HHsearch alignment for GI: 254780321 and conserved domain: KOG1673

>KOG1673 consensus.
Probab=93.77  E-value=0.44  Score=26.75  Aligned_cols=153  Identities=18%  Similarity=0.306  Sum_probs=84.5

Q ss_pred             EEEEECCCCCCHHHHHHHHHHHCCCCCCCCCCCEEECCCHHHHHHCCEEEEEEEEEEEECCCCCEEEEEEEECCCCCHHH
Q ss_conf             79998013898778899999982980544443113058677987195052327999974378843899996178730027
Q gi|254780321|r   13 NFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVRLNYTSTDAKDYQLNLIDTPGHVDFT   92 (606)
Q Consensus        13 N~~IiaHvDhGKTTL~d~lL~~tg~i~~~~~~~~vlD~~~~EreRGITIka~~~~~~~~~~~~~~y~iNlIDTPGH~DF~   92 (606)
T Consensus        22 kv~llGD~qiGKTs~mv---kYV~~~~d----------e~~~q~~GvN~mdkt~~i~-----~t~IsfSIwdlgG~~~~~   83 (205)
T KOG1673          22 KVGLLGDAQIGKTSLMV---KYVQNEYD----------EEYTQTLGVNFMDKTVSIR-----GTDISFSIWDLGGQREFI   83 (205)
T ss_pred             EEEEECCCCCCCEEEEH---HHHCCHHH----------HHHHHHHCCCCEEEEEEEC-----CEEEEEEEEECCCCHHHH
T ss_conf             99851365458354304---45413127----------8888874740021078862-----408999987437747554


Q ss_pred             HHHHHHHH-HCCEE---EEEEECCCCCCHHHH-HHHHHHHHCCCCEEEE--ECCCC----CCCCCCCCHHHHHHHHHHHH
Q ss_conf             99999997-30268---999986878865589-9999999709967998--32678----87532113388877555322
Q gi|254780321|r   93 YEVSRSLS-ACEGS---LLVVDATQGVEAQTL-ANVYQAIDNNHEIITV--LNKAD----LPSADPDRVKKQIEETIGIS  161 (606)
Q Consensus        93 ~EV~r~l~-a~dga---iLvVdA~~Gvq~QT~-~~~~~A~~~~l~~I~v--iNKiD----~~~A~~e~v~~ei~~~~g~~  161 (606)
T Consensus        84 n----~lPiac~dsvaIlFmFDLt~r~TLnSi~~WY~QAr~~NktAiPilvGTKyD~fi~lp~e~Q~~I~~qar~YAk~m  159 (205)
T KOG1673          84 N----MLPIACKDSVAILFMFDLTRRSTLNSIKEWYRQARGLNKTAIPILVGTKYDLFIDLPPELQETISRQARKYAKVM  159 (205)
T ss_pred             C----CCCEEECCCEEEEEEEECCCHHHHHHHHHHHHHHHCCCCCCCEEEECCCHHHHHCCCHHHHHHHHHHHHHHHHHH
T ss_conf             0----476544473799999844766778889999998742577531388524357662489889899999999999973


Q ss_pred             HHHHHHHHHHCCCCCCHHHHHHHHHH
Q ss_conf             32100011100223200678776321
Q gi|254780321|r  162 TEDALLVSAKTGEGIPLLLERIVQQL  187 (606)
Q Consensus       162 ~~~ii~vSAktG~GV~~LLd~Iv~~i  187 (606)
T Consensus       160 nAsL~F~Sts~sINv~KIFK~vlAkl  185 (205)
T KOG1673         160 NASLFFCSTSHSINVQKIFKIVLAKL  185 (205)
T ss_pred             CCCEEEEECCCCCCHHHHHHHHHHHH
T ss_conf             78379861365202999999999998