HHsearch alignment for GI: 254780321 and conserved domain: PRK00089

>PRK00089 era GTP-binding protein Era; Reviewed.
Probab=99.76  E-value=2.8e-17  Score=135.51  Aligned_cols=158  Identities=25%  Similarity=0.290  Sum_probs=113.0

Q ss_pred             CEEEEEECCCCCCHHHHHHHHHHHCCCCCCCCCCCEEECCCHHHHHHCCEEEEEEEEEEEECCCCCEEEEEEEECCCCCH
Q ss_conf             31799980138987788999999829805444431130586779871950523279999743788438999961787300
Q gi|254780321|r   11 IRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVRLNYTSTDAKDYQLNLIDTPGHVD   90 (606)
Q Consensus        11 IRN~~IiaHvDhGKTTL~d~lL~~tg~i~~~~~~~~vlD~~~~EreRGITIka~~~~~~~~~~~~~~y~iNlIDTPGH~D   90 (606)
T Consensus         8 sG~VaivG~PNvGKSTL~N~l~~~k~siVS~k~--------------~TTR~--~i~gi~---~~~~~q~i~iDTpGi~~   68 (296)
T PRK00089          8 SGFVAIVGRPNVGKSTLLNALVGQKISIVSPKP--------------QTTRH--RIRGIV---TEDDAQIIFVDTPGIHK   68 (296)
T ss_pred             EEEEEEECCCCCCHHHHHHHHHCCCEEEECCCC--------------CCCCC--CEEEEE---EECCEEEEEEECCCCCC
T ss_conf             799999989998889999999689617614959--------------98728--389999---97997999998998667


Q ss_pred             --------HHHHHHHHHHHCCEEEEEEECCCCCCHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCCHHHHHHHHHH-HH
Q ss_conf             --------279999999730268999986878865589999999970996799832678875321133888775553-22
Q gi|254780321|r   91 --------FTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQAIDNNHEIITVLNKADLPSADPDRVKKQIEETIG-IS  161 (606)
Q Consensus        91 --------F~~EV~r~l~a~dgaiLvVdA~~Gvq~QT~~~~~~A~~~~l~~I~viNKiD~~~A~~e~v~~ei~~~~g-~~  161 (606)
T Consensus        69 ~~~~l~~~~~~~~~~ai~~aDlil~viD~~~~~~~~d~~i~~~l~~~~kp~ilviNKiDlv--~k~~l~~~~~~l~~~~~  146 (296)
T PRK00089         69 PKRALNRAMNKAAWSSLKDVDLVLFVVDADEKIGPGDEFILEKLKKVKTPVILVLNKIDLV--DKEELLPLLEELSELMD  146 (296)
T ss_pred             CHHHHHHHHHHHHHHHHHHCCEEEEEEECCCCCCHHHHHHHHHHHHCCCCEEEEEEHHHHC--CHHHHHHHHHHHHHHCC
T ss_conf             4677878999999999975999999985788989889999998887499889995478842--89889999999985379


Q ss_pred             HHHHHHHHHHCCCCCCHHHHHHHHHHHC
Q ss_conf             3210001110022320067877632100
Q gi|254780321|r  162 TEDALLVSAKTGEGIPLLLERIVQQLPS  189 (606)
Q Consensus       162 ~~~ii~vSAktG~GV~~LLd~Iv~~iP~  189 (606)
T Consensus       147 f~~if~iSA~~~~gi~~L~~~l~~~lp~  174 (296)
T PRK00089        147 FAEIVPISALKGDNVDELLDLIAKYLPE  174 (296)
T ss_pred             CCEEEEEECCCCCCHHHHHHHHHHHCCC
T ss_conf             7659999677888989999999986798