HHsearch alignment for GI: 254780321 and conserved domain: PRK00093

>PRK00093 engA GTP-binding protein EngA; Reviewed.
Probab=99.71  E-value=2.9e-16  Score=128.66  Aligned_cols=155  Identities=25%  Similarity=0.283  Sum_probs=113.9

Q ss_pred             EEEEECCCCCCHHHHHHHHHHHCCCCCCCCCCCEEECCCHHHHHHCCEEEEEEEEEEEECCCCCEEEEEEEECCCCCH--
Q ss_conf             799980138987788999999829805444431130586779871950523279999743788438999961787300--
Q gi|254780321|r   13 NFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVRLNYTSTDAKDYQLNLIDTPGHVD--   90 (606)
Q Consensus        13 N~~IiaHvDhGKTTL~d~lL~~tg~i~~~~~~~~vlD~~~~EreRGITIka~~~~~~~~~~~~~~y~iNlIDTPGH~D--   90 (606)
T Consensus         3 ~VaIvGrpNvGKStLfN~l~~~~~aIv~--------~------~~G~TRD~~~~~~~-----~~~~~~~lvDT~G~~~~~   63 (438)
T PRK00093          3 VVAIVGRPNVGKSTLFNRLTGKRDAIVA--------D------TPGVTRDRIYGEAE-----WLGREFIVIDTGGIDPGD   63 (438)
T ss_pred             EEEEECCCCCCHHHHHHHHHCCCEEEEC--------C------CCCCCCCCEEEEEE-----ECCEEEEEEECCCCCCCC
T ss_conf             8999899998789999998688618715--------9------89998471589999-----999289999897989888


Q ss_pred             ---HHHH----HHHHHHHCCEEEEEEECCCCCCHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCCHHHHHHHHHHHHHH
Q ss_conf             ---2799----999997302689999868788655899999999709967998326788753211338887755532232
Q gi|254780321|r   91 ---FTYE----VSRSLSACEGSLLVVDATQGVEAQTLANVYQAIDNNHEIITVLNKADLPSADPDRVKKQIEETIGISTE  163 (606)
Q Consensus        91 ---F~~E----V~r~l~a~dgaiLvVdA~~Gvq~QT~~~~~~A~~~~l~~I~viNKiD~~~A~~e~v~~ei~~~~g~~~~  163 (606)
T Consensus        64 ~~~~~~~i~~q~~~ai~~aDlIlfVvD~~~git~~D~~i~~~Lrk~~k~vilviNK~D~~~~-----~~~~~ef~~LGf~  138 (438)
T PRK00093         64 EDGFEKQMREQALLAIEEADVILFVVDGRAGLTPADEEIAKILRKSNKPVILVVNKVDGKKM-----EADAYEFYSLGLG  138 (438)
T ss_pred             CHHHHHHHHHHHHHHHHHCCEEEEEEECCCCCCHHHHHHHHHHHHCCCCEEEEEECCCCCCH-----HHHHHHHHHHCCC
T ss_conf             20799999999999998589999998377689878999999999739978999975566320-----3459999983689


Q ss_pred             HHHHHHHHCCCCCCHHHHHHHHHHHCCC
Q ss_conf             1000111002232006787763210001
Q gi|254780321|r  164 DALLVSAKTGEGIPLLLERIVQQLPSPT  191 (606)
Q Consensus       164 ~ii~vSAktG~GV~~LLd~Iv~~iP~P~  191 (606)
T Consensus       139 ~~i~iSA~h~~Gi~~L~~~i~~~l~~~~  166 (438)
T PRK00093        139 EPYPISAEHGRGIGDLLDAILELLPEEE  166 (438)
T ss_pred             CEEEEEECCCCCHHHHHHHHHHHCCCCC
T ss_conf             8188853056698999999985488554