HHsearch alignment for GI: 254780321 and conserved domain: PRK09554

>PRK09554 feoB ferrous iron transport protein B; Reviewed.
Probab=99.32  E-value=6.2e-11  Score=92.88  Aligned_cols=153  Identities=20%  Similarity=0.328  Sum_probs=104.8

Q ss_pred             HHHCEEEEEECCCCCCHHHHHHHHHHHCCCCCCCCCCCEEECCCHHHHHHCCEEEEEEEEEEEECCCCCEEEEEEEECCC
Q ss_conf             52531799980138987788999999829805444431130586779871950523279999743788438999961787
Q gi|254780321|r    8 LSRIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVRLNYTSTDAKDYQLNLIDTPG   87 (606)
Q Consensus         8 ~~~IRN~~IiaHvDhGKTTL~d~lL~~tg~i~~~~~~~~vlD~~~~EreRGITIka~~~~~~~~~~~~~~y~iNlIDTPG   87 (606)
T Consensus         1 Mk~i-~IALvGNPN~GKSTLFN~L---TG~~q--~VgNw----------PGvTVEkk~G~~~~-----~~~~~~ivDLPG   59 (772)
T PRK09554          1 MKKL-TIGLIGNPNSGKTTLFNQL---TGARQ--RVGNW----------AGVTVERKEGQFST-----TDHQVTLVDLPG   59 (772)
T ss_pred             CCCC-EEEEECCCCCCHHHHHHHH---HCCCC--EEECC----------CCCEEEEEEEEEEE-----CCCEEEEEECCC
T ss_conf             9735-6998889987899999998---68998--35789----------97647423899996-----894699997997


Q ss_pred             CCHHH---------HHHHHH-HH--HCCEEEEEEECCCCCCHHHHHHHHHH---HHCCCCEEEEECCCCCCCCCCCC-HH
Q ss_conf             30027---------999999-97--30268999986878865589999999---97099679983267887532113-38
Q gi|254780321|r   88 HVDFT---------YEVSRS-LS--ACEGSLLVVDATQGVEAQTLANVYQA---IDNNHEIITVLNKADLPSADPDR-VK  151 (606)
Q Consensus        88 H~DF~---------~EV~r~-l~--a~dgaiLvVdA~~Gvq~QT~~~~~~A---~~~~l~~I~viNKiD~~~A~~e~-v~  151 (606)
T Consensus        60 ~YSL~~~S~e~s~dE~Var~~ll~~~pDvvvnVvDAtn-----LeRnLyLt~QllElg~PvVvaLNM~D~A~~~Gi~ID~  134 (772)
T PRK09554         60 TYSLTTISSQTSLDEQIACHYILSGDADLLINVVDASN-----LERNLYLTLQLLELGIPCIVALNMLDIAEKQNIRIDI  134 (772)
T ss_pred             CCCCCCCCCCCCCHHHHHHHHHHCCCCCEEEEEEECCC-----HHHHHHHHHHHHHCCCCEEEEEECHHHHHHCCCEECH
T ss_conf             78699999777730899999861399989999801687-----5442899999997499989998779989887793289


Q ss_pred             HHHHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHC
Q ss_conf             88775553223210001110022320067877632100
Q gi|254780321|r  152 KQIEETIGISTEDALLVSAKTGEGIPLLLERIVQQLPS  189 (606)
Q Consensus       152 ~ei~~~~g~~~~~ii~vSAktG~GV~~LLd~Iv~~iP~  189 (606)
T Consensus       135 ~~Ls~~LGvP---VV~~~A~~g~Gi~eL~~ai~~~~~~  169 (772)
T PRK09554        135 DALSARLGCP---VIPLVSTRGRGIEALKLAIDRYKAN  169 (772)
T ss_pred             HHHHHHHCCC---EEEEEECCCCCHHHHHHHHHHHHCC
T ss_conf             9999985899---8999827887999999999975225