HHsearch alignment for GI: 254780321 and conserved domain: PRK11058

>PRK11058 putative GTPase HflX; Provisional.
Probab=99.15  E-value=3e-09  Score=81.55  Aligned_cols=156  Identities=25%  Similarity=0.331  Sum_probs=93.0

Q ss_pred             HCEEEEEECCCCCCHHHHHHHHHHHCCCCCCCCCCCEEECCCHHHHHHCCEEEEEEEEEEEECCCCCEEEEEEEECCCCC
Q ss_conf             53179998013898778899999982980544443113058677987195052327999974378843899996178730
Q gi|254780321|r   10 RIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVRLNYTSTDAKDYQLNLIDTPGHV   89 (606)
Q Consensus        10 ~IRN~~IiaHvDhGKTTL~d~lL~~tg~i~~~~~~~~vlD~~~~EreRGITIka~~~~~~~~~~~~~~y~iNlIDTPGH~   89 (606)
T Consensus       196 ~~~~ValVGYTNAGKSTL~n~Lt~-~~v~~----~d~LFATLD~----------t~R~~~--l~~~~~--~lltDTVGFI  256 (426)
T PRK11058        196 DVPTVSLVGYTNAGKSTLFNRITE-ARVYA----ADQLFATLDP----------TLRRID--VADVGE--TVLADTVGFI  256 (426)
T ss_pred             CCCEEEEECCCCCCHHHHHHHHHC-CCCCC----CCCCCCCCCC----------CEEEEE--CCCCCE--EEEECCCHHH
T ss_conf             997699973577778999877752-88763----2545014786----------202678--699986--9997150666


Q ss_pred             H---------HHHHHHHHHHHCCEEEEEEECCCC-CCHHHHHHHHHHHHC---CCCEEEEECCCCCCCCCCCCHHHHHHH
Q ss_conf             0---------279999999730268999986878-865589999999970---996799832678875321133888775
Q gi|254780321|r   90 D---------FTYEVSRSLSACEGSLLVVDATQG-VEAQTLANVYQAIDN---NHEIITVLNKADLPSADPDRVKKQIEE  156 (606)
Q Consensus        90 D---------F~~EV~r~l~a~dgaiLvVdA~~G-vq~QT~~~~~~A~~~---~l~~I~viNKiD~~~A~~e~v~~ei~~  156 (606)
T Consensus       257 ~~LP~~LveAF~sTLeE-v~~ADlLLhVvD~S~p~~~~q~~~v~~vL~elg~~~~p~i~V~NKiD~~~~~~~----~~~~  331 (426)
T PRK11058        257 RHLPHDLVAAFKATLQE-TRQATLLLHVIDAADVRVQENIEAVNTVLEEIDAHEIPTLLVMNKIDMLDDFEP----RIDR  331 (426)
T ss_pred             HHCCHHHHHHHHHHHHH-HHCCCEEEEEEECCCCCHHHHHHHHHHHHHHCCCCCCCEEEEEECCCCCCCHHH----HHHH
T ss_conf             51989999999999999-963988999984999379999999999999759999977999977023896445----5666


Q ss_pred             HHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHCC
Q ss_conf             5532232100011100223200678776321000
Q gi|254780321|r  157 TIGISTEDALLVSAKTGEGIPLLLERIVQQLPSP  190 (606)
Q Consensus       157 ~~g~~~~~ii~vSAktG~GV~~LLd~Iv~~iP~P  190 (606)
T Consensus       332 ~-~~~~p~~V~iSA~tg~Gi~~L~~~I~~~L~~~  364 (426)
T PRK11058        332 D-EENKPIRVWLSAQTGAGIPLLFQALTERLSGE  364 (426)
T ss_pred             H-HCCCCCEEEEECCCCCCHHHHHHHHHHHCCCC
T ss_conf             5-33998779997899989999999999870337