HHsearch alignment for GI: 254780321 and conserved domain: PRK13351

>PRK13351 elongation factor G; Reviewed.
Probab=100.00  E-value=0  Score=860.96  Aligned_cols=466  Identities=32%  Similarity=0.468  Sum_probs=409.4

Q ss_pred             CCCHHHCEEEEEECCCCCCHHHHHHHHHHHCCCCCCCC---CCCEEECCCHHHHHHCCEEEEEEEEEEEECCCCCEEEEE
Q ss_conf             99852531799980138987788999999829805444---431130586779871950523279999743788438999
Q gi|254780321|r    5 PTPLSRIRNFSIVAHIDHGKSTLADRFIQHCRGLTERE---MSSQVLDNMDIERERGITIKAQTVRLNYTSTDAKDYQLN   81 (606)
Q Consensus         5 ~~p~~~IRN~~IiaHvDhGKTTL~d~lL~~tg~i~~~~---~~~~vlD~~~~EreRGITIka~~~~~~~~~~~~~~y~iN   81 (606)
T Consensus         2 ~~~~e~IRNi~IiaHvd~GKTTL~d~Ll~~~g~i~~~g~v~~g~t~~D~~~~E~eRgITikss~~sl~~-----~~~~iN   76 (687)
T PRK13351          2 EMPLMQIRNIGIMAHIDAGKTTLTERILFYTGKIHKMGSVEDGNTVSDWMPQEQERGISIESAAATCDW-----KNHRIN   76 (687)
T ss_pred             CCCHHHCCEEEEECCCCCCHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCHHHHHCCCCEEEEEEEEEE-----CCEEEE
T ss_conf             998689308999917998989999999997499875871547874478829999749877621599988-----998999


Q ss_pred             EEECCCCCHHHHHHHHHHHHCCEEEEEEECCCCCCHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCCHHHHHHHHHHHH
Q ss_conf             96178730027999999973026899998687886558999999997099679983267887532113388877555322
Q gi|254780321|r   82 LIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQAIDNNHEIITVLNKADLPSADPDRVKKQIEETIGIS  161 (606)
Q Consensus        82 lIDTPGH~DF~~EV~r~l~a~dgaiLvVdA~~Gvq~QT~~~~~~A~~~~l~~I~viNKiD~~~A~~e~v~~ei~~~~g~~  161 (606)
T Consensus        77 lIDTPGHvDF~~Ev~~aLr~~DgallVVDaveGv~~qT~~v~r~a~~~~lp~il~iNK~DR~~~d~~~~l~~i~~~l~~~  156 (687)
T PRK13351         77 LIDTPGHIDFTGEVERSLRVLDGAVVVIDAVTGVQPQTETVWEQADKYKIPRLIFINKMDRVGADLFDVLEDIEEKFGKR  156 (687)
T ss_pred             EEECCCCCCHHHHHHHHHHHHCEEEEEEECCCCCCHHHHHHHHHHHHCCCCEEEEEECCCCCCCCHHHHHHHHHHHHCCC
T ss_conf             98097974309999999998786899997899986889999999998799859999797789987667788999984896


Q ss_pred             H-------------------------------------------------------------------------------
Q ss_conf             3-------------------------------------------------------------------------------
Q gi|254780321|r  162 T-------------------------------------------------------------------------------  162 (606)
Q Consensus       162 ~-------------------------------------------------------------------------------  162 (606)
T Consensus       157 ~~~~~~p~~~~~~~~~~id~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~e~~~~~dd~lle~~l~~~~~~~  236 (687)
T PRK13351        157 PLPLQLPIGSGDSFEGVVDLITEKELHFKEGDGGDTVEERPIPEELLEEVASAREKLIDALLEFDDELLELYLEGEEITA  236 (687)
T ss_pred             EEEEEECCCCCCCCCCEEEECCCHHHCCCCCCCCCEEEECCCCHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHCCCCCCH
T ss_conf             47786001356555641663110122002455685057725628889999999999999998308999999874887889


Q ss_pred             -------------HH---HHHHHHHCCCCCCHHHHHHHHHHHCCCC----------------HHHHHCCCCCCCCCEEEC
Q ss_conf             -------------21---0001110022320067877632100011----------------112201233101210114
Q gi|254780321|r  163 -------------ED---ALLVSAKTGEGIPLLLERIVQQLPSPTS----------------PEGANAPLKALLIDSWYN  210 (606)
Q Consensus       163 -------------~~---ii~vSAktG~GV~~LLd~Iv~~iP~P~~----------------~~~~~~Pl~alVfds~~D  210 (606)
T Consensus       237 ~~l~~~l~~~~~~~~~~Pv~~gsa~~~~Gv~~LLd~i~~~lPsP~e~~~~~~~~~~~~~~~~~~~~~~p~~a~V~K~~~~  316 (687)
T PRK13351        237 EQLRAPFRRGLRSGHLVPVLFGSALKNIGIRPLLDAVVEYLPSPLEGNPPAGSKGTEKKVLVNPDPEKPLLALVFKVQYD  316 (687)
T ss_pred             HHHHHHHHHHHHHCCCCHHHCCCCCCCCCHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCEEEEEEEEEEC
T ss_conf             99999999999848724123030335878588999998708992103454565666640014579998708999997874


Q ss_pred             CCCCEEEEEEECCCCCCCCCEEEEECCCCCCCCCCCCCCCC-CEEEEHHCCCCCHHHHHHCCCCCCCCCCCCEECCCCCC
Q ss_conf             75725999981698735584588733556421012223355-41240101247123322011002444454200046678
Q gi|254780321|r  211 SYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVERIGILTP-KMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSP  289 (606)
Q Consensus       211 ~~~G~I~~~RV~sG~lk~Gd~I~~~~~g~~~~v~~ig~~~~-~~~~v~~l~aGdVG~ii~gik~l~~~~vGDTl~~~~~p  289 (606)
T Consensus       317 ~~~g~~s~~RV~sGtL~~g~~v~~~~~~~~e~i~~l~~~~g~~~~~v~~~~aG~Iv----~i~gl~~~~~g~tl~~~~~~  392 (687)
T PRK13351        317 PYAGKLTYLRVYQGTLRSGSQLYNGSGRKREKVGRIFRLQGNKREEVDEAKAGDIV----AVAGLKELETGDTLHDEEGN  392 (687)
T ss_pred             CCCCEEEEEEEECCEECCCCEEEECCCCCEEEECCEEEECCCCCCCCCEECCCCEE----EEECCCCCCCCCEECCCCCC
T ss_conf             88975899998534545798776348983599676146426775414886779889----99587647568870589987


Q ss_pred             CCCCCCCCCCCCCEEEEEECCCCHHHHHHHHHHHHHHHHHCCCCCCC--CCCCCCCCCEEEEEECCHHHHHHHHHHHHHH
Q ss_conf             53236455222212664212677024578899998886411221112--5676000420289963767898889888664
Q gi|254780321|r  290 TTSALPGFKPIQPVVFCGLFPVDATQFENLRTAINKLRLNDASFSFE--LENSTALGFGFRCGFLGLLHLEIIQERLERE  367 (606)
Q Consensus       290 ~~~~Lp~~~~~~P~v~~~i~p~~~~d~~~L~~aL~kL~~~D~sl~~e--~Ets~aLg~Gfr~gglG~LHLeVi~eRL~rE  367 (606)
T Consensus       393 ~--~~~~~~~~~Pv~~vaieP~~~~d~~kL~~aL~~L~~eDPsl~v~~~eetge~v-----i~g~GElHLe~~l~~L~~~  465 (687)
T PRK13351        393 V--HLEPLTFPEPVFSLAVEPERRGDEQKLAEALEKLVWEDPTLRVEEDEETGQTI-----LSGMGELHLEIALERLRRE  465 (687)
T ss_pred             C--CCCCCCCCCCCEEEEEEECCHHHHHHHHHHHHHHHHHCCCEEEEECCCCEEEE-----EECCCHHHHHHHHHHHHHH
T ss_conf             5--68999999985167688678136889999999998539837999837541887-----6588899999999988887


Q ss_pred             CCCEEEEECCCCCEEEEEE-------------------------------------------------------------
Q ss_conf             4950697378233033531-------------------------------------------------------------
Q gi|254780321|r  368 FSLNLIGTSPSVVYELYMH-------------------------------------------------------------  386 (606)
Q Consensus       368 fg~ev~~t~P~V~Ykv~~~-------------------------------------------------------------  386 (606)
T Consensus       466 f~vev~vs~p~V~yrETi~~~~~~~~~~~k~~~~~~~~~~v~l~~eP~~~g~g~~~~~~~~~g~~~~~~~~aI~~G~~~a  545 (687)
T PRK13351        466 FKLEVNTGKPQVAYRETIRKMAEGVYRHKKQFGGKGQFGEVHLRVEPLERGAGFEFVSKVVGGAVPEELIPAVEKGIREA  545 (687)
T ss_pred             HCCCEEEECCCCEEEEEECCCCCCCEEEEEECCCCCCCEEEEEEECCCCCCCCCEEECCCCCCCCCHHHHHHHHHHHHHH
T ss_conf             19845852883027864025642222576504887632279999724667875088146568868566778999999999


Q ss_pred             -------------------CCCEEECCC-HHHCCCHHHHH----------HHHCCEEEEEEEECCCCCHHHHHHHHHHHH
Q ss_conf             -------------------564541269-66625867788----------862326999998083100038999886300
Q gi|254780321|r  387 -------------------DGSMQKLSN-PIDMPEVTKIA----------ELREPWIQVTIITPNEYLGSILKLCQERRG  436 (606)
Q Consensus       387 -------------------dG~~~~Vd~-p~~~p~~~~i~----------~i~EPi~~~~I~~P~ey~G~Vm~~l~~RRG  436 (606)
T Consensus       546 ~~~GpL~g~pv~~v~v~l~d~~~~~~~~~~~~~~~a~~~a~~~a~~~a~p~LlEPi~~~eI~~p~~~~g~V~~~L~~RRG  625 (687)
T PRK13351        546 LASGPLAGYPVTDLRVTVLDGKYHSVDSSESAFVKAARKAFLEAVRKANPVLLEPIMELEITVPTEHVGDVLGDLSQRRG  625 (687)
T ss_pred             HHCCCCCCCCEEEEEEEEEECCCCCCCCCHHHHHHHHHHHHHHHHHHCCCEEECCEEEEEEEECHHHHHHHHHHHHHCCC
T ss_conf             96396689952506999982687888887678999999999999985698897782899999688999999999986698


Q ss_pred             EEECCCCCC-CEEEEEEEECHHHHHHHHHHHHHHHCCCEEEEEEEECCCEEC
Q ss_conf             142443368-369999996043332204687676357418889854354643
Q gi|254780321|r  437 IQIDMSHLD-NRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDYRDS  487 (606)
Q Consensus       437 ~~~~m~~~~-~~~~i~~~vPl~Eli~~f~~~LkS~T~G~as~~ye~~~Y~~~  487 (606)
T Consensus       626 ~i~~~~~~~~~~~~I~a~vPv~e~-~g~~~~LRs~T~G~a~~~~~F~~~e~v  676 (687)
T PRK13351        626 KIHGTEPIGDGKVLVKAEAPLAEL-FGYATRLRSMTKGRGSFTMEFSHFDPV  676 (687)
T ss_pred             EEECCEECCCCEEEEEEEECHHHH-HCHHHHHHHCCCCCEEEEEEECCCCCC
T ss_conf             886727459976999999886786-086687463088836999995755239