HHsearch alignment for GI: 254780321 and conserved domain: TIGR00073

>TIGR00073 hypB hydrogenase accessory protein HypB; InterPro: IPR004392 The hydrogenase accessory protein HypB is a GTP hydrolase for assembly of nickel metallocentre of hydrogenase. A similar protein, ureG, is an accessory protein for urease, which also uses nickel.; GO: 0016151 nickel ion binding, 0006461 protein complex assembly.
Probab=98.42  E-value=5.2e-07  Score=66.53  Aligned_cols=149  Identities=25%  Similarity=0.367  Sum_probs=91.3

Q ss_pred             EEEEECCCCCCHHHHHHHHHHHCCCCCCCC--CCCEEECCCHHHHHH--CCEEEEEEEE------EE----E--------
Q ss_conf             799980138987788999999829805444--431130586779871--9505232799------99----7--------
Q gi|254780321|r   13 NFSIVAHIDHGKSTLADRFIQHCRGLTERE--MSSQVLDNMDIERER--GITIKAQTVR------LN----Y--------   70 (606)
Q Consensus        13 N~~IiaHvDhGKTTL~d~lL~~tg~i~~~~--~~~~vlD~~~~EreR--GITIka~~~~------~~----~--------   70 (606)
T Consensus        36 ~lNfmsspGSGKT~LiEk~~~~~~~~~K~Avi~GD~~-t~~DA~RlR~~G~~a--~~~nTGk~CHLdA~mv~G~~~~L~~  112 (225)
T TIGR00073        36 VLNFMSSPGSGKTTLIEKLIERLDDEVKIAVIEGDVQ-TKNDADRLRKYGVPA--IQINTGKECHLDAHMVAGAIHALKD  112 (225)
T ss_pred             EEEECCCCCCCHHHHHHHHHHHHCCCCCEEEEECCHH-HHHHHHHHHHCCCEE--EEECCCCCCCCHHHHHHHHHHHHHC
T ss_conf             9980258861158999999998457897899975532-255699998649868--8636886444016678658755421


Q ss_pred             ECCCCC-EEEE-----EEEECCCCCHHHHHHHHHHHHCCEEEEEEECCCC---CC--HHHHHHHHHHHHCCCCEEEEECC
Q ss_conf             437884-3899-----9961787300279999999730268999986878---86--55899999999709967998326
Q gi|254780321|r   71 TSTDAK-DYQL-----NLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQG---VE--AQTLANVYQAIDNNHEIITVLNK  139 (606)
Q Consensus        71 ~~~~~~-~y~i-----NlIDTPGH~DF~~EV~r~l~a~dgaiLvVdA~~G---vq--~QT~~~~~~A~~~~l~~I~viNK  139 (606)
T Consensus       113 ~~ld~~~DlL~IENVGNLv-CP~~FdLGe---------~~rVvllSVTEGdDk~lKyP~~---F~~Ad------~~~inK  173 (225)
T TIGR00073       113 LPLDDISDLLLIENVGNLV-CPADFDLGE---------HMRVVLLSVTEGDDKVLKYPAM---FKEAD------LILINK  173 (225)
T ss_pred             CCCCCCCCEEEEEECCCCE-ECCCCCCCC---------CCEEEEEEECCCCCCCCCCCHH---HHHHH------HHHHCH
T ss_conf             6888714626886447610-067311235---------6307999865899965466158---87444------562147


Q ss_pred             CCCC---CCCCCCHHHHHHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHH
Q ss_conf             7887---532113388877555322321000111002232006787763
Q gi|254780321|r  140 ADLP---SADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERIVQ  185 (606)
Q Consensus       140 iD~~---~A~~e~v~~ei~~~~g~~~~~ii~vSAktG~GV~~LLd~Iv~  185 (606)
T Consensus       174 ~DL~~~v~~D~ek~~~d~~~~n--P~a~Ii~~S~ktg~Gl~~w~~~l~~  220 (225)
T TIGR00073       174 VDLAEAVGFDVEKMKADARKIN--PEAEIILVSAKTGKGLDEWLEFLEG  220 (225)
T ss_pred             HHHHHHHCCCHHHHHHHHHHHC--CCEEEEEEECCCCCCHHHHHHHHHH
T ss_conf             8899770736789999998628--9507998636897347899999998