HHsearch alignment for GI: 254780321 and conserved domain: TIGR01393

>TIGR01393 lepA GTP-binding protein LepA; InterPro: IPR006297 LepA (GUF1 in Saccaromyces) is a GTP-binding membrane protein related to EF-G and EF-Tu. Two types of phylogenetic tree, rooted by other GTP-binding proteins, suggest that eukaryotic homologs (including GUF1 of yeast) originated within the bacterial LepA family. The function of the proteins in this family are unknown. ; GO: 0005525 GTP binding.
Probab=100.00  E-value=0  Score=2101.66  Aligned_cols=594  Identities=63%  Similarity=1.066  Sum_probs=589.9

Q ss_pred             HHCEEEEEECCCCCCHHHHHHHHHHHCCCCCCCCCCCEEECCCHHHHHHCCEEEEEEEEEEEE-CCCCCEEEEEEEECCC
Q ss_conf             253179998013898778899999982980544443113058677987195052327999974-3788438999961787
Q gi|254780321|r    9 SRIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVRLNYT-STDAKDYQLNLIDTPG   87 (606)
Q Consensus         9 ~~IRN~~IiaHvDhGKTTL~d~lL~~tg~i~~~~~~~~vlD~~~~EreRGITIka~~~~~~~~-~~~~~~y~iNlIDTPG   87 (606)
T Consensus         1 ~~IRNFsIIAHIDHGKSTLADRlle~T~~~s~R~m~~Q~LD~MDlERERGITIK~qaV~l~Yk~~~DGe~Y~LNLIDTPG   80 (598)
T TIGR01393         1 KNIRNFSIIAHIDHGKSTLADRLLEKTGAVSEREMREQVLDSMDLERERGITIKAQAVRLKYKVAKDGETYVLNLIDTPG   80 (598)
T ss_pred             CCCCCEEEEEEECCCCCHHHHHHHHHCCCCCCHHHHHCCCCCCCEEECCCCEEECCCEEEEEEEECCCCEEEEEEECCCC
T ss_conf             98752678846248932488999986174562025430577510000058201156347533753388788996452889


Q ss_pred             CCHHHHHHHHHHHHCCEEEEEEECCCCCCHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCCHHHHHHHHHHHHHHHHHH
Q ss_conf             30027999999973026899998687886558999999997099679983267887532113388877555322321000
Q gi|254780321|r   88 HVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQAIDNNHEIITVLNKADLPSADPDRVKKQIEETIGISTEDALL  167 (606)
Q Consensus        88 H~DF~~EV~r~l~a~dgaiLvVdA~~Gvq~QT~~~~~~A~~~~l~~I~viNKiD~~~A~~e~v~~ei~~~~g~~~~~ii~  167 (606)
T Consensus        81 HVDFsYEVSRSLAACEGALL~VDA~QGvEAQT~aN~YlAlE~dLeIIPViNKIDLP~Adpe~v~~eIe~~iGld~~~ai~  160 (598)
T TIGR01393        81 HVDFSYEVSRSLAACEGALLLVDAAQGVEAQTLANVYLALENDLEIIPVINKIDLPSADPERVKKEIEEVIGLDASEAIL  160 (598)
T ss_pred             CCCCCHHHHHHHHHHCCEEEEEECCCCHHHHHHHHHHHHHHCCCEEEEEECCCCCCCCCHHHHHHHHHHHCCCCCCCCEE
T ss_conf             72127378888887164035614103235888999988756187584778253688888589999876541889643038


Q ss_pred             HHHHCCCCCCHHHHHHHHHHHCCCCHHHHH-CCCCCCCCCEEECCCCCEEEEEEECCCCCCCCCEEEEECCCCCCCCCCC
Q ss_conf             111002232006787763210001111220-1233101210114757259999816987355845887335564210122
Q gi|254780321|r  168 VSAKTGEGIPLLLERIVQQLPSPTSPEGAN-APLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVERI  246 (606)
Q Consensus       168 vSAktG~GV~~LLd~Iv~~iP~P~~~~~~~-~Pl~alVfds~~D~~~G~I~~~RV~sG~lk~Gd~I~~~~~g~~~~v~~i  246 (606)
T Consensus       161 ~SAKtG~Gi~e~LEaIv~~vPpP~G--d~~DapLkALIFDS~YD~YrGVv~~vRv~~G~ik~gD~I~~Mstgk~y~V~ev  238 (598)
T TIGR01393       161 ASAKTGIGIEEILEAIVKRVPPPKG--DPDDAPLKALIFDSHYDNYRGVVVLVRVFEGTIKKGDKIRFMSTGKEYEVDEV  238 (598)
T ss_pred             EEECCCCCHHHHHHHHHHCCCCCCC--CCCCCCCEEEEEEEEECCCCEEEEEEEEEECEECCCCEEEEEECCCEEEEEEE
T ss_conf             7503678889998897101810011--38886632278843543865089999995268646988999534876667550


Q ss_pred             CCCCCCE-EEEHHCCCCCHHHHHHCCCCCCCCCCCCEECCCCCCCCCCCCCCCCCCCEEEEEECCCCHHHHHHHHHHHHH
Q ss_conf             2335541-240101247123322011002444454200046678532364552222126642126770245788999988
Q gi|254780321|r  247 GILTPKM-IDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVVFCGLFPVDATQFENLRTAINK  325 (606)
Q Consensus       247 g~~~~~~-~~v~~l~aGdVG~ii~gik~l~~~~vGDTl~~~~~p~~~~Lp~~~~~~P~v~~~i~p~~~~d~~~L~~aL~k  325 (606)
T Consensus       239 G~~~P~~~~~~~~L~aGeVGy~~AgIK~v~D~~VGDTiT~~~~Pa~eplpGF~~~KP~VFaGlYPid~~~Ye~LrdALeK  318 (598)
T TIGR01393       239 GVFTPKLEVKTQELSAGEVGYIIAGIKDVSDVKVGDTITSVKNPAKEPLPGFKEVKPMVFAGLYPIDTEDYEDLRDALEK  318 (598)
T ss_pred             EEECCCCCCCCCCEECCCEEEEEEEEEECCCEECCCEEECCCCCCCCCCCCCCCCCCEEEECCCCCCCHHHHHHHHHHHH
T ss_conf             03434520146620016305999865310411205445256787376788861257658601258880346899999755


Q ss_pred             HHHHCCCCCCCCCCCCCCCCEEEEEECCHHHHHHHHHHHHHHCCCEEEEECCCCCEEEEEECCCEEECCCHHHCCCHHHH
Q ss_conf             86411221112567600042028996376789888988866449506973782330335315645412696662586778
Q gi|254780321|r  326 LRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERLEREFSLNLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKI  405 (606)
Q Consensus       326 L~~~D~sl~~e~Ets~aLg~Gfr~gglG~LHLeVi~eRL~rEfg~ev~~t~P~V~Ykv~~~dG~~~~Vd~p~~~p~~~~i  405 (606)
T Consensus       319 L~LNDAsL~yE~E~S~ALGFGFRCGFLGLLHmEiiqERLeREFnldlI~TAP~V~Y~V~~~~G~~~~v~nP~~~P~~~~I  398 (598)
T TIGR01393       319 LKLNDASLTYEPESSPALGFGFRCGFLGLLHMEIIQERLEREFNLDLITTAPSVVYKVYLTDGEVIEVDNPSDLPDPNKI  398 (598)
T ss_pred             HHHHHHHHHCCCCCCCCCCCCEEECCCCCHHHHHHHHHHHHHCCCEEEEECCCEEEEEEEECCCEEEEECCHHCCCCCCC
T ss_conf             54402542102236300374043326663368999876544308706872781599999707818997183006850157


Q ss_pred             HHHHCCEEEEEEEECCCCCHHHHHHHHHHHHEEECCCCCC-CEEEEEEEECHHHHHHHHHHHHHHHCCCEEEEEEEECCC
Q ss_conf             8862326999998083100038999886300142443368-369999996043332204687676357418889854354
Q gi|254780321|r  406 AELREPWIQVTIITPNEYLGSILKLCQERRGIQIDMSHLD-NRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDY  484 (606)
Q Consensus       406 ~~i~EPi~~~~I~~P~ey~G~Vm~~l~~RRG~~~~m~~~~-~~~~i~~~vPl~Eli~~f~~~LkS~T~G~as~~ye~~~Y  484 (606)
T Consensus       399 ~~v~EPyv~~~IitP~ey~G~iM~LC~~KRG~~~~~~Y~d~~RV~L~YemPL~EI~~DFfDkLKS~skGYASfDYE~~~y  478 (598)
T TIGR01393       399 EHVEEPYVKATIITPSEYLGAIMELCQEKRGVQTNMEYLDPNRVELIYEMPLAEIVYDFFDKLKSISKGYASFDYELIGY  478 (598)
T ss_pred             CEEECCEEEEEEECCCCHHHHHHHHHHHCCEEEEEEEECCCCEEEEEEECCCCCEEEEEECCCCCCCCCCCCCCCCCCCC
T ss_conf             77844749999435830124688876301514634363189559999975753063301063202223532112321357


Q ss_pred             EECCEEEEEEEECCCCCCEEEEEEEHHHHHHHHHHHHHHHHHCCCHHHCCCCCEEEECCEEEEEECCCCCCCCEEEEECC
Q ss_conf             64366797488628824356874215779999999999987408701020022045647889741256420320323017
Q gi|254780321|r  485 RDSDLVKLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGGRIIARETVKARRKDVTAKCYG  564 (606)
Q Consensus       485 ~~~dlvk~~ilin~~~vdals~i~h~~~a~~~gr~~~~~L~~~iprq~F~v~iqa~~~~~iiare~i~~~rkdvt~kcyg  564 (606)
T Consensus       479 r~~dLVKlDIL~Nge~VDALS~IVH~d~A~~~gr~~~~KLKE~IPRQqF~ipIQA~IG~KIIARETiKa~RKdVtAKCYG  558 (598)
T TIGR01393       479 RESDLVKLDILINGEPVDALSFIVHRDKAYSRGREIVEKLKELIPRQQFEIPIQAAIGGKIIARETIKALRKDVTAKCYG  558 (598)
T ss_pred             CCCCEEEEEEEECCCCCCEEEEECCCHHHHHHHHHHHHHHHHCCCCCCCCCCHHEECCCEEEEECCCCCCCCCEEEEECC
T ss_conf             43262899999848943368771235135889999998866228634666411022188068750354122550235208


Q ss_pred             CCCCHHHHHHHHHHHHHHHHHHCCCEECCHHHHHHHHCCC
Q ss_conf             7734787756898842178751077445889999974246
Q gi|254780321|r  565 GDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISILKTD  604 (606)
Q Consensus       565 Gd~trk~KLl~~qk~GKkrmk~~g~v~ip~~af~~~l~~~  604 (606)
T Consensus       559 GDiTRKrKLLEKQKEGKKRMK~~G~VevPQeAFLaVLK~~  598 (598)
T TIGR01393       559 GDITRKRKLLEKQKEGKKRMKQIGKVEVPQEAFLAVLKVD  598 (598)
T ss_pred             CCCCHHHHHHHHHHHHHHHCCCCCCEECCHHHHHHHHCCC
T ss_conf             7704324545521021032157775315646865431279