HHsearch alignment for GI: 254780321 and conserved domain: TIGR03594

>TIGR03594 GTPase_EngA ribosome-associated GTPase EngA. EngA (YfgK, Der) is a ribosome-associated essential GTPase with a duplication of its GTP-binding domain. It is broadly to universally distributed among bacteria. It appears to function in ribosome biogenesis or stability.
Probab=99.67  E-value=2.6e-15  Score=122.31  Aligned_cols=159  Identities=25%  Similarity=0.358  Sum_probs=113.9

Q ss_pred             HHCEEEEEECCCCCCHHHHHHHHHHHCCCCCCCCCCCEEECCCHHHHHHCCEEEEEEEEEEEECCCCCEEEEEEEECCCC
Q ss_conf             25317999801389877889999998298054444311305867798719505232799997437884389999617873
Q gi|254780321|r    9 SRIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVRLNYTSTDAKDYQLNLIDTPGH   88 (606)
Q Consensus         9 ~~IRN~~IiaHvDhGKTTL~d~lL~~tg~i~~~~~~~~vlD~~~~EreRGITIka~~~~~~~~~~~~~~y~iNlIDTPGH   88 (606)
T Consensus       170 ~~~iriaivGrPNvGKSTl~N~ll~~~r~ivs~~--------------~GtTrD~i~~~~~~-----~~~~~~~iDTaGi  230 (429)
T TIGR03594       170 DGPIKIAIIGRPNVGKSTLVNALLGEERVIVSDI--------------AGTTRDSIDIPFER-----NGKKYLLIDTAGI  230 (429)
T ss_pred             CCCEEEEEECCCCCCHHHHHHHHHHHHHHHCCCC--------------CCCCCCCEEEEEEE-----CCEEEEEEECCCC
T ss_conf             5652699974887654677777654333214799--------------98631026879999-----9908999989887


Q ss_pred             CH----------H-HHHHHHHHHHCCEEEEEEECCCCCCHHHHHHHHHHHHCCCCEEEEECCCCCCC-C-CCCCHHHHHH
Q ss_conf             00----------2-79999999730268999986878865589999999970996799832678875-3-2113388877
Q gi|254780321|r   89 VD----------F-TYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQAIDNNHEIITVLNKADLPS-A-DPDRVKKQIE  155 (606)
Q Consensus        89 ~D----------F-~~EV~r~l~a~dgaiLvVdA~~Gvq~QT~~~~~~A~~~~l~~I~viNKiD~~~-A-~~e~v~~ei~  155 (606)
T Consensus       231 rkk~k~~~~~e~~s~~~t~~~i~~~dvvil~iD~~~~~~~qD~~i~~~i~~~~k~~ii~~NK~Dli~~~~~~~~~~~~i~  310 (429)
T TIGR03594       231 RRKGKVTEGIEKYSVLRTLKAIERADVVLLVLDATEGITEQDLRIAGLALEAGKALIIVVNKWDLVKDEKTREEFKKELR  310 (429)
T ss_pred             CCCCCCCHHHHHHHHHHHHHHHHHCCEEEEEEECCCCCCHHHHHHHHHHHHCCCCEEEEEEHHHCCCCHHHHHHHHHHHH
T ss_conf             63664230477999999999987447799999766588488899999898739976999972230379999999999999


Q ss_pred             HHH-HHHHHHHHHHHHHCCCCCCHHHHHHHHH
Q ss_conf             555-3223210001110022320067877632
Q gi|254780321|r  156 ETI-GISTEDALLVSAKTGEGIPLLLERIVQQ  186 (606)
Q Consensus       156 ~~~-g~~~~~ii~vSAktG~GV~~LLd~Iv~~  186 (606)
T Consensus       311 ~~l~~~~~~pI~fiSA~~g~gi~kl~~~i~~~  342 (429)
T TIGR03594       311 RKLPFLDFAPIVFISALTGQGVDKLLDAIDEV  342 (429)
T ss_pred             HHCCCCCCCCEEEEECCCCCCHHHHHHHHHHH
T ss_conf             85623689868997345778999999999999