HHsearch alignment for GI: 254780321 and conserved domain: TIGR03598

>TIGR03598 GTPase_YsxC ribosome biogenesis GTP-binding protein YsxC/EngB. Members of this protein family are a GTPase associated with ribosome biogenesis, typified by YsxC from Bacillus subutilis. The family is widely but not universally distributed among bacteria. Members commonly are called EngB based on homology to EngA, one of several other GTPases of ribosome biogenesis. Cutoffs as set find essentially all bacterial members, but also identify large numbers of eukaryotic (probably organellar) sequences. This protein is found in about 80 percent of bacterial genomes.
Probab=99.64  E-value=2.7e-15  Score=122.20  Aligned_cols=154  Identities=19%  Similarity=0.273  Sum_probs=105.3

Q ss_pred             CCCCCHHHCEEEEEECCCCCCHHHHHHHHHHHCCCCCCCCCCCEEECCCHHHHHHCCEEEEEEEEEEEECCCCCEEEEEE
Q ss_conf             88998525317999801389877889999998298054444311305867798719505232799997437884389999
Q gi|254780321|r    3 KKPTPLSRIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVRLNYTSTDAKDYQLNL   82 (606)
Q Consensus         3 ~~~~p~~~IRN~~IiaHvDhGKTTL~d~lL~~tg~i~~~~~~~~vlD~~~~EreRGITIka~~~~~~~~~~~~~~y~iNl   82 (606)
T Consensus        10 ~~~~p~~~~p~IaivGrpNvGKSTL~N~L~---g~--k~~a--~v------s~~pGtTr-----~i~~~~~~---~~~~l   68 (179)
T TIGR03598        10 LKQLPPDDGPEIAFAGRSNVGKSSLINALT---NR--KKLA--RT------SKTPGRTQ-----LINFFEVN---DGFRL   68 (179)
T ss_pred             HHHCCCCCCCEEEEECCCCCCHHHHHHHHH---CC--CCEE--EE------CCCCCEEE-----ECCEEEEC---CCEEE
T ss_conf             767999889789998699988899999986---89--8558--97------08997366-----02320104---73699


Q ss_pred             EECCCC----------CHHHHHHHHHHH---HCCEEEEEEECCCCCCHHHHHHHHHHHHCCCCEEEEECCCCCCC-CCCC
Q ss_conf             617873----------002799999997---30268999986878865589999999970996799832678875-3211
Q gi|254780321|r   83 IDTPGH----------VDFTYEVSRSLS---ACEGSLLVVDATQGVEAQTLANVYQAIDNNHEIITVLNKADLPS-ADPD  148 (606)
Q Consensus        83 IDTPGH----------~DF~~EV~r~l~---a~dgaiLvVdA~~Gvq~QT~~~~~~A~~~~l~~I~viNKiD~~~-A~~e  148 (606)
T Consensus        69 vDtpGyG~~~~~~~~~~~~~~~~~~~~~~~~~l~~villiDa~~gl~~~D~~i~~~l~~~~kp~iivlNK~Dll~~~~~~  148 (179)
T TIGR03598        69 VDLPGYGYAKVSKEEKEKWQKLIEEYLRGRENLKGVVLLMDIRHPLKELDLEMLEWLDERGIPVLIVLTKADKLKKSERN  148 (179)
T ss_pred             EECCCHHHCCCCHHHHHHHHHHHHHHHHHHHHHHCEEEEEECCCCCCHHHHHHHHHHHHCCCCEEEEEECCCCCCHHHHH
T ss_conf             97776021127888899999999999999886430289874377998999999999997599889999781306989999


Q ss_pred             CHHHHHHHHHHH--HHHHHHHHHHHCCCCCC
Q ss_conf             338887755532--23210001110022320
Q gi|254780321|r  149 RVKKQIEETIGI--STEDALLVSAKTGEGIP  177 (606)
Q Consensus       149 ~v~~ei~~~~g~--~~~~ii~vSAktG~GV~  177 (606)
T Consensus       149 ~~~~~i~~~l~~~~~~~~v~~ISA~~g~GID  179 (179)
T TIGR03598       149 KQLKKIKKALKKDADDPSVQLFSSLKKTGIE  179 (179)
T ss_pred             HHHHHHHHHHHCCCCCCCEEEEECCCCCCCC
T ss_conf             9999999997336688948999799983879