>cd01869 Rab1_Ypt1 Rab1/Ypt1 subfamily. Rab1 is found in every eukaryote and is a key regulatory component for the transport of vesicles from the ER to the Golgi apparatus. Studies on mutations of Ypt1, the yeast homolog of Rab1, showed that this protein is necessary for the budding of vesicles of the ER as well as for their transport to, and fusion with, the Golgi apparatus. GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state. Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilitate Rab recycling by masking C-terminal lipid binding and promoting cytosolic localization. Most Rab GTPases contain a lipid modification site at the C-terminus, with sequence motifs CC, CXC, or CCX. Lipid binding is essential for membrane attachment, a key feature of most Rab proteins. Due to t

Probab=99.41 E-value=1.1e-11 Score=98.04 Aligned_cols=156 Identities=24% Similarity=0.255 Sum_probs=101.1 Q ss_pred EEEEECCCCCCHHHHHHHHHHHCCCCCCCCCCCEEECCCHHHHHHCCEEEEEEEEEEEECCCCCEEEEEEEECCCCCHHH Q ss_conf 79998013898778899999982980544443113058677987195052327999974378843899996178730027 Q gi|254780321|r 13 NFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVRLNYTSTDAKDYQLNLIDTPGHVDFT 92 (606) Q Consensus 13 N~~IiaHvDhGKTTL~d~lL~~tg~i~~~~~~~~vlD~~~~EreRGITIka~~~~~~~~~~~~~~y~iNlIDTPGH~DF~ 92 (606) T Consensus 4 Kiv~vGd~~vGKTsli~r~~--~~~f~~~y~-~T----------ig~~~~~~~i~-----~~~~~~~l~iwDtaG~e~~~ 65 (166) T cd01869 4 KLLLIGDSGVGKSCLLLRFA--DDTYTESYI-ST----------IGVDFKIRTIE-----LDGKTIKLQIWDTAGQERFR 65 (166) T ss_pred EEEEECCCCCCHHHHHHHHH--CCCCCCCCC-CC----------CCEEEEEEEEE-----ECCEEEEEEEEECCCCCCCC T ss_conf 99999999978999999994--399998747-85----------44048999999-----99999999999899982346 Q ss_pred HHHHHHHHHCCEEEEEEECCCCCCHHHHHHHHHHH-H---CCCCEEEEECCCCCCCCCCCCHHHHHHHHHHHHHHHHHHH Q ss_conf 99999997302689999868788655899999999-7---0996799832678875321133888775553223210001 Q gi|254780321|r 93 YEVSRSLSACEGSLLVVDATQGVEAQTLANVYQAI-D---NNHEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLV 168 (606) Q Consensus 93 ~EV~r~l~a~dgaiLvVdA~~Gvq~QT~~~~~~A~-~---~~l~~I~viNKiD~~~A~~e~v~~ei~~~~g~~~~~ii~v 168 (606) T Consensus 66 ~~~~~~~~~a~~~ilvfdit~~~Sf~~i~~w~~~i~~~~~~~~~~ilvgNK~DL~~~r~v-~~~~~~~~a~~~~~~~~E~ 144 (166) T cd01869 66 TITSSYYRGAHGIIIVYDVTDQESFNNVKQWLQEIDRYASENVNKLLVGNKCDLTDKRVV-DYSEAQEFADELGIPFLET 144 (166) T ss_pred CCHHHHHHHCCEEEEEECCCCHHHHHHHHHHHHHHHHHCCCCCCEEEEEEEECCCCCCCC-CHHHHHHHHHHCCCEEEEE T ss_conf 267888563267799711799899999999999999867877744886132011314667-9999999999839969998 Q ss_pred HHHCCCCCCHHHHHHHHHH Q ss_conf 1100223200678776321 Q gi|254780321|r 169 SAKTGEGIPLLLERIVQQL 187 (606) Q Consensus 169 SAktG~GV~~LLd~Iv~~i 187 (606) T Consensus 145 SAk~g~nI~e~F~~l~~~i 163 (166) T cd01869 145 SAKNATNVEQAFMTMAREI 163 (166) T ss_pred CCCCCCCHHHHHHHHHHHH T ss_conf 7687806899999999999

HHsearch alignment for GI: 254780321 and conserved domain: cd01869