HHsearch alignment for GI: 254780321 and conserved domain: cd01883

>cd01883 EF1_alpha Eukaryotic elongation factor 1 (EF1) alpha subfamily. EF1 is responsible for the GTP-dependent binding of aminoacyl-tRNAs to the ribosomes. EF1 is composed of four subunits: the alpha chain which binds GTP and aminoacyl-tRNAs, the gamma chain that probably plays a role in anchoring the complex to other cellular components and the beta and delta (or beta') chains. This subfamily is the alpha subunit, and represents the counterpart of bacterial EF-Tu for the archaea (aEF1-alpha) and eukaryotes (eEF1-alpha). eEF1-alpha interacts with the actin of the eukaryotic cytoskeleton and may thereby play a role in cellular transformation and apoptosis. EF-Tu can have no such role in bacteria. In humans, the isoform eEF1A2 is overexpressed in 2/3 of breast cancers and has been identified as a putative oncogene. This subfamily also includes Hbs1, a G protein known to be important for efficient growth and protein synthesis under conditions of limiting translation initiation in
Probab=100.00  E-value=2.2e-44  Score=317.35  Aligned_cols=173  Identities=31%  Similarity=0.541  Sum_probs=146.3

Q ss_pred             EEEEECCCCCCHHHHHHHHHHHCCCCCCCCC-------C---------CEEECCCHHHHHHCCEEEEEEEEEEEECCCCC
Q ss_conf             7999801389877889999998298054444-------3---------11305867798719505232799997437884
Q gi|254780321|r   13 NFSIVAHIDHGKSTLADRFIQHCRGLTEREM-------S---------SQVLDNMDIERERGITIKAQTVRLNYTSTDAK   76 (606)
Q Consensus        13 N~~IiaHvDhGKTTL~d~lL~~tg~i~~~~~-------~---------~~vlD~~~~EreRGITIka~~~~~~~~~~~~~   76 (606)
T Consensus         1 Ni~iiGHvD~GKSTL~g~lL~~~g~i~~~~~~k~~~~~~~~gk~s~~~a~~lD~~~~ErerGiTI~~~~~~f-----~~~   75 (219)
T cd01883           1 NLVVIGHVDAGKSTTTGHLLYLLGGVDKRTIEKYEKEAKEMGKGSFKYAWVLDTLKEERERGVTIDVGLAKF-----ETE   75 (219)
T ss_pred             CEEEEECCCCCHHHHHHHHHHHCCCCCHHHHHHHHHHHHHCCCCCCEEEEEECCCHHHHHCCCCEEEEEEEE-----EEC
T ss_conf             989996689989999999999859976889999999998549987505566138987985892588589999-----849


Q ss_pred             EEEEEEEECCCCCHHHHHHHHHHHHCCEEEEEEECCCC-------CCHHHHHHHHHHHHCCCC-EEEEECCCCCCCC---
Q ss_conf             38999961787300279999999730268999986878-------865589999999970996-7998326788753---
Q gi|254780321|r   77 DYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQG-------VEAQTLANVYQAIDNNHE-IITVLNKADLPSA---  145 (606)
Q Consensus        77 ~y~iNlIDTPGH~DF~~EV~r~l~a~dgaiLvVdA~~G-------vq~QT~~~~~~A~~~~l~-~I~viNKiD~~~A---  145 (606)
T Consensus        76 ~~~~~iiDtPGH~df~~~mi~g~~~ad~ailvvda~~g~~e~g~~~~~QTreH~~l~~~lGik~iIVavNKMD~v~~~y~  155 (219)
T cd01883          76 KYRFTILDAPGHRDFVPNMITGASQADVAVLVVDARKGEFEAGFEKGGQTREHALLARTLGVKQLIVAVNKMDDVTVNWS  155 (219)
T ss_pred             CEEEEEEECCCCHHHHHHHHHHHHHCCEEEEEEECCCCCCCCCCCCCCHHHHHHHHHHHCCCCEEEEEEECCCCCCCCCC
T ss_conf             93699987897266788999877531668999985767510366777659999999998499748999987536886525


Q ss_pred             --CCCCHHHHHHHHH---HHHHHHH--HHHHHHCCCCC------------CHHHHHHHHHHHCCC
Q ss_conf             --2113388877555---3223210--00111002232------------006787763210001
Q gi|254780321|r  146 --DPDRVKKQIEETI---GISTEDA--LLVSAKTGEGI------------PLLLERIVQQLPSPT  191 (606)
Q Consensus       146 --~~e~v~~ei~~~~---g~~~~~i--i~vSAktG~GV------------~~LLd~Iv~~iP~P~  191 (606)
T Consensus       156 ~~rf~~i~~~~~~~l~~~g~~~~~~~~IPiSa~~GdNi~~~s~~m~WY~GptLl~~L-d~~~~p~  219 (219)
T cd01883         156 EERYDEIKKELSPFLKKVGYNPKDVPFIPISGLTGDNLIEKSENMPWYKGPTLLEAL-DSLEPPE  219 (219)
T ss_pred             HHHHHHHHHHHHHHHHHCCCCCCCCEEEEEECCCCCCCCCCCCCCCCCCCCHHHHHH-HCCCCCC
T ss_conf             999999999999999982999566159993367663046678899898781699998-4789989