HHsearch alignment for GI: 254780321 and conserved domain: cd01887

>cd01887 IF2_eIF5B IF2/eIF5B (initiation factors 2/ eukaryotic initiation factor 5B) subfamily. IF2/eIF5B contribute to ribosomal subunit joining and function as GTPases that are maximally activated by the presence of both ribosomal subunits. As seen in other GTPases, IF2/IF5B undergoes conformational changes between its GTP- and GDP-bound states. Eukaryotic IF2/eIF5Bs possess three characteristic segments, including a divergent N-terminal region followed by conserved central and C-terminal segments. This core region is conserved among all known eukaryotic and archaeal IF2/eIF5Bs and eubacterial IF2s.
Probab=100.00  E-value=1.3e-32  Score=238.37  Aligned_cols=157  Identities=36%  Similarity=0.448  Sum_probs=128.6

Q ss_pred             EEEEECCCCCCHHHHHHHHHHHCCCCCCCCCCCEEECCCHHHHHHCCEEEEEEEEEEEECCCCCEEEEEEEECCCCCHHH
Q ss_conf             79998013898778899999982980544443113058677987195052327999974378843899996178730027
Q gi|254780321|r   13 NFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVRLNYTSTDAKDYQLNLIDTPGHVDFT   92 (606)
Q Consensus        13 N~~IiaHvDhGKTTL~d~lL~~tg~i~~~~~~~~vlD~~~~EreRGITIka~~~~~~~~~~~~~~y~iNlIDTPGH~DF~   92 (606)
T Consensus         2 ~VaivG~~n~GKSTL~n~L~---~~--~~~----------~~~~~g~T~~i~~~~~~~~--~~~~~~i~~iDTPGh~~f~   64 (168)
T cd01887           2 VVTVMGHVDHGKTTLLDKIR---KT--NVA----------AGEAGGITQHIGAFEVPAE--VLKIPGITFIDTPGHEAFT   64 (168)
T ss_pred             EEEEEECCCCCHHHHHHHHH---CC--CCC----------EEECCCCEEEECEEEEEEE--ECCCCEEEEEECCCCHHHH
T ss_conf             89999489985989999985---86--750----------4516981687153999988--2588718999899816779


Q ss_pred             HHHHHHHHHCCEEEEEEECCCCCCHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCCHHHHHHHHHHH------HHHHHH
Q ss_conf             99999997302689999868788655899999999709967998326788753211338887755532------232100
Q gi|254780321|r   93 YEVSRSLSACEGSLLVVDATQGVEAQTLANVYQAIDNNHEIITVLNKADLPSADPDRVKKQIEETIGI------STEDAL  166 (606)
Q Consensus        93 ~EV~r~l~a~dgaiLvVdA~~Gvq~QT~~~~~~A~~~~l~~I~viNKiD~~~A~~e~v~~ei~~~~g~------~~~~ii  166 (606)
T Consensus        65 ~~~~~~~~~aD~~ilvvda~~g~~~~~~~~~~~l~~~~~p~ivviNKiD~~~~~~~~v~~~l~~~~~~~~~~~~~~~~iI  144 (168)
T cd01887          65 NMRARGASLTDIAILVVAADDGVMPQTIEAIKLAKAANVPFIVALNKIDKPNANPERVKNELSELGLQGEDEWGGDVQIV  144 (168)
T ss_pred             HHHHHHHHHCCEEEEEEECCCCCCHHHHHHHHHHHHCCCCEEEEEECCCCCCCCHHHHHHHHHHHHCCCHHHCCCCCEEE
T ss_conf             99999986268899998646675458999999998769978999989308987989999999997545245528987599


Q ss_pred             HHHHHCCCCCCHHHHHHHHH
Q ss_conf             01110022320067877632
Q gi|254780321|r  167 LVSAKTGEGIPLLLERIVQQ  186 (606)
Q Consensus       167 ~vSAktG~GV~~LLd~Iv~~  186 (606)
T Consensus       145 pvSA~tG~gi~~L~~~i~~~  164 (168)
T cd01887         145 PTSAKTGEGIDDLLEAILLL  164 (168)
T ss_pred             EEECCCCCCHHHHHHHHHHH
T ss_conf             99899998999999999999