HHsearch alignment for GI: 254780321 and conserved domain: cd01888

>cd01888 eIF2_gamma eIF2-gamma (gamma subunit of initiation factor 2). eIF2 is a heterotrimeric translation initiation factor that consists of alpha, beta, and gamma subunits. The GTP-bound gamma subunit also binds initiator methionyl-tRNA and delivers it to the 40S ribosomal subunit. Following hydrolysis of GTP to GDP, eIF2:GDP is released from the ribosome. The gamma subunit has no intrinsic GTPase activity, but is stimulated by the GTPase activating protein (GAP) eIF5, and GDP/GTP exchange is stimulated by the guanine nucleotide exchange factor (GEF) eIF2B. eIF2B is a heteropentamer, and the epsilon chain binds eIF2. Both eIF5 and eIF2B-epsilon are known to bind strongly to eIF2-beta, but have also been shown to bind directly to eIF2-gamma. It is possible that eIF2-beta serves simply as a high-affinity docking site for eIF5 and eIF2B-epsilon, or that eIF2-beta serves a regulatory role. eIF2-gamma is found only in eukaryotes and archaea. It is closely related to SelB, the sel
Probab=100.00  E-value=4.1e-42  Score=302.20  Aligned_cols=167  Identities=28%  Similarity=0.359  Sum_probs=132.4

Q ss_pred             EEEEECCCCCCHHHHHHHHHHHCCCCCCCCCCCEEECCCHHHHHHCCEEEEEEEE--E----------EE--EC--CCC-
Q ss_conf             7999801389877889999998298054444311305867798719505232799--9----------97--43--788-
Q gi|254780321|r   13 NFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVR--L----------NY--TS--TDA-   75 (606)
Q Consensus        13 N~~IiaHvDhGKTTL~d~lL~~tg~i~~~~~~~~vlD~~~~EreRGITIka~~~~--~----------~~--~~--~~~-   75 (606)
T Consensus         2 Ni~iiGHVDhGKSTLi~~L---~g~~---------~~~~~~e~er~it~klg~a~~~~~~~~~~~~~~~~~~~~~~~~~~   69 (203)
T cd01888           2 NIGTIGHVAHGKSTLVKAL---SGVW---------TVRFKEELERNITIKLGYANAKIYKCPNCGCPRPYCYRSKEDSPE   69 (203)
T ss_pred             EEEEEEEECCCHHHHHHHH---HCCC---------HHHHHHHHHCCCCHHHHHHHHHHHHCCCCCCCCCHHHHCCCCCCE
T ss_conf             6999988578799999997---0851---------244078886776031114566665111212231011110124421


Q ss_pred             -----------CEEEEEEEECCCCCHHHHHHHHHHHHCCEEEEEEECCCCC-CHHHHHHHHHHHHCCCC-EEEEECCCCC
Q ss_conf             -----------4389999617873002799999997302689999868788-65589999999970996-7998326788
Q gi|254780321|r   76 -----------KDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGV-EAQTLANVYQAIDNNHE-IITVLNKADL  142 (606)
Q Consensus        76 -----------~~y~iNlIDTPGH~DF~~EV~r~l~a~dgaiLvVdA~~Gv-q~QT~~~~~~A~~~~l~-~I~viNKiD~  142 (606)
T Consensus        70 ~~~~~~~~~~~~~r~~tiiD~PGH~df~~nmi~Gas~aD~aiLvVdA~eG~~~~QT~eH~~l~~~lgv~~iIV~vNKmDl  149 (203)
T cd01888          70 CECPGCGGETKLVRHVSFVDCPGHEILMATMLSGAAVMDGALLLIAANEPCPQPQTSEHLAALEIMGLKHIIIVQNKIDL  149 (203)
T ss_pred             EEECCCCCCCCCEEEEEEEECCCHHHHHHHHHHHHHHCCEEEEEEECCCCCCHHHHHHHHHHHHHCCCCCEEEEEECCCC
T ss_conf             45314565431124799986898799999999766434766898643667750779999999998499863677507777


Q ss_pred             CCCCC-CCHHHHHHHHH---HHHHHHHHHHHHHCCCCCCHHHHHHHHHHHCCC
Q ss_conf             75321-13388877555---322321000111002232006787763210001
Q gi|254780321|r  143 PSADP-DRVKKQIEETI---GISTEDALLVSAKTGEGIPLLLERIVQQLPSPT  191 (606)
Q Consensus       143 ~~A~~-e~v~~ei~~~~---g~~~~~ii~vSAktG~GV~~LLd~Iv~~iP~P~  191 (606)
T Consensus       150 v~~~~~~~~~~ei~~~l~~~~~~~~~iIPiSA~~G~NI~~ll~~i~~~ip~P~  202 (203)
T cd01888         150 VKEEQALENYEQIKKFVKGTIAENAPIIPISAQLKYNIDVLLEYIVKKIPTPP  202 (203)
T ss_pred             CCHHHHHHHHHHHHHHHCCCCCCCCEEEEEECCCCCCHHHHHHHHHHHCCCCC
T ss_conf             88678999999999985521689985999147889799999999986782999