HHsearch alignment for GI: 254780321 and conserved domain: cd01896

>cd01896 DRG The developmentally regulated GTP-binding protein (DRG) subfamily is an uncharacterized member of the Obg family, an evolutionary branch of GTPase superfamily proteins. GTPases act as molecular switches regulating diverse cellular processes. DRG2 and DRG1 comprise the DRG subfamily in eukaryotes. In view of their widespread expression in various tissues and high conservation among distantly related species in eukaryotes and archaea, DRG proteins may regulate fundamental cellular processes. It is proposed that the DRG subfamily proteins play their physiological roles through RNA binding.
Probab=99.33  E-value=6.4e-11  Score=92.81  Aligned_cols=147  Identities=26%  Similarity=0.335  Sum_probs=92.2

Q ss_pred             EEEEECCCCCCHHHHHHHHHHHCCCCCCCCCCCEEECCCHHHHHHCCEEEEEEEEEEEECCCCCEEEEEEEECCCCCHH-
Q ss_conf             7999801389877889999998298054444311305867798719505232799997437884389999617873002-
Q gi|254780321|r   13 NFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVRLNYTSTDAKDYQLNLIDTPGHVDF-   91 (606)
Q Consensus        13 N~~IiaHvDhGKTTL~d~lL~~tg~i~~~~~~~~vlD~~~~EreRGITIka~~~~~~~~~~~~~~y~iNlIDTPGH~DF-   91 (606)
T Consensus         2 ~V~LVG~PN~GKSTLln~L---T~a~--~~v~----~yp------fTT~~pi~g~~~~-----~~~~iqlvDtPGli~~a   61 (233)
T cd01896           2 RVALVGFPSVGKSTLLSKL---TNTK--SEVA----AYE------FTTLTCVPGVLEY-----KGAKIQLLDLPGIIEGA   61 (233)
T ss_pred             EEEEECCCCCCHHHHHHHH---HCCC--CCCC----CCC------CCCCCCEEEEEEE-----CCEEEEEEECCCCCCCC
T ss_conf             5999999999999999999---7899--5436----989------7875747779998-----99899999673002463


Q ss_pred             ------HHHHHHHHHHCCEEEEEEECCCCCCHH---------------------------------------------HH
Q ss_conf             ------799999997302689999868788655---------------------------------------------89
Q gi|254780321|r   92 ------TYEVSRSLSACEGSLLVVDATQGVEAQ---------------------------------------------TL  120 (606)
Q Consensus        92 ------~~EV~r~l~a~dgaiLvVdA~~Gvq~Q---------------------------------------------T~  120 (606)
T Consensus        62 ~~g~g~g~~~l~~~r~aD~il~VvD~~~~~~~~~~i~~eLe~~gi~l~~~~~~v~i~~~~~~gi~i~~~~~~~~~~~~~v  141 (233)
T cd01896          62 ADGKGRGRQVIAVARTADLILMVLDATKPEGHREILERELEGVGIRLNKRPPNITIKKKKKGGINITSTVPLTKLDEKTI  141 (233)
T ss_pred             CCCCCHHHHHHHHHHHCCEEEEEEECCCCHHHHHHHHHHHHHHCCCCCCCCCCCEEEEECCCCEEEECCCCCCCCCHHHH
T ss_conf             33320689999998758999999847982667899999998605110357876257771358678604566666888999


Q ss_pred             HH----------------------HHHHHHCC---CCEEEEECCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHCCCC
Q ss_conf             99----------------------99999709---967998326788753211338887755532232100011100223
Q gi|254780321|r  121 AN----------------------VYQAIDNN---HEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEG  175 (606)
Q Consensus       121 ~~----------------------~~~A~~~~---l~~I~viNKiD~~~A~~e~v~~ei~~~~g~~~~~ii~vSAktG~G  175 (606)
T Consensus       142 ~~il~e~~i~~a~v~i~~~~t~dd~~d~i~~n~~y~P~i~V~NKiDl~~~------ee~~~~~--~~~~~i~ISA~~g~g  213 (233)
T cd01896         142 KAILREYKIHNADVLIREDITVDDLIDVIEGNRVYIPCLYVYNKIDLISI------EELDLLA--RQPNSVVISAEKGLN  213 (233)
T ss_pred             HHHHHHHCCCCCEEEECCCCCHHHHHHHHHCCCCCCCEEEEEECCCCCCH------HHHHHHH--CCCCEEEEECCCCCC
T ss_conf             99999827676437860578888989987357676737999974036998------9999864--679859998888989


Q ss_pred             CCHHHHHHHHHH
Q ss_conf             200678776321
Q gi|254780321|r  176 IPLLLERIVQQL  187 (606)
Q Consensus       176 V~~LLd~Iv~~i  187 (606)
T Consensus       214 ld~L~~~I~~~L  225 (233)
T cd01896         214 LDELKERIWDKL  225 (233)
T ss_pred             HHHHHHHHHHHH
T ss_conf             899999999983