HHsearch alignment for GI: 254780321 and conserved domain: cd04105

>cd04105 SR_beta Signal recognition particle receptor, beta subunit (SR-beta). SR-beta and SR-alpha form the heterodimeric signal recognition particle (SRP or SR) receptor that binds SRP to regulate protein translocation across the ER membrane. Nascent polypeptide chains are synthesized with an N-terminal hydrophobic signal sequence that binds SRP54, a component of the SRP. SRP directs targeting of the ribosome-nascent chain complex (RNC) to the ER membrane via interaction with the SR, which is localized to the ER membrane. The RNC is then transferred to the protein-conducting channel, or translocon, which facilitates polypeptide translation across the ER membrane or integration into the ER membrane. SR-beta is found only in eukaryotes; it is believed to control the release of the signal sequence from SRP54 upon binding of the ribosome to the translocon. High expression of SR-beta has been observed in human colon cancer, suggesting it may play a role in the development of this typ
Probab=99.04  E-value=1.2e-08  Score=77.64  Aligned_cols=127  Identities=22%  Similarity=0.412  Sum_probs=77.3

Q ss_pred             EEEEECCCCCCHHHHHHHHHHHCCCCCCCCCCCEEECCCHHHHHHCCEEEEEEEEEEEECCCCCEEEEEEEECCCCCHHH
Q ss_conf             79998013898778899999982980544443113058677987195052327999974378843899996178730027
Q gi|254780321|r   13 NFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVRLNYTSTDAKDYQLNLIDTPGHVDFT   92 (606)
Q Consensus        13 N~~IiaHvDhGKTTL~d~lL~~tg~i~~~~~~~~vlD~~~~EreRGITIka~~~~~~~~~~~~~~y~iNlIDTPGH~DF~   92 (606)
T Consensus         2 tvLl~Gl~~aGKT~Lf~~L~--~~~~~~-----T~-t----------S~~~n~~~~-~~~~~~~~~~~~lvD~PGH~klR   62 (203)
T cd04105           2 TVLLLGPSDSGKTALFTKLT--TGKYRS-----TV-T----------SIEPNVATF-ILNSEGKGKKFRLVDVPGHPKLR   62 (203)
T ss_pred             EEEEECCCCCCHHHHHHHHH--CCCCCC-----CC-C----------CCCCCCEEE-ECCCCCCCCEEEEEECCCCHHHH
T ss_conf             59999079998999999997--499888-----77-8----------887862066-40246687279999879968899


Q ss_pred             HHHHHHHH-HCCEEEEEEECCCCCC--HHHHHHHHHHH---H---CCCCEEEEECCCCCCCCCCCCH-HHHHHHHH
Q ss_conf             99999997-3026899998687886--55899999999---7---0996799832678875321133-88877555
Q gi|254780321|r   93 YEVSRSLS-ACEGSLLVVDATQGVE--AQTLANVYQAI---D---NNHEIITVLNKADLPSADPDRV-KKQIEETI  158 (606)
Q Consensus        93 ~EV~r~l~-a~dgaiLvVdA~~Gvq--~QT~~~~~~A~---~---~~l~~I~viNKiD~~~A~~e~v-~~ei~~~~  158 (606)
T Consensus        63 ~~~~~~~~~~~~gIVfvVDs~~~~~~l~~~Ae~Ly~iL~~~~~~~~~iPvLIacNKqDl~tA~~~~~Ik~~LE~Ei  138 (203)
T cd04105          63 DKLLETLKNSAKGIVFVVDSATFQKNLKDVAEFLYDILTDLEKVKNKIPVLIACNKQDLFTAKPAKKIKEQLEKEL  138 (203)
T ss_pred             HHHHHHHHHCCCEEEEEEECCCCCHHHHHHHHHHHHHHHHHHHCCCCCCEEEEEECCCCCCCCCHHHHHHHHHHHH
T ss_conf             9999998754989999996887511199999999999862664368998899986614345789999999999999