HHsearch alignment for GI: 254780321 and conserved domain: cd04106

>cd04106 Rab23_lke Rab23-like subfamily. Rab23 is a member of the Rab family of small GTPases. In mouse, Rab23 has been shown to function as a negative regulator in the sonic hedgehog (Shh) signalling pathway. Rab23 mediates the activity of Gli2 and Gli3, transcription factors that regulate Shh signaling in the spinal cord, primarily by preventing Gli2 activation in the absence of Shh ligand. Rab23 also regulates a step in the cytoplasmic signal transduction pathway that mediates the effect of Smoothened (one of two integral membrane proteins that are essential components of the Shh signaling pathway in vertebrates). In humans, Rab23 is expressed in the retina. Mice contain an isoform that shares 93% sequence identity with the human Rab23 and an alternative splicing isoform that is specific to the brain. This isoform causes the murine open brain phenotype, indicating it may have a role in the development of the central nervous system. GTPase activating proteins (GAPs) interact with G
Probab=99.32  E-value=4.3e-11  Score=93.94  Aligned_cols=156  Identities=18%  Similarity=0.233  Sum_probs=101.6

Q ss_pred             EEEECCCCCCHHHHHHHHHHHCCCCCCCCCCCEEECCCHHHHHHCCEEEEEEEEEEEECCCCCEEEEEEEECCCCCHHHH
Q ss_conf             99980138987788999999829805444431130586779871950523279999743788438999961787300279
Q gi|254780321|r   14 FSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVRLNYTSTDAKDYQLNLIDTPGHVDFTY   93 (606)
Q Consensus        14 ~~IiaHvDhGKTTL~d~lL~~tg~i~~~~~~~~vlD~~~~EreRGITIka~~~~~~~~~~~~~~y~iNlIDTPGH~DF~~   93 (606)
T Consensus         3 ivvlGd~~VGKTsLi~r~~--~~~f~~~y-~~----------Tig~~~~~k~i~~---~~~~~~v~l~iwDtaG~e~~~~   66 (162)
T cd04106           3 VIVVGNGNVGKSSMIQRFV--KGIFTKDY-KK----------TIGVDFLEKQIFL---RQSDEDVRLMLWDTAGQEEFDA   66 (162)
T ss_pred             EEEECCCCCCHHHHHHHHH--HCCCCCCC-CC----------CCCCEEEEEEEEE---CCCCEEEEEEEEECCCCCCCCC
T ss_conf             9999999988999999998--49689876-88----------5562578878998---6799799999997899701341


Q ss_pred             HHHHHHHHCCEEEEEEECCCCCCHHHHHHHHHHHH---CCCCEEEEECCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             99999973026899998687886558999999997---099679983267887532113388877555322321000111
Q gi|254780321|r   94 EVSRSLSACEGSLLVVDATQGVEAQTLANVYQAID---NNHEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSA  170 (606)
Q Consensus        94 EV~r~l~a~dgaiLvVdA~~Gvq~QT~~~~~~A~~---~~l~~I~viNKiD~~~A~~e~v~~ei~~~~g~~~~~ii~vSA  170 (606)
T Consensus        67 l~~~~~~~a~~~ilvydvt~~~Sf~~l~~w~~~~~~~~~~~piilVgNK~DL~~~r~-V~~~e~~~~a~~~~~~~~E~SA  145 (162)
T cd04106          67 ITKAYYRGAQACILVFSTTDRESFEAIESWKEKVEAECGDIPMVLVQTKIDLLDQAV-ITNEEAEALAKRLQLPLFRTSV  145 (162)
T ss_pred             CHHHHHHHHCCEEEEEECCCHHHHHHHHHHHHHHHHHCCCCCEEEEECCHHHHHCCC-CCHHHHHHHHHHCCCEEEEECC
T ss_conf             524561230312688406988999999999999997669962999840544410177-8999999999986987999868


Q ss_pred             HCCCCCCHHHHHHHHH
Q ss_conf             0022320067877632
Q gi|254780321|r  171 KTGEGIPLLLERIVQQ  186 (606)
Q Consensus       171 ktG~GV~~LLd~Iv~~  186 (606)
T Consensus       146 k~~~nV~e~F~~la~k  161 (162)
T cd04106         146 KDDFNVTELFEYLAEK  161 (162)
T ss_pred             CCCCCHHHHHHHHHHH
T ss_conf             8882989999999960