HHsearch alignment for GI: 254780321 and conserved domain: cd04109

>cd04109 Rab28 Rab28 subfamily. First identified in maize, Rab28 has been shown to be a late embryogenesis-abundant (Lea) protein that is regulated by the plant hormone abcisic acid (ABA). In Arabidopsis, Rab28 is expressed during embryo development and is generally restricted to provascular tissues in mature embryos. Unlike maize Rab28, it is not ABA-inducible. Characterization of the human Rab28 homolog revealed two isoforms, which differ by a 95-base pair insertion, producing an alternative sequence for the 30 amino acids at the C-terminus. The two human isoforms are presumbly the result of alternative splicing. Since they differ at the C-terminus but not in the GTP-binding region, they are predicted to be targeted to different cellular locations. GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state. Rabs
Probab=99.17  E-value=1.8e-09  Score=83.07  Aligned_cols=158  Identities=21%  Similarity=0.295  Sum_probs=99.3

Q ss_pred             EEEECCCCCCHHHHHHHHHHHCCCCCCCCCCCEEECCCHHHHHHCCEEEEEEEEEEEECCCCCEEEEEEEECCCCCHHHH
Q ss_conf             99980138987788999999829805444431130586779871950523279999743788438999961787300279
Q gi|254780321|r   14 FSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVRLNYTSTDAKDYQLNLIDTPGHVDFTY   93 (606)
Q Consensus        14 ~~IiaHvDhGKTTL~d~lL~~tg~i~~~~~~~~vlD~~~~EreRGITIka~~~~~~~~~~~~~~y~iNlIDTPGH~DF~~   93 (606)
T Consensus         3 vvllGd~~VGKTSli~rf~--~~~F~~~y~-~Ti----------G~d~~~k~i~i----~~~~~v~l~iwDtaGqe~~~~   65 (215)
T cd04109           3 IVVLGDGAVGKTSLCRRFA--KEGFGKSYK-QTI----------GLDFFSKRVTL----PGNLNVTLQVWDIGGQSIGGK   65 (215)
T ss_pred             EEEECCCCCCHHHHHHHHH--HCCCCCCCC-CCC----------CEEEEEEEEEE----CCCCEEEEEEEECCCCCCHHH
T ss_conf             9999999970999999997--498988778-865----------57889999998----799469999996998500237


Q ss_pred             HHHHHHHHCCEEEEEEECCCCCCHHHHHHHHHHH----HC-CC--CEEEEECCCCCCCCCCCCHHHHHHHHHHHHHHHHH
Q ss_conf             9999997302689999868788655899999999----70-99--67998326788753211338887755532232100
Q gi|254780321|r   94 EVSRSLSACEGSLLVVDATQGVEAQTLANVYQAI----DN-NH--EIITVLNKADLPSADPDRVKKQIEETIGISTEDAL  166 (606)
Q Consensus        94 EV~r~l~a~dgaiLvVdA~~Gvq~QT~~~~~~A~----~~-~l--~~I~viNKiD~~~A~~e~v~~ei~~~~g~~~~~ii  166 (606)
T Consensus        66 ~~~~y~~~a~~~ilVYDitn~~SF~~l~~W~~~i~~~~~~~~~~~~iiLVGNK~DL~~~R~V-s~ee~~~~A~~~g~~f~  144 (215)
T cd04109          66 MLDKYIYGAHAVFLVYDVTNSQSFENLEDWYSMVRKVLKSSETQPLVVLVGNKTDLEHNRTV-KDDKHARFAQANGMESC  144 (215)
T ss_pred             HHHHHHHHHCCEEEECCCCCHHHHHHHHHHHHHHHHHHHCCCCCCEEEEEEECCCHHHHCCC-CHHHHHHHHHHCCCEEE
T ss_conf             89999975151377414786789998999999999985045778529999754542864776-99999999998299899


Q ss_pred             HHHHHCCCCCCHHHHHHHHHHHC
Q ss_conf             01110022320067877632100
Q gi|254780321|r  167 LVSAKTGEGIPLLLERIVQQLPS  189 (606)
Q Consensus       167 ~vSAktG~GV~~LLd~Iv~~iP~  189 (606)
T Consensus       145 E~SAktg~nV~e~F~~la~~i~~  167 (215)
T cd04109         145 LVSAKTGDRVNLLFQQLAAELLG  167 (215)
T ss_pred             EEECCCCCCHHHHHHHHHHHHHC
T ss_conf             98389994989999999999976