HHsearch alignment for GI: 254780321 and conserved domain: cd04130

>cd04130 Wrch_1 Wrch-1 subfamily. Wrch-1 (Wnt-1 responsive Cdc42 homolog) is a Rho family GTPase that shares significant sequence and functional similarity with Cdc42. Wrch-1 was first identified in mouse mammary epithelial cells, where its transcription is upregulated in Wnt-1 transformation. Wrch-1 contains N- and C-terminal extensions relative to cdc42, suggesting potential differences in cellular localization and function. The Wrch-1 N-terminal extension contains putative SH3 domain-binding motifs and has been shown to bind the SH3 domain-containing protein Grb2, which increases the level of active Wrch-1 in cells. Unlike Cdc42, which localizes to the cytosol and perinuclear membranes, Wrch-1 localizes extensively with the plasma membrane and endosomes. The membrane association, localization, and biological activity of Wrch-1 indicate an atypical model of regulation distinct from other Rho family GTPases. Most Rho proteins contain a lipid modification site at the C-terminus,
Probab=99.24  E-value=4.4e-10  Score=87.16  Aligned_cols=151  Identities=20%  Similarity=0.199  Sum_probs=95.2

Q ss_pred             EEEECCCCCCHHHHHHHHHHHCCCCCCCCCCCEEECCCHHHHHHCCEEEE-EEEEEEEECCCCCEEEEEEEECCCCCHHH
Q ss_conf             99980138987788999999829805444431130586779871950523-27999974378843899996178730027
Q gi|254780321|r   14 FSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKA-QTVRLNYTSTDAKDYQLNLIDTPGHVDFT   92 (606)
Q Consensus        14 ~~IiaHvDhGKTTL~d~lL~~tg~i~~~~~~~~vlD~~~~EreRGITIka-~~~~~~~~~~~~~~y~iNlIDTPGH~DF~   92 (606)
T Consensus         3 vvlvGd~~VGKTsli~r~~--~~~F~~~y-~--------------pT~~~~~~~~i~---~~~~~v~l~iwDtaG~e~~~   62 (173)
T cd04130           3 CVLVGDGAVGKTSLIVSYT--TNGYPTEY-V--------------PTAFDNFSVVVL---VDGKPVRLQLCDTAGQDEFD   62 (173)
T ss_pred             EEEECCCCCCHHHHHHHHH--HCCCCCCC-C--------------CCEEEEEEEEEE---ECCEEEEEEEEECCCCCCCC
T ss_conf             9999989978899999996--19999985-7--------------835899999999---99999999999899873443


Q ss_pred             HHHHHHHHHCCEEEEEEECCCCCCHHHHH-HHHHHHH---CCCCEEEEECCCCCCCCCC---------CC-HH-HHHHHH
Q ss_conf             99999997302689999868788655899-9999997---0996799832678875321---------13-38-887755
Q gi|254780321|r   93 YEVSRSLSACEGSLLVVDATQGVEAQTLA-NVYQAID---NNHEIITVLNKADLPSADP---------DR-VK-KQIEET  157 (606)
Q Consensus        93 ~EV~r~l~a~dgaiLvVdA~~Gvq~QT~~-~~~~A~~---~~l~~I~viNKiD~~~A~~---------e~-v~-~ei~~~  157 (606)
T Consensus        63 ~l~~~~~~~a~~~ilvydv~~~~Sf~~l~~~w~~~i~~~~~~~piilvGnK~DL~~~~~~~~~~~~~~~r~Vs~~e~~~~  142 (173)
T cd04130          63 KLRPLCYPDTDVFLLCFSVVNPSSFQNISEKWIPEIRKHNPKAPIILVGTQADLRTDVNVLIQLARYGEKPVSQSRAKAL  142 (173)
T ss_pred             HHHHHHHCCCCEEEEEEECCCHHHHHHHHHHHHHHHHHCCCCCCEEEEEECCCCCCCHHHHHHHHHCCCCCCCHHHHHHH
T ss_conf             45676613787899999659878899999999999996098998899988701100133554443325755789999999


Q ss_pred             H-HHHHHHHHHHHHHCCCCCCHHHHHHH
Q ss_conf             5-32232100011100223200678776
Q gi|254780321|r  158 I-GISTEDALLVSAKTGEGIPLLLERIV  184 (606)
Q Consensus       158 ~-g~~~~~ii~vSAktG~GV~~LLd~Iv  184 (606)
T Consensus       143 a~~~~~~~y~EtSAkt~~nV~e~Fe~~i  170 (173)
T cd04130         143 AEKIGACEYIECSALTQKNLKEVFDTAI  170 (173)
T ss_pred             HHHCCCCEEEEECCCCCCCHHHHHHHHH
T ss_conf             9984996899968688969799999998