HHsearch alignment for GI: 254780321 and conserved domain: cd04136

>cd04136 Rap_like Rap-like subfamily. The Rap subfamily consists of the Rap1, Rap2, and RSR1. Rap subfamily proteins perform different cellular functions, depending on the isoform and its subcellular localization. For example, in rat salivary gland, neutrophils, and platelets, Rap1 localizes to secretory granules and is believed to regulate exocytosis or the formation of secretory granules. Rap1 has also been shown to localize in the Golgi of rat fibroblasts, zymogen granules, plasma membrane, and microsomal membrane of the pancreatic acini, as well as in the endocytic compartment of skeletal muscle cells and fibroblasts. Rap1 localizes in the nucleus of human oropharyngeal squamous cell carcinomas (SCCs) and cell lines. Rap1 plays a role in phagocytosis by controlling the binding of adhesion receptors (typically integrins) to their ligands. In yeast, Rap1 has been implicated in multiple functions, including activation and silencing of transcription and maintenance of telomeres.
Probab=99.32  E-value=5.9e-11  Score=93.05  Aligned_cols=148  Identities=21%  Similarity=0.284  Sum_probs=99.5

Q ss_pred             EEEECCCCCCHHHHHHHHHHHCCCCCCCCCCCEEECCCHHHHHHCCEEEE-EEEEEEEECCCCCEEEEEEEECCCCCHHH
Q ss_conf             99980138987788999999829805444431130586779871950523-27999974378843899996178730027
Q gi|254780321|r   14 FSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKA-QTVRLNYTSTDAKDYQLNLIDTPGHVDFT   92 (606)
Q Consensus        14 ~~IiaHvDhGKTTL~d~lL~~tg~i~~~~~~~~vlD~~~~EreRGITIka-~~~~~~~~~~~~~~y~iNlIDTPGH~DF~   92 (606)
T Consensus         4 ivllGd~~VGKTsli~r~~--~~~f~~~y-~~--------------Ti~~~~~k~i~---~~~~~~~l~iwDtaG~e~~~   63 (163)
T cd04136           4 VVVLGSGGVGKSALTVQFV--QGIFVEKY-DP--------------TIEDSYRKQIE---VDGQQCMLEILDTAGTEQFT   63 (163)
T ss_pred             EEEECCCCCCHHHHHHHHH--HCCCCCCC-CC--------------CCCCEEEEEEE---ECCEEEEEEECCCCCCHHHH
T ss_conf             9998999988999999997--19598866-99--------------54206999999---99999999864576544555


Q ss_pred             HHHHHHHHHCCEEEEEEECCCCCCHHHHH---HHHHH-H----HCCCCEEEEECCCCCCCCCCC--CHHHHHHHHHHHHH
Q ss_conf             99999997302689999868788655899---99999-9----709967998326788753211--33888775553223
Q gi|254780321|r   93 YEVSRSLSACEGSLLVVDATQGVEAQTLA---NVYQA-I----DNNHEIITVLNKADLPSADPD--RVKKQIEETIGIST  162 (606)
Q Consensus        93 ~EV~r~l~a~dgaiLvVdA~~Gvq~QT~~---~~~~A-~----~~~l~~I~viNKiD~~~A~~e--~v~~ei~~~~g~~~  162 (606)
T Consensus        64 ~~~~~y~~~a~~~ilvydvt~---~~Sf~~l~~~~~~i~~~~~~~~~piilVGnK~Dl~~~r~v~~~~~~~~a~~~~~--  138 (163)
T cd04136          64 AMRDLYIKNGQGFVLVYSITS---QSSFNDLQDLREQILRVKDTENVPMVLVGNKCDLEDERVVSREEGQALARQWGC--  138 (163)
T ss_pred             HHHHHHHCCCCEEEEEECCCC---HHHHHHHHHHHHHHHHHCCCCCCCEEEEECCCCHHHHCCCCHHHHHHHHHHCCC--
T ss_conf             678988346876999704898---899999999999999861888886787623547264078999999999998499--


Q ss_pred             HHHHHHHHHCCCCCCHHHHHHHHHH
Q ss_conf             2100011100223200678776321
Q gi|254780321|r  163 EDALLVSAKTGEGIPLLLERIVQQL  187 (606)
Q Consensus       163 ~~ii~vSAktG~GV~~LLd~Iv~~i  187 (606)
T Consensus       139 -~~~E~SAk~~~nV~e~F~~l~~~i  162 (163)
T cd04136         139 -PFYETSAKSKINVDEVFADLVRQI  162 (163)
T ss_pred             -EEEEECCCCCCCHHHHHHHHHHHH
T ss_conf             -899974487805899999999963