HHsearch alignment for GI: 254780321 and conserved domain: cd04138

>cd04138 H_N_K_Ras_like H-Ras/N-Ras/K-Ras subfamily. H-Ras, N-Ras, and K-Ras4A/4B are the prototypical members of the Ras family. These isoforms generate distinct signal outputs despite interacting with a common set of activators and effectors, and are strongly associated with oncogenic progression in tumor initiation. Mutated versions of Ras that are insensitive to GAP stimulation (and are therefore constitutively active) are found in a significant fraction of human cancers. Many Ras guanine nucleotide exchange factors (GEFs) have been identified. They are sequestered in the cytosol until activation by growth factors triggers recruitment to the plasma membrane or Golgi, where the GEF colocalizes with Ras. Active (GTP-bound) Ras interacts with several effector proteins that stimulate a variety of diverse cytoplasmic signaling activities. Some are known to positively mediate the oncogenic properties of Ras, including Raf, phosphatidylinositol 3-kinase (PI3K), RalGEFs, and Tiam1.
Probab=99.41  E-value=9.6e-12  Score=98.31  Aligned_cols=151  Identities=22%  Similarity=0.305  Sum_probs=99.8

Q ss_pred             EEEEECCCCCCHHHHHHHHHHHCCCCCCCCCCCEEECCCHHHHHHCCEEEEEEEEEEEECCCCCEEEEEEEECCCCCHHH
Q ss_conf             79998013898778899999982980544443113058677987195052327999974378843899996178730027
Q gi|254780321|r   13 NFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVRLNYTSTDAKDYQLNLIDTPGHVDFT   92 (606)
Q Consensus        13 N~~IiaHvDhGKTTL~d~lL~~tg~i~~~~~~~~vlD~~~~EreRGITIka~~~~~~~~~~~~~~y~iNlIDTPGH~DF~   92 (606)
T Consensus         3 KvvlvGd~~VGKTsli~r~~--~~~F~~~y---------------~~Ti~~~-~~k~-~~i~~~~~~l~iwDtaG~e~~~   63 (162)
T cd04138           3 KLVVVGAGGVGKSALTIQLI--QNHFVDEY---------------DPTIEDS-YRKQ-VVIDGETCLLDILDTAGQEEYS   63 (162)
T ss_pred             EEEEECCCCCCHHHHHHHHH--HCCCCCCC---------------CCCCCCE-EEEE-EEECCEEEEEEEEECCCCCCCC
T ss_conf             99998999988999999998--39288756---------------8855527-9999-9999999999999799860111


Q ss_pred             HHHHHHHHHCCEEEEEEECCCCCCHHHHHHHHHHHH-----CCCCEEEEECCCCCCCCCCCCHHHHHH---HHHHHHHHH
Q ss_conf             999999973026899998687886558999999997-----099679983267887532113388877---555322321
Q gi|254780321|r   93 YEVSRSLSACEGSLLVVDATQGVEAQTLANVYQAID-----NNHEIITVLNKADLPSADPDRVKKQIE---ETIGISTED  164 (606)
Q Consensus        93 ~EV~r~l~a~dgaiLvVdA~~Gvq~QT~~~~~~A~~-----~~l~~I~viNKiD~~~A~~e~v~~ei~---~~~g~~~~~  164 (606)
T Consensus        64 ~l~~~~~~~a~~~ilvydvt~~~Sf~~v~~w~~~i~~~~~~~~~piilVgNK~Dl~~r~V~--~~e~~~~a~~~~~---~  138 (162)
T cd04138          64 AMRDQYMRTGEGFLCVFAINSRKSFEDIHTYREQIKRVKDSDDVPMVLVGNKCDLAARTVS--SRQGQDLAKSYGI---P  138 (162)
T ss_pred             HHHHHHHCCCCEEEEEEECCCHHHHHHHHHHHHHHHHHCCCCCCEEEEEEEECCHHHCCCC--HHHHHHHHHHCCC---E
T ss_conf             4789871578779999617988999989999999998548888549999765356455588--9999999998099---8


Q ss_pred             HHHHHHHCCCCCCHHHHHHHHHH
Q ss_conf             00011100223200678776321
Q gi|254780321|r  165 ALLVSAKTGEGIPLLLERIVQQL  187 (606)
Q Consensus       165 ii~vSAktG~GV~~LLd~Iv~~i  187 (606)
T Consensus       139 f~E~SAk~~~nV~e~F~~l~~~I  161 (162)
T cd04138         139 YIETSAKTRQGVEEAFYTLVREI  161 (162)
T ss_pred             EEEECCCCCCCHHHHHHHHHHHC
T ss_conf             99973899859899999999963