HHsearch alignment for GI: 254780321 and conserved domain: cd04143

>cd04143 Rhes_like Rhes_like subfamily. This subfamily includes Rhes (Ras homolog enriched in striatum) and Dexras1/AGS1 (activator of G-protein signaling 1). These proteins are homologous, but exhibit significant differences in tissue distribution and subcellular localization. Rhes is found primarily in the striatum of the brain, but is also expressed in other areas of the brain, such as the cerebral cortex, hippocampus, inferior colliculus, and cerebellum. Rhes expression is controlled by thyroid hormones. In rat PC12 cells, Rhes is farnesylated and localizes to the plasma membrane. Rhes binds and activates PI3K, and plays a role in coupling serpentine membrane receptors with heterotrimeric G-protein signaling. Rhes has recently been shown to be reduced under conditions of dopamine supersensitivity and may play a role in determining dopamine receptor sensitivity. Dexras1/AGS1 is a dexamethasone-induced Ras protein that is expressed primarily in the brain, with low expression l
Probab=99.13  E-value=1.7e-09  Score=83.31  Aligned_cols=158  Identities=18%  Similarity=0.271  Sum_probs=102.4

Q ss_pred             EEEECCCCCCHHHHHHHHHHHCCCCCCCCCCCEEECCCHHHHHHCCEEEEEEEEEEEECCCCCEEEEEEEECCCCCHHHH
Q ss_conf             99980138987788999999829805444431130586779871950523279999743788438999961787300279
Q gi|254780321|r   14 FSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVRLNYTSTDAKDYQLNLIDTPGHVDFTY   93 (606)
Q Consensus        14 ~~IiaHvDhGKTTL~d~lL~~tg~i~~~~~~~~vlD~~~~EreRGITIka~~~~~~~~~~~~~~y~iNlIDTPGH~DF~~   93 (606)
T Consensus         3 IvvlGdsgVGKTSLi~Rf~--~~~F~~~y-~pTi------~-d----~~~k~i~-----i~g~~v~L~IwDTaGqe~f~s   63 (247)
T cd04143           3 MVVLGASKVGKTAIVSRFL--GGRFEEQY-TPTI------E-D----FHRKLYS-----IRGEVYQLDILDTSGNHPFPA   63 (247)
T ss_pred             EEEECCCCCCHHHHHHHHH--CCCCCCCC-CCCH------H-H----EEEEEEE-----ECCEEEEEEEEECCCCCCCCC
T ss_conf             9999989978999999996--49689987-8883------5-3----1889999-----999999999996766536874


Q ss_pred             HHHHHHHHCCEEEEEEECCCCCCHHHHHHHHHHH-------------HCCCCEEEEECCCCCCCCCCCCHHHHHHHHHHH
Q ss_conf             9999997302689999868788655899999999-------------709967998326788753211338887755532
Q gi|254780321|r   94 EVSRSLSACEGSLLVVDATQGVEAQTLANVYQAI-------------DNNHEIITVLNKADLPSADPDRVKKQIEETIGI  160 (606)
Q Consensus        94 EV~r~l~a~dgaiLvVdA~~Gvq~QT~~~~~~A~-------------~~~l~~I~viNKiD~~~A~~e~v~~ei~~~~g~  160 (606)
T Consensus        64 l~~~y~~~a~~~IlVYDITnr~SFe~v~~w~~~I~e~k~~~~~~~~~~~~vpiiLVGNK~DL~~~R-~Vs~eEa~~~~A~  142 (247)
T cd04143          64 MRRLSILTGDVFILVFSLDNRESFEEVCRLREQILETKSCLKNKTKENVKIPMVICGNKADRDFPR-EVQRDEVEQLVGG  142 (247)
T ss_pred             CHHHHHHCCCEEEEEEECCCHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCEEEEEECCCCHHCC-CCCHHHHHHHHHH
T ss_conf             420131217789999979987899989999999998640010013578887589986655432017-8799999999997


Q ss_pred             -HHHHHHHHHHHCCCCCCHHHHHHHHHHHCCC
Q ss_conf             -2321000111002232006787763210001
Q gi|254780321|r  161 -STEDALLVSAKTGEGIPLLLERIVQQLPSPT  191 (606)
Q Consensus       161 -~~~~ii~vSAktG~GV~~LLd~Iv~~iP~P~  191 (606)
T Consensus       143 ~~~~~f~EtSAKt~~NV~E~F~~L~~~~~l~~  174 (247)
T cd04143         143 DENCAYFEVSAKKNSNLDEMFRALFSLAKLPN  174 (247)
T ss_pred             HCCCEEEECCCCCCCCHHHHHHHHHHHCCCCC
T ss_conf             68987998878999498999999998549986