HHsearch alignment for GI: 254780321 and conserved domain: cd04159

>cd04159 Arl10_like Arl10-like subfamily. Arl9/Arl10 was identified from a human cancer-derived EST dataset. No functional information about the subfamily is available at the current time, but crystal structures of human Arl10b and Arl10c have been solved.
Probab=99.53  E-value=1.3e-13  Score=110.82  Aligned_cols=147  Identities=21%  Similarity=0.333  Sum_probs=97.6

Q ss_pred             EEEECCCCCCHHHHHHHHHHHCCCCCCCCCCCEEECCCHHHHHHCCEEEEEEEEEEEECCCCCEEEEEEEECCCCCHHHH
Q ss_conf             99980138987788999999829805444431130586779871950523279999743788438999961787300279
Q gi|254780321|r   14 FSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVRLNYTSTDAKDYQLNLIDTPGHVDFTY   93 (606)
Q Consensus        14 ~~IiaHvDhGKTTL~d~lL~~tg~i~~~~~~~~vlD~~~~EreRGITIka~~~~~~~~~~~~~~y~iNlIDTPGH~DF~~   93 (606)
T Consensus         2 I~llG~~~~GKTsll~~~~--~~~f~~~~-~pTi----------g~~~~----~i~-----~~~~~l~iwDt~G~e~~~~   59 (159)
T cd04159           2 ITLVGLQNSGKTTLVNVIA--GGQFSEDT-IPTV----------GFNMR----KVT-----KGNVTLKVWDLGGQPRFRS   59 (159)
T ss_pred             EEEECCCCCCHHHHHHHHH--CCCCCCCC-CCCC----------CEEEE----EEE-----ECCEEEEEEECCCHHHHHH
T ss_conf             8999999986999999997--59998861-6732----------50589----999-----8999999997983587799


Q ss_pred             HHHHHHHHCCEEEEEEECCCCCCHHHHHH----HHHHH----HCCCCEEEEECCCCCCCCCC-CCHHHHHHHHHHHHH--
Q ss_conf             99999973026899998687886558999----99999----70996799832678875321-133888775553223--
Q gi|254780321|r   94 EVSRSLSACEGSLLVVDATQGVEAQTLAN----VYQAI----DNNHEIITVLNKADLPSADP-DRVKKQIEETIGIST--  162 (606)
Q Consensus        94 EV~r~l~a~dgaiLvVdA~~Gvq~QT~~~----~~~A~----~~~l~~I~viNKiD~~~A~~-e~v~~ei~~~~g~~~--  162 (606)
T Consensus        60 l~~~y~~~~~~ii~V~D~sd---~~s~~~~~~~l~~~~~~~~~~~~piliv~NK~Dl~~~~~~~~i~~~~-~~~~~~~~~  135 (159)
T cd04159          60 MWERYCRGVNAIVYVVDAAD---RTALEAAKNELHDLLEKPSLEGIPLLVLGNKNDLPGALSVDELIEQM-NLKSITDRE  135 (159)
T ss_pred             HHHHHHCCCCEEEECCCCCC---HHHHHHHHHHHHHHHHHHCCCCCEEEEEEECCCCCCCCCHHHHHHHH-HHHHHHCCC
T ss_conf             99987468636875157787---88999999999999854434898289888356764347899999999-999873499


Q ss_pred             HHHHHHHHHCCCCCCHHHHHHHHH
Q ss_conf             210001110022320067877632
Q gi|254780321|r  163 EDALLVSAKTGEGIPLLLERIVQQ  186 (606)
Q Consensus       163 ~~ii~vSAktG~GV~~LLd~Iv~~  186 (606)
T Consensus       136 ~~~~~~SAktg~gI~e~f~wL~~~  159 (159)
T cd04159         136 VSCYSISCKEKTNIDIVLDWLIKH  159 (159)
T ss_pred             CEEEEEECCCCCCHHHHHHHHHCC
T ss_conf             879999796896989999999659