HHsearch alignment for GI: 254780321 and conserved domain: cd04161

>cd04161 Arl2l1_Arl13_like Arl2l1/Arl13 subfamily. Arl2l1 (Arl2-like protein 1) and Arl13 form a subfamily of the Arf family of small GTPases. Arl2l1 was identified in human cells during a search for the gene(s) responsible for Bardet-Biedl syndrome (BBS). Like Arl6, the identified BBS gene, Arl2l1 is proposed to have cilia-specific functions. Arl13 is found on the X chromosome, but its expression has not been confirmed; it may be a pseudogene.
Probab=99.16  E-value=1.1e-09  Score=84.44  Aligned_cols=145  Identities=19%  Similarity=0.206  Sum_probs=94.9

Q ss_pred             EEEECCCCCCHHHHHHHHHHHCCCCCCCCCCCEEECCCHHHHHHCCEEEEEEEEEEEECCCCCEEEEEEEECCCCCHHHH
Q ss_conf             99980138987788999999829805444431130586779871950523279999743788438999961787300279
Q gi|254780321|r   14 FSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVRLNYTSTDAKDYQLNLIDTPGHVDFTY   93 (606)
Q Consensus        14 ~~IiaHvDhGKTTL~d~lL~~tg~i~~~~~~~~vlD~~~~EreRGITIka~~~~~~~~~~~~~~y~iNlIDTPGH~DF~~   93 (606)
T Consensus         2 ililGLd~aGKTTil~~l~--~~~~~~--~--------------~PT~G~~~~~~~~-----~~~~l~~~DlgG~~~~R~   58 (167)
T cd04161           2 LLTVGLDNAGKTTLVSALQ--GEIPKK--V--------------APTVGFTPTKLRL-----DKYEVCIFDLGGGANFRG   58 (167)
T ss_pred             EEEEEECCCCHHHHHHHHC--CCCCCC--C--------------CCCCCCCEEEEEE-----CCEEEEEEECCCCHHHHH
T ss_conf             8999008998899999982--899876--5--------------0877731799998-----999999998998778889


Q ss_pred             HHHHHHHHCCEEEEEEECCCCC-CHHHHHHHHHHHH----CCCCEEEEECCCCCCCCCCCCHHHHHHHHHHHHH------
Q ss_conf             9999997302689999868788-6558999999997----0996799832678875321133888775553223------
Q gi|254780321|r   94 EVSRSLSACEGSLLVVDATQGV-EAQTLANVYQAID----NNHEIITVLNKADLPSADPDRVKKQIEETIGIST------  162 (606)
Q Consensus        94 EV~r~l~a~dgaiLvVdA~~Gv-q~QT~~~~~~A~~----~~l~~I~viNKiD~~~A~~e~v~~ei~~~~g~~~------  162 (606)
T Consensus        59 lW~~Y~~~~~gIIfVVDssD~~rl~eak~~L~~lL~~~~l~~~PiLIlaNKqDl~~a~~~---~ei~~~L~L~~l~~~~~  135 (167)
T cd04161          59 IWVNYYAEAHGLVFVVDSSDDDRVQEVKEILRELLQHPRVSGKPILVLANKQDKKNALLG---ADVIEYLSLEKLVNENK  135 (167)
T ss_pred             HHHHHCCCCCEEEEEEECCCHHHHHHHHHHHHHHHCCHHHCCCEEEEEEECCCCCCCCCH---HHHHHHHCCHHHCCCCC
T ss_conf             999873477657999855758899999999999965887789959999886576158999---99998819742408998


Q ss_pred             --HHHHHHHHHCCCC------CCHHHHHHH
Q ss_conf             --2100011100223------200678776
Q gi|254780321|r  163 --EDALLVSAKTGEG------IPLLLERIV  184 (606)
Q Consensus       163 --~~ii~vSAktG~G------V~~LLd~Iv  184 (606)
T Consensus       136 ~~~~I~~csA~tG~G~~~~~~l~eGl~WL~  165 (167)
T cd04161         136 SLCHIEPCSAIEGLGKKIDPSIVEGLRWLL  165 (167)
T ss_pred             CEEEEEECEEECCCCCCCCCCHHHHHHHHH
T ss_conf             637999576444888787663154998986