>cd04170 EF-G_bact Elongation factor G (EF-G) subfamily. Translocation is mediated by EF-G (also called translocase). The structure of EF-G closely resembles that of the complex between EF-Tu and tRNA. This is an example of molecular mimicry; a protein domain evolved so that it mimics the shape of a tRNA molecule. EF-G in the GTP form binds to the ribosome, primarily through the interaction of its EF-Tu-like domain with the 50S subunit. The binding of EF-G to the ribosome in this manner stimulates the GTPase activity of EF-G. On GTP hydrolysis, EF-G undergoes a conformational change that forces its arm deeper into the A site on the 30S subunit. To accommodate this domain, the peptidyl-tRNA in the A site moves to the P site, carrying the mRNA and the deacylated tRNA with it. The ribosome may be prepared for these rearrangements by the initial binding of EF-G as well. The dissociation of EF-G leaves the ribosome ready to accept the next aminoacyl-tRNA into the A site. This group

Probab=100.00 E-value=0 Score=385.33 Aligned_cols=142 Identities=32% Similarity=0.404 Sum_probs=134.2 Q ss_pred EEEEECCCCCCHHHHHHHHHHHCCCCCCCC---CCCEEECCCHHHHHHCCEEEEEEEEEEEECCCCCEEEEEEEECCCCC Q ss_conf 799980138987788999999829805444---43113058677987195052327999974378843899996178730 Q gi|254780321|r 13 NFSIVAHIDHGKSTLADRFIQHCRGLTERE---MSSQVLDNMDIERERGITIKAQTVRLNYTSTDAKDYQLNLIDTPGHV 89 (606) Q Consensus 13 N~~IiaHvDhGKTTL~d~lL~~tg~i~~~~---~~~~vlD~~~~EreRGITIka~~~~~~~~~~~~~~y~iNlIDTPGH~ 89 (606) T Consensus 1 Ni~iigH~~aGKTtL~E~lL~~~g~i~~~G~V~~g~t~~D~~~~E~~RgiSi~s~~~~~~w-----~~~~inliDTPG~~ 75 (268) T cd04170 1 NIALVGHSGSGKTTLAEALLYATGAIDRLGSVEDGTTVSDYDPEEIKRKMSISTSVAPLEW-----KGHKINLIDTPGYA 75 (268) T ss_pred CEEEEECCCCCHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCHHHHHCCCCEECCEEEEEE-----CCEEEEEEECCCCH T ss_conf 9899908999989999999996699665765458973577878898679675135578888-----99799998698975 Q ss_pred HHHHHHHHHHHHCCEEEEEEECCCCCCHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCCHHHHHHHHHH Q ss_conf 0279999999730268999986878865589999999970996799832678875321133888775553 Q gi|254780321|r 90 DFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQAIDNNHEIITVLNKADLPSADPDRVKKQIEETIG 159 (606) Q Consensus 90 DF~~EV~r~l~a~dgaiLvVdA~~Gvq~QT~~~~~~A~~~~l~~I~viNKiD~~~A~~e~v~~ei~~~~g 159 (606) T Consensus 76 DF~~e~~~aL~v~D~Av~Vida~~GVe~~T~~~w~~~~~~~iP~i~fINKmDr~~ad~~~~l~~i~~~lg 145 (268) T cd04170 76 DFVGETRAALRAADAALVVVSAQSGVEVGTEKLWEFADEAGIPRIIFINKMDRERADFDKTLAALQEAFG 145 (268) T ss_pred HHHHHHHHHHCCCCEEEEEECCCCCHHHHHHHHHHHHHHCCCCEEEEEECCCCCCCCHHHHHHHHHHHHC T ss_conf 7999999984047839999418754768799999999985999899997878789964779999999868

HHsearch alignment for GI: 254780321 and conserved domain: cd04170