Query         gi|254780321|ref|YP_003064734.1| GTP-binding protein LepA [Candidatus Liberibacter asiaticus str. psy62]
Match_columns 606
No_of_seqs    317 out of 5227
Neff          6.0 
Searched_HMMs 39220
Date          Sun May 29 15:36:42 2011
Command       /home/congqian_1/programs/hhpred/hhsearch -i 254780321.hhm -d /home/congqian_1/database/cdd/Cdd.hhm 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 TIGR01393 lepA GTP-binding pro 100.0       0       0 2101.7  38.4  594    9-604     1-598 (598)
  2 PRK05433 GTP-binding protein L 100.0       0       0 1768.7  43.3  599    6-606     2-601 (601)
  3 COG0481 LepA Membrane GTPase L 100.0       0       0 1726.4  41.9  601    4-606     2-603 (603)
  4 KOG0462 consensus              100.0       0       0 1489.6  35.1  594    6-603    55-650 (650)
  5 TIGR01394 TypA_BipA GTP-bindin 100.0       0       0 1165.1  24.2  518   11-587     1-567 (609)
  6 PRK10218 GTP-binding protein;  100.0       0       0 1101.5  37.1  535    8-605     2-576 (607)
  7 COG1217 TypA Predicted membran 100.0       0       0  963.3  29.4  514    8-584     2-553 (603)
  8 PRK00007 elongation factor G;  100.0       0       0  904.9  39.5  467    4-486     3-679 (693)
  9 PRK13351 elongation factor G;  100.0       0       0  861.0  41.4  466    5-487     2-676 (687)
 10 PRK12740 elongation factor G;  100.0       0       0  854.4  39.2  454   17-487     1-660 (670)
 11 PRK12739 elongation factor G;  100.0       0       0  849.3  40.9  466    4-486     3-677 (693)
 12 PRK07560 elongation factor EF- 100.0       0       0  849.8  40.0  468    8-487    17-699 (730)
 13 TIGR00484 EF-G translation elo 100.0       0       0  868.6  16.6  469    5-487     4-691 (705)
 14 COG0480 FusA Translation elong 100.0       0       0  838.6  38.4  467    6-488     5-680 (697)
 15 KOG0465 consensus              100.0       0       0  786.1  24.1  465    5-487    33-709 (721)
 16 PRK00741 prfC peptide chain re 100.0       0       0  670.5  28.9  358    7-381     6-467 (526)
 17 TIGR00490 aEF-2 translation el 100.0       0       0  593.0  26.4  466    8-486    16-702 (724)
 18 KOG0464 consensus              100.0       0       0  598.4  19.3  470    4-488    30-738 (753)
 19 COG4108 PrfC Peptide chain rel 100.0       0       0  496.1  22.1  359    7-381     8-469 (528)
 20 KOG0469 consensus              100.0       0       0  487.7  22.3  479    9-507    17-815 (842)
 21 TIGR00503 prfC peptide chain r 100.0       0       0  462.2  12.3  361    5-381     5-471 (530)
 22 KOG0467 consensus              100.0       0       0  416.6  23.3  469    5-489     3-830 (887)
 23 cd01890 LepA LepA subfamily.   100.0       0       0  419.5  17.7  179   12-190     1-179 (179)
 24 cd01891 TypA_BipA TypA (tyrosi 100.0       0       0  399.6  17.3  176   10-190     1-194 (194)
 25 cd01885 EF2 EF2 (for archaea a 100.0       0       0  386.4  17.0  179   12-190     1-222 (222)
 26 cd04170 EF-G_bact Elongation f 100.0       0       0  385.3  16.3  142   13-159     1-145 (268)
 27 cd04169 RF3 RF3 subfamily.  Pe 100.0       0       0  384.9  16.5  176   10-190     1-267 (267)
 28 KOG0468 consensus              100.0       0       0  369.8  26.7  467    9-486   126-905 (971)
 29 cd04167 Snu114p Snu114p subfam 100.0       0       0  379.0  16.1  179   12-190     1-213 (213)
 30 cd01886 EF-G Elongation factor 100.0       0       0  372.6  16.9  142   13-159     1-145 (270)
 31 PRK12317 elongation factor 1-a 100.0       0       0  364.2  19.0  267   11-289     7-313 (426)
 32 cd04168 TetM_like Tet(M)-like  100.0       0       0  365.7  16.3  172   13-189     1-236 (237)
 33 PRK05124 cysN sulfate adenylyl 100.0       0       0  351.2  21.5  268    9-289    25-330 (475)
 34 PTZ00336 elongation factor 1-a 100.0       0       0  354.4  18.6  265   12-288     8-319 (449)
 35 PTZ00141 elongation factor 1 a 100.0       0       0  349.8  17.6  266   11-288     7-317 (443)
 36 COG5256 TEF1 Translation elong 100.0       0       0  348.8  18.1  273   12-297     8-325 (428)
 37 PRK12736 elongation factor Tu; 100.0       0       0  352.2  14.4  279    1-288     1-298 (394)
 38 PRK00049 elongation factor Tu; 100.0       0       0  346.2  18.2  277    1-288     1-301 (397)
 39 cd00881 GTP_translation_factor 100.0       0       0  345.4  17.3  173   13-190     1-189 (189)
 40 cd01884 EF_Tu EF-Tu subfamily. 100.0       0       0  347.0  14.4  174   12-190     3-195 (195)
 41 PRK12735 elongation factor Tu; 100.0       0       0  343.4  16.9  277    1-288     1-300 (396)
 42 TIGR00483 EF-1_alpha translati 100.0       0       0  350.8  11.1  320   11-343     7-393 (445)
 43 PRK04000 translation initiatio 100.0       0       0  342.1  17.2  270    1-288     1-318 (410)
 44 CHL00071 tufA elongation facto 100.0       0       0  339.4  17.5  267   11-288    12-308 (409)
 45 cd01889 SelB_euk SelB subfamil 100.0       0       0  339.7  15.6  172   13-192     2-190 (192)
 46 PRK05506 bifunctional sulfate  100.0       0       0  328.7  20.8  268    9-289     5-309 (613)
 47 TIGR00475 selB selenocysteine- 100.0       0       0  330.4  15.2  257   13-287     2-269 (627)
 48 pfam06421 LepA_C GTP-binding p 100.0       0       0  343.0   5.4  108  496-603     1-108 (108)
 49 PRK10512 selenocysteinyl-tRNA- 100.0 4.2E-45       0  322.4  18.5  249   14-287     3-260 (615)
 50 PRK12312 infB translation init 100.0 2.1E-44       0  317.6  16.5  424   13-490   119-600 (610)
 51 CHL00189 infB translation init 100.0 2.7E-44       0  316.9  16.9  426   13-490   274-758 (770)
 52 cd01883 EF1_alpha Eukaryotic e 100.0 2.2E-44       0  317.4  14.6  173   13-191     1-219 (219)
 53 pfam00009 GTP_EFTU Elongation  100.0 5.2E-44       0  315.0  15.1  176    9-189     1-185 (185)
 54 KOG0460 consensus              100.0 2.4E-44       0  317.3  11.3  264   12-288    55-342 (449)
 55 PTZ00327 eukaryotic translatio 100.0 1.4E-42       0  305.4  18.6  263   11-288    37-355 (460)
 56 PRK05306 infB translation init 100.0 1.3E-42       0  305.7  18.1  427   13-490   343-828 (839)
 57 COG0050 TufB GTPases - transla 100.0   2E-43       0  311.0  13.1  265   11-288    12-298 (394)
 58 cd04166 CysN_ATPS CysN_ATPS su 100.0   9E-42       0  299.9  14.2  160   13-177     1-183 (208)
 59 cd01888 eIF2_gamma eIF2-gamma  100.0 4.1E-42       0  302.2  11.4  167   13-191     2-202 (203)
 60 PRK04004 translation initiatio 100.0 2.1E-39 5.2E-44  284.1  17.0  211   14-239     8-271 (592)
 61 KOG0458 consensus              100.0 1.9E-38 4.8E-43  277.6  16.5  272    6-290   172-494 (603)
 62 KOG1145 consensus              100.0 1.8E-38 4.7E-43  277.7  16.3  247   13-287   155-408 (683)
 63 COG0532 InfB Translation initi 100.0   2E-38 5.2E-43  277.4  15.9  209   14-240     8-222 (509)
 64 COG3276 SelB Selenocysteine-sp 100.0 7.4E-38 1.9E-42  273.6  15.7  251   13-287     2-256 (447)
 65 COG2895 CysN GTPases - Sulfate 100.0 3.8E-37 9.7E-42  268.8  15.0  290   11-319     6-335 (431)
 66 TIGR02034 CysN sulfate adenyly 100.0   1E-37 2.6E-42  272.7  11.1  286   14-317     3-331 (411)
 67 TIGR00485 EF-Tu translation el 100.0 4.8E-36 1.2E-40  261.5  10.5  270   10-288    11-298 (394)
 68 cd04171 SelB SelB subfamily.   100.0 2.1E-34 5.4E-39  250.4  14.1  156   14-185     3-163 (164)
 69 cd01887 IF2_eIF5B IF2/eIF5B (i 100.0 1.3E-32 3.4E-37  238.4  14.1  157   13-186     2-164 (168)
 70 COG5257 GCD11 Translation init 100.0 2.9E-32 7.5E-37  236.0  13.2  238   10-263     9-292 (415)
 71 KOG0459 consensus              100.0 2.4E-31 6.2E-36  229.9   6.1  272    7-291    75-394 (501)
 72 KOG0461 consensus              100.0 4.5E-29 1.1E-33  214.7  11.2  250    7-270     4-271 (522)
 73 cd04165 GTPBP1_like GTPBP1-lik 100.0 7.8E-28   2E-32  206.4  12.4  174   14-190     2-224 (224)
 74 COG5258 GTPBP1 GTPase [General  99.9 3.3E-27 8.5E-32  202.1  12.8  277    3-289   110-439 (527)
 75 cd03709 lepA_C lepA_C: This fa  99.9 3.6E-27 9.1E-32  201.9   8.1   79  410-488     1-80  (80)
 76 TIGR00487 IF-2 translation ini  99.9 3.3E-25 8.4E-30  188.7  13.4  207   12-237    91-303 (594)
 77 TIGR00491 aIF-2 translation in  99.9 1.1E-24 2.7E-29  185.3   9.8  310   15-373   558-929 (1145)
 78 cd03699 lepA_II lepA_II: This   99.9 8.1E-26 2.1E-30  192.8   4.0   86  200-285     1-86  (86)
 79 KOG1144 consensus               99.9 3.3E-23 8.4E-28  175.3  13.7  235    9-252   471-752 (1064)
 80 KOG0466 consensus               99.9 1.5E-23 3.8E-28  177.6   6.1  253   11-289    38-350 (466)
 81 cd03710 BipA_TypA_C BipA_TypA_  99.9   8E-22   2E-26  166.0   7.9   77  410-487     1-78  (79)
 82 cd04097 mtEFG1_C mtEFG1_C: C-t  99.8 9.8E-21 2.5E-25  158.7   8.1   77  410-487     1-77  (78)
 83 smart00838 EFG_C Elongation fa  99.8 1.2E-20   3E-25  158.2   8.1   79  408-487     1-79  (85)
 84 cd01895 EngA2 EngA2 subfamily.  99.8 2.3E-19 5.9E-24  149.5  13.7  154   13-186     4-173 (174)
 85 cd03713 EFG_mtEFG_C EFG_mtEFG_  99.8 7.3E-20 1.9E-24  152.8   8.0   77  410-487     1-77  (78)
 86 cd03711 Tet_C Tet_C: C-terminu  99.8 1.9E-19 4.7E-24  150.1   8.3   77  410-487     1-77  (78)
 87 pfam00679 EFG_C Elongation fac  99.8 1.1E-19 2.9E-24  151.5   7.1   82  408-490     2-84  (89)
 88 cd01894 EngA1 EngA1 subfamily.  99.8 8.7E-18 2.2E-22  138.9  13.1  149   15-187     1-157 (157)
 89 cd04163 Era Era subfamily.  Er  99.8 1.4E-17 3.5E-22  137.5  13.6  155   13-187     5-168 (168)
 90 cd00880 Era_like Era (E. coli   99.8 1.1E-17 2.8E-22  138.2  12.1  154   16-187     1-163 (163)
 91 cd01876 YihA_EngB The YihA (En  99.8 1.1E-17 2.9E-22  138.1  12.0  153   14-187     2-170 (170)
 92 PRK00089 era GTP-binding prote  99.8 2.8E-17 7.1E-22  135.5  13.4  158   11-189     8-174 (296)
 93 cd04096 eEF2_snRNP_like_C eEF2  99.7 3.9E-18   1E-22  141.2   7.7   77  410-487     1-79  (80)
 94 cd01514 Elongation_Factor_C El  99.7   5E-18 1.3E-22  140.5   8.0   78  410-488     1-79  (79)
 95 TIGR03594 GTPase_EngA ribosome  99.7 1.6E-16 4.2E-21  130.3  12.7  155   14-192     2-164 (429)
 96 PRK00454 engB GTPase EngB; Rev  99.7 1.5E-16 3.9E-21  130.5  12.5  163    4-187    17-195 (196)
 97 PRK03003 engA GTP-binding prot  99.7 1.6E-16   4E-21  130.4  12.5  161    6-190    33-201 (474)
 98 PRK00093 engA GTP-binding prot  99.7 2.9E-16 7.4E-21  128.7  13.1  155   13-191     3-166 (438)
 99 cd04092 mtEFG2_II_like mtEFG2_  99.7 5.1E-18 1.3E-22  140.4   4.1   82  200-285     1-83  (83)
100 PRK09518 bifunctional cytidyla  99.7 6.7E-16 1.7E-20  126.2  13.6  158    9-190   277-442 (714)
101 pfam10662 PduV-EutP Ethanolami  99.7 1.1E-16 2.9E-21  131.4   9.3  133   14-184     4-142 (143)
102 cd03691 BipA_TypA_II BipA_TypA  99.7   5E-17 1.3E-21  133.8   5.4   82  200-285     1-86  (86)
103 PRK00093 engA GTP-binding prot  99.7 2.8E-15 7.2E-20  122.0  14.3  159    9-186   170-343 (438)
104 PRK03003 engA GTP-binding prot  99.7 2.5E-15 6.3E-20  122.4  13.9  158    9-186   209-380 (474)
105 TIGR03594 GTPase_EngA ribosome  99.7 2.6E-15 6.5E-20  122.3  14.0  159    9-186   170-342 (429)
106 pfam02421 FeoB_N Ferrous iron   99.7 1.2E-15 3.2E-20  124.4  12.3  153   13-190     1-162 (188)
107 pfam00025 Arf ADP-ribosylation  99.7 1.4E-15 3.5E-20  124.2  12.2  154   11-187    14-174 (174)
108 cd04088 EFG_mtEFG_II EFG_mtEFG  99.7 4.2E-17 1.1E-21  134.3   4.4   82  200-285     1-83  (83)
109 cd04098 eEF2_C_snRNP eEF2_C_sn  99.7 1.6E-16   4E-21  130.5   7.2   76  410-486     1-78  (80)
110 cd04155 Arl3 Arl3 subfamily.    99.7 1.4E-15 3.6E-20  124.0  12.0  151    9-185    12-172 (173)
111 cd04164 trmE TrmE (MnmE, ThdF,  99.7 1.8E-15 4.7E-20  123.3  12.4  146   13-187     3-156 (157)
112 COG1160 Predicted GTPases [Gen  99.7 3.2E-15 8.1E-20  121.7  13.2  155   12-191     4-167 (444)
113 PRK09518 bifunctional cytidyla  99.6 4.1E-15   1E-19  120.9  12.7  160    8-186   449-621 (714)
114 KOG0052 consensus               99.6 3.6E-17 9.1E-22  134.8   1.9  125   11-143     7-155 (391)
115 TIGR03598 GTPase_YsxC ribosome  99.6 2.7E-15 6.8E-20  122.2  11.3  154    3-177    10-179 (179)
116 cd04091 mtEFG1_II_like mtEFG1_  99.6 1.9E-16 4.9E-21  129.9   3.5   80  200-285     1-81  (81)
117 PRK04213 GTP-binding protein;   99.6 1.4E-14 3.7E-19  117.3  13.0  153   13-191     3-187 (195)
118 cd00878 Arf_Arl Arf (ADP-ribos  99.6 9.7E-15 2.5E-19  118.4  11.8  146   14-185     2-157 (158)
119 cd04160 Arfrp1 Arfrp1 subfamil  99.6 9.8E-15 2.5E-19  118.4  11.7  152   14-186     2-167 (167)
120 cd04154 Arl2 Arl2 subfamily.    99.6 1.2E-14   3E-19  117.8  12.0  149   11-185    14-172 (173)
121 COG1160 Predicted GTPases [Gen  99.6 1.7E-14 4.4E-19  116.8  11.1  206   10-238   177-405 (444)
122 COG1159 Era GTPase [General fu  99.6   3E-14 7.5E-19  115.2  12.3  157   12-189     7-173 (298)
123 cd01897 NOG NOG1 is a nucleola  99.6 6.6E-14 1.7E-18  112.8  13.6  152   13-187     2-167 (168)
124 cd01878 HflX HflX subfamily.    99.6 1.1E-13 2.7E-18  111.4  13.4  152   11-187    41-204 (204)
125 cd04152 Arl4_Arl7 Arl4/Arl7 su  99.6   2E-13   5E-18  109.7  14.0  156   13-189     5-171 (183)
126 cd00882 Ras_like_GTPase Ras-li  99.6   2E-13   5E-18  109.7  13.7  151   16-185     1-157 (157)
127 cd01879 FeoB Ferrous iron tran  99.6 6.5E-14 1.7E-18  112.9  11.0  147   16-187     1-156 (158)
128 pfam00071 Ras Ras family. Incl  99.5 1.7E-13 4.3E-18  110.1  12.7  155   14-187     2-160 (162)
129 cd01898 Obg Obg subfamily.  Th  99.5 1.8E-13 4.5E-18  110.0  12.7  154   13-187     2-170 (170)
130 cd04159 Arl10_like Arl10-like   99.5 1.3E-13 3.4E-18  110.8  11.5  147   14-186     2-159 (159)
131 cd04153 Arl5_Arl8 Arl5/Arl8 su  99.5 3.5E-13   9E-18  107.9  13.0  150   10-185    14-173 (174)
132 COG2229 Predicted GTPase [Gene  99.5 3.3E-13 8.4E-18  108.1  12.0  167   13-190    12-181 (187)
133 cd03690 Tet_II Tet_II: This su  99.5 1.5E-14 3.7E-19  117.3   4.8   84  197-285     1-85  (85)
134 cd04157 Arl6 Arl6 subfamily.    99.5 4.5E-13 1.1E-17  107.2  12.0  149   13-185     1-161 (162)
135 PTZ00133 ADP-ribosylation fact  99.5 6.2E-13 1.6E-17  106.3  12.7  151   11-187    17-177 (182)
136 cd04150 Arf1_5_like Arf1-Arf5-  99.5 5.8E-13 1.5E-17  106.5  12.5  147   13-185     2-158 (159)
137 cd04149 Arf6 Arf6 subfamily.    99.5 2.9E-13 7.4E-18  108.5  10.9  148   12-185    10-167 (168)
138 smart00177 ARF ARF-like small   99.5 7.9E-13   2E-17  105.6  13.0  150   12-187    14-173 (175)
139 cd03689 RF3_II RF3_II: this su  99.5 1.6E-14 4.2E-19  116.9   3.9   80  202-285     1-84  (85)
140 cd04151 Arl1 Arl1 subfamily.    99.5 4.7E-13 1.2E-17  107.1  10.9  146   14-185     2-157 (158)
141 cd04156 ARLTS1 ARLTS1 subfamil  99.5 2.2E-12 5.6E-17  102.6  13.9  147   14-185     2-159 (160)
142 cd01863 Rab18 Rab18 subfamily.  99.5 1.2E-12 3.2E-17  104.3  12.3  153   14-187     3-161 (161)
143 cd00876 Ras Ras family.  The R  99.5 3.7E-12 9.3E-17  101.1  14.3  154   14-187     2-160 (160)
144 cd04112 Rab26 Rab26 subfamily.  99.5 3.5E-12   9E-17  101.2  13.6  159   13-191     2-166 (191)
145 cd01860 Rab5_related Rab5-rela  99.5 4.2E-12 1.1E-16  100.7  13.8  157   13-188     3-163 (163)
146 TIGR00231 small_GTP small GTP-  99.4 3.7E-13 9.5E-18  107.8   8.1  166   10-183     2-184 (186)
147 cd04124 RabL2 RabL2 subfamily.  99.4 7.4E-12 1.9E-16   99.1  14.5  153   14-188     3-158 (161)
148 cd01867 Rab8_Rab10_Rab13_like   99.4 6.8E-12 1.7E-16   99.3  13.9  156   13-187     5-164 (167)
149 smart00175 RAB Rab subfamily o  99.4 4.8E-12 1.2E-16  100.3  13.2  156   13-187     2-161 (164)
150 cd00154 Rab Rab family.  Rab G  99.4 6.1E-12 1.6E-16   99.6  13.6  151   13-185     2-159 (159)
151 cd01881 Obg_like The Obg-like   99.4 2.8E-12 7.3E-17  101.9  11.8  151   16-187     1-176 (176)
152 cd04128 Spg1 Spg1p.  Spg1p (se  99.4 1.2E-11   3E-16   97.8  14.8  157   14-188     3-166 (182)
153 cd04123 Rab21 Rab21 subfamily.  99.4 3.6E-12 9.3E-17  101.2  12.1  156   13-187     2-161 (162)
154 cd04139 RalA_RalB RalA/RalB su  99.4 8.7E-12 2.2E-16   98.6  14.0  154   14-187     3-161 (164)
155 cd01893 Miro1 Miro1 subfamily.  99.4 1.2E-11 3.1E-16   97.7  14.7  157   14-190     3-166 (166)
156 cd04116 Rab9 Rab9 subfamily.    99.4 4.6E-12 1.2E-16  100.5  12.5  157   11-187     5-170 (170)
157 PTZ00132 GTP-binding nuclear p  99.4 5.3E-12 1.3E-16  100.1  12.4  154   13-187     8-164 (209)
158 cd01868 Rab11_like Rab11-like.  99.4 9.6E-12 2.4E-16   98.3  13.6  156   13-187     5-164 (165)
159 KOG0463 consensus               99.4 5.3E-13 1.4E-17  106.8   7.2  269   13-287   135-456 (641)
160 smart00173 RAS Ras subfamily o  99.4 1.2E-11 3.1E-16   97.6  14.0  150   14-187     3-161 (164)
161 cd01869 Rab1_Ypt1 Rab1/Ypt1 su  99.4 1.1E-11 2.7E-16   98.0  13.5  156   13-187     4-163 (166)
162 cd04101 RabL4 RabL4 (Rab-like4  99.4   3E-11 7.7E-16   95.0  15.7  157   14-187     3-163 (164)
163 cd04121 Rab40 Rab40 subfamily.  99.4 1.5E-11 3.8E-16   97.0  14.2  158   11-187     6-166 (189)
164 cd04138 H_N_K_Ras_like H-Ras/N  99.4 9.6E-12 2.5E-16   98.3  13.1  151   13-187     3-161 (162)
165 cd04137 RheB Rheb (Ras Homolog  99.4 1.3E-11 3.3E-16   97.5  13.6  155   12-188     2-163 (180)
166 cd04113 Rab4 Rab4 subfamily.    99.4 1.4E-11 3.5E-16   97.3  13.7  155   14-187     3-161 (161)
167 cd04110 Rab35 Rab35 subfamily.  99.4 9.4E-12 2.4E-16   98.4  12.7  161    9-188     4-167 (199)
168 cd04147 Ras_dva Ras-dva subfam  99.4 1.3E-11 3.3E-16   97.5  13.1  158   14-190     2-165 (198)
169 cd04127 Rab27A Rab27a subfamil  99.4 2.5E-11 6.3E-16   95.6  14.5  162   12-187     5-176 (180)
170 cd04119 RJL RJL (RabJ-Like) su  99.4 3.4E-11 8.6E-16   94.6  15.2  153   14-187     3-166 (168)
171 cd04120 Rab12 Rab12 subfamily.  99.4 1.7E-11 4.3E-16   96.7  13.6  155   14-187     3-162 (202)
172 cd00877 Ran Ran (Ras-related n  99.4 2.2E-11 5.5E-16   96.0  14.0  155   14-189     3-160 (166)
173 cd04107 Rab32_Rab38 Rab38/Rab3  99.4 1.9E-11 4.8E-16   96.4  13.6  157   14-188     3-168 (201)
174 cd04158 ARD1 ARD1 subfamily.    99.4 1.2E-11 3.2E-16   97.6  12.7  149   14-188     2-161 (169)
175 cd04108 Rab36_Rab34 Rab34/Rab3  99.4 2.4E-11 6.1E-16   95.7  13.9  156   14-187     3-164 (170)
176 cd04175 Rap1 Rap1 subgroup.  T  99.4 2.6E-11 6.7E-16   95.4  13.7  154   13-187     3-162 (164)
177 cd01862 Rab7 Rab7 subfamily.    99.4 3.9E-11 9.9E-16   94.3  14.5  155   14-187     3-166 (172)
178 cd04132 Rho4_like Rho4-like su  99.4 2.3E-11 5.9E-16   95.7  13.3  159   14-190     3-169 (187)
179 cd04176 Rap2 Rap2 subgroup.  T  99.4 2.8E-11 7.2E-16   95.2  13.5  151   13-187     3-162 (163)
180 cd04177 RSR1 RSR1 subgroup.  R  99.4 1.5E-11 3.7E-16   97.1  12.0  157   13-189     3-165 (168)
181 cd00879 Sar1 Sar1 subfamily.    99.4   2E-11 5.2E-16   96.1  12.7  152    9-186    17-189 (190)
182 cd04144 Ras2 Ras2 subfamily.    99.4 3.2E-11   8E-16   94.9  13.6  154   14-187     2-162 (190)
183 cd04145 M_R_Ras_like M-Ras/R-R  99.4 2.8E-11   7E-16   95.2  13.3  154   13-187     4-163 (164)
184 cd01866 Rab2 Rab2 subfamily.    99.4   3E-11 7.8E-16   95.0  13.1  156   13-187     6-165 (168)
185 cd04117 Rab15 Rab15 subfamily.  99.4 2.7E-11 6.9E-16   95.3  12.8  155   14-187     3-161 (161)
186 KOG1143 consensus               99.4 6.2E-12 1.6E-16   99.6   9.4  250   13-265   169-469 (591)
187 cd00157 Rho Rho (Ras homology)  99.4 4.7E-11 1.2E-15   93.7  13.8  154   13-185     2-170 (171)
188 cd04114 Rab30 Rab30 subfamily.  99.3 3.5E-11 9.1E-16   94.5  13.0  158   11-187     7-168 (169)
189 cd04125 RabA_like RabA-like su  99.3 2.8E-11 7.2E-16   95.2  12.4  153   14-187     3-161 (188)
190 cd01896 DRG The developmentall  99.3 6.4E-11 1.6E-15   92.8  13.6  147   13-187     2-225 (233)
191 cd01864 Rab19 Rab19 subfamily.  99.3 3.5E-11   9E-16   94.5  12.2  153   13-187     5-165 (165)
192 cd04140 ARHI_like ARHI subfami  99.3 3.7E-11 9.6E-16   94.3  12.3  151   13-186     3-163 (165)
193 cd04118 Rab24 Rab24 subfamily.  99.3 9.1E-11 2.3E-15   91.8  13.9  156   14-189     3-167 (193)
194 cd04122 Rab14 Rab14 subfamily.  99.3 3.6E-11 9.2E-16   94.5  11.8  156   13-187     4-163 (166)
195 cd04126 Rab20 Rab20 subfamily.  99.3 3.8E-11 9.8E-16   94.3  11.8  149   14-188     3-190 (220)
196 cd01865 Rab3 Rab3 subfamily.    99.3 5.8E-11 1.5E-15   93.1  12.7  154   13-187     3-162 (165)
197 cd01861 Rab6 Rab6 subfamily.    99.3 9.2E-11 2.3E-15   91.7  13.7  156   13-187     2-161 (161)
198 cd04136 Rap_like Rap-like subf  99.3 5.9E-11 1.5E-15   93.0  12.7  148   14-187     4-162 (163)
199 cd04106 Rab23_lke Rab23-like s  99.3 4.3E-11 1.1E-15   93.9  12.0  156   14-186     3-161 (162)
200 PRK09554 feoB ferrous iron tra  99.3 6.2E-11 1.6E-15   92.9  12.7  153    8-189     1-169 (772)
201 smart00174 RHO Rho (Ras homolo  99.3 6.9E-11 1.7E-15   92.6  12.7  157   14-190     1-174 (174)
202 cd01892 Miro2 Miro2 subfamily.  99.3 1.7E-10 4.4E-15   89.9  14.5  159    9-190     2-168 (169)
203 smart00176 RAN Ran (Ras-relate  99.3   8E-11   2E-15   92.2  12.8  150   17-187     1-153 (200)
204 cd04141 Rit_Rin_Ric Rit/Rin/Ri  99.3 6.1E-11 1.5E-15   92.9  12.0  155   13-190     4-166 (172)
205 cd04142 RRP22 RRP22 subfamily.  99.3 1.4E-10 3.6E-15   90.5  13.9  158   14-190     3-176 (198)
206 cd01870 RhoA_like RhoA-like su  99.3 2.3E-10 5.9E-15   89.0  13.5  151   13-186     3-173 (175)
207 smart00178 SAR Sar1p-like memb  99.3 2.2E-10 5.6E-15   89.2  13.1  153    9-187    15-184 (184)
208 cd04146 RERG_RasL11_like RERG/  99.3 1.8E-10 4.5E-15   89.8  12.5  154   14-187     2-163 (165)
209 cd04134 Rho3 Rho3 subfamily.    99.3 4.1E-10 1.1E-14   87.3  14.4  160   12-190     1-176 (189)
210 COG0218 Predicted GTPase [Gene  99.3 2.1E-10 5.4E-15   89.3  12.9  165    3-188    16-197 (200)
211 cd04111 Rab39 Rab39 subfamily.  99.2 3.3E-10 8.5E-15   88.0  13.2  157   13-188     4-166 (211)
212 cd01871 Rac1_like Rac1-like su  99.2   7E-10 1.8E-14   85.8  14.7  155   14-187     4-174 (174)
213 cd04133 Rop_like Rop subfamily  99.2 4.8E-10 1.2E-14   86.9  13.8  153   14-189     4-174 (176)
214 cd04130 Wrch_1 Wrch-1 subfamil  99.2 4.4E-10 1.1E-14   87.2  13.5  151   14-184     3-170 (173)
215 cd04135 Tc10 TC10 subfamily.    99.2 5.2E-10 1.3E-14   86.7  13.8  153   13-187     2-173 (174)
216 cd04115 Rab33B_Rab33A Rab33B/R  99.2 9.2E-10 2.4E-14   85.0  15.0  158   11-187     2-168 (170)
217 cd01874 Cdc42 Cdc42 subfamily.  99.2 8.1E-10 2.1E-14   85.4  14.4  152   13-186     3-173 (175)
218 TIGR03156 GTP_HflX GTP-binding  99.2 4.5E-10 1.1E-14   87.1  12.4  151   10-187   188-351 (351)
219 cd04162 Arl9_Arfrp2_like Arl9/  99.2 2.5E-10 6.4E-15   88.8  11.1  150   14-188     2-159 (164)
220 PRK05291 trmE tRNA modificatio  99.2 6.1E-10 1.5E-14   86.2  12.2  143   13-189   218-368 (445)
221 COG0370 FeoB Fe2+ transport sy  99.2 5.9E-10 1.5E-14   86.3  11.9  148   14-191     6-167 (653)
222 cd04148 RGK RGK subfamily.  Th  99.2 1.8E-09 4.7E-14   83.0  14.2  152   13-188     2-163 (221)
223 cd04109 Rab28 Rab28 subfamily.  99.2 1.8E-09 4.6E-14   83.1  14.0  158   14-189     3-167 (215)
224 cd01875 RhoG RhoG subfamily.    99.2 2.1E-09 5.4E-14   82.6  14.0  158   13-191     5-180 (191)
225 cd04161 Arl2l1_Arl13_like Arl2  99.2 1.1E-09 2.9E-14   84.4  12.5  145   14-184     2-165 (167)
226 PRK11058 putative GTPase HflX;  99.2   3E-09 7.7E-14   81.6  14.5  156   10-190   196-364 (426)
227 cd04143 Rhes_like Rhes_like su  99.1 1.7E-09 4.2E-14   83.3  12.4  158   14-191     3-174 (247)
228 COG0486 ThdF Predicted GTPase   99.1 9.3E-10 2.4E-14   85.0  10.7  152   13-190   219-378 (454)
229 cd04129 Rho2 Rho2 subfamily.    99.1 2.3E-09 5.9E-14   82.3  12.0  154   12-190     2-175 (187)
230 PRK12299 obgE GTPase ObgE; Rev  99.1 1.2E-08   3E-13   77.5  14.0  161    8-189   155-328 (334)
231 cd04131 Rnd Rnd subfamily.  Th  99.1 1.4E-08 3.5E-13   77.1  14.3  154   13-186     3-174 (178)
232 cd04105 SR_beta Signal recogni  99.0 1.2E-08   3E-13   77.6  13.5  127   13-158     2-138 (203)
233 pfam01926 MMR_HSR1 GTPase of u  99.0 3.5E-09   9E-14   81.1  10.7   98   23-139     1-106 (106)
234 pfam09439 SRPRB Signal recogni  99.0 7.8E-09   2E-13   78.8  11.8  123   12-155     4-138 (181)
235 KOG1423 consensus               99.0 8.7E-09 2.2E-13   78.5  11.9  162    8-189    69-272 (379)
236 TIGR00437 feoB ferrous iron tr  99.0 1.3E-09 3.3E-14   84.0   6.9  136   20-185     3-153 (733)
237 cd04103 Centaurin_gamma Centau  99.0 2.4E-08 6.1E-13   75.5  13.2  149   14-187     3-158 (158)
238 PTZ00099 rab6; Provisional      99.0   7E-09 1.8E-13   79.1  10.0  116   73-190    24-144 (176)
239 COG1100 GTPase SAR1 and relate  98.9 4.6E-08 1.2E-12   73.6  12.6  160   12-190     6-187 (219)
240 cd03693 EF1_alpha_II EF1_alpha  98.9 8.9E-10 2.3E-14   85.1   3.5   88  197-288     2-90  (91)
241 KOG0092 consensus               98.9 3.2E-08 8.3E-13   74.6  10.5  159   14-192     8-171 (200)
242 COG2262 HflX GTPases [General   98.9 3.8E-08 9.7E-13   74.2  10.8  154   10-189   191-357 (411)
243 cd04174 Rnd1_Rho6 Rnd1/Rho6 su  98.9 3.6E-07 9.1E-12   67.6  15.6  159    4-187     6-187 (232)
244 COG1084 Predicted GTPase [Gene  98.9 1.1E-07 2.7E-12   71.2  12.9  153   10-186   167-334 (346)
245 cd04172 Rnd3_RhoE_Rho8 Rnd3/Rh  98.9 1.7E-07 4.4E-12   69.7  14.0  153   13-185     7-177 (182)
246 cd04173 Rnd2_Rho7 Rnd2/Rho7 su  98.9 2.3E-07 5.9E-12   68.9  14.5  147   14-185     4-173 (222)
247 KOG1489 consensus               98.8 4.4E-08 1.1E-12   73.7  10.4  157    7-185   192-364 (366)
248 TIGR02528 EutP ethanolamine ut  98.8   6E-09 1.5E-13   79.6   5.3  134   14-184     3-143 (144)
249 PRK12298 obgE GTPase ObgE; Rev  98.8 3.2E-07   8E-12   68.0  12.7  156    9-188   157-333 (380)
250 cd03700 eEF2_snRNP_like_II EF2  98.8 9.3E-09 2.4E-13   78.3   4.8   79  202-284     3-92  (93)
251 cd04102 RabL3 RabL3 (Rab-like3  98.7 8.1E-07 2.1E-11   65.3  14.2  156   14-187     3-199 (202)
252 PRK12296 obgE GTPase ObgE; Rev  98.7 3.1E-07 7.8E-12   68.1  11.9  159    8-189   156-341 (495)
253 PRK12297 obgE GTPase ObgE; Rev  98.7 4.4E-07 1.1E-11   67.0  12.5  160    8-189   155-330 (429)
254 KOG0078 consensus               98.7 1.6E-06 4.1E-11   63.2  14.8  164    1-189     4-175 (207)
255 TIGR00450 thdF tRNA modificati  98.7 4.4E-07 1.1E-11   67.1  11.6  111   13-143   227-346 (473)
256 KOG0080 consensus               98.7 2.5E-07 6.3E-12   68.7   9.9  154   12-187    12-173 (209)
257 cd04089 eRF3_II eRF3_II: domai  98.7 2.2E-08 5.6E-13   75.8   3.9   81  199-285     1-82  (82)
258 pfam08477 Miro Miro-like prote  98.6 1.1E-06 2.7E-11   64.5  12.4  111   14-141     2-118 (118)
259 cd01873 RhoBTB RhoBTB subfamil  98.6   9E-07 2.3E-11   64.9  11.8  156   13-185     4-193 (195)
260 cd03698 eRF3_II_like eRF3_II_l  98.6 3.3E-08 8.5E-13   74.6   3.8   82  199-285     1-83  (83)
261 COG1163 DRG Predicted GTPase [  98.6 4.7E-07 1.2E-11   66.8   8.4  149   11-187    63-288 (365)
262 PRK13768 GTPase; Provisional    98.6 1.3E-06 3.3E-11   63.9  10.6  110   76-187    97-246 (253)
263 cd01342 Translation_Factor_II_  98.5 6.1E-08 1.6E-12   72.8   3.7   81  200-285     1-83  (83)
264 pfam03308 ArgK ArgK protein. T  98.5 2.3E-07 5.8E-12   68.9   6.1  172   10-190    28-232 (267)
265 KOG0098 consensus               98.5 4.2E-06 1.1E-10   60.4  12.3  150   13-187     8-167 (216)
266 KOG0084 consensus               98.5 5.5E-06 1.4E-10   59.7  12.8  159   10-187     6-171 (205)
267 KOG0073 consensus               98.5 3.9E-06 9.9E-11   60.7  12.0  149   14-185    19-175 (185)
268 KOG0094 consensus               98.5 1.3E-05 3.4E-10   57.1  14.4  163    9-192    20-189 (221)
269 TIGR00073 hypB hydrogenase acc  98.4 5.2E-07 1.3E-11   66.5   5.9  149   13-185    36-220 (225)
270 cd03696 selB_II selB_II: this   98.4 4.1E-07   1E-11   67.2   4.6   82  200-285     1-83  (83)
271 KOG0395 consensus               98.4 2.8E-06 7.1E-11   61.6   8.6  159   11-190     3-167 (196)
272 pfam03144 GTP_EFTU_D2 Elongati  98.4 2.7E-07 6.9E-12   68.4   3.3   67  214-284     1-70  (70)
273 cd01859 MJ1464 MJ1464.  This f  98.3 2.7E-06   7E-11   61.7   8.1   96   91-189     2-97  (156)
274 pfam00350 Dynamin_N Dynamin fa  98.3 8.3E-06 2.1E-10   58.5  10.3   64   77-140   100-168 (168)
275 cd01882 BMS1 Bms1.  Bms1 is an  98.3 1.1E-05 2.9E-10   57.5  10.8  154   13-195    41-208 (225)
276 cd03697 EFTU_II EFTU_II: Elong  98.3 6.6E-07 1.7E-11   65.9   4.0   84  200-287     1-87  (87)
277 KOG0093 consensus               98.3 3.4E-05 8.7E-10   54.3  12.7  155   13-189    23-184 (193)
278 PRK09435 arginine/ornithine tr  98.3 2.5E-06 6.4E-11   62.0   6.5  172   11-189    49-254 (325)
279 COG3596 Predicted GTPase [Gene  98.2 2.1E-05 5.4E-10   55.8  10.1  157   13-189    41-223 (296)
280 COG4917 EutP Ethanolamine util  98.2   3E-06 7.7E-11   61.4   5.7  136   13-186     3-144 (148)
281 cd04090 eEF2_II_snRNP Loc2 eEF  98.2 1.5E-06 3.9E-11   63.4   4.2   72  202-277     3-85  (94)
282 KOG0086 consensus               98.2 7.8E-05   2E-09   51.9  12.8  158    9-189     7-176 (214)
283 pfam03029 ATP_bind_1 Conserved  98.2 5.4E-06 1.4E-10   59.7   6.9  107   77-185    91-230 (234)
284 KOG0075 consensus               98.2 5.1E-06 1.3E-10   59.9   6.5  149   14-188    23-182 (186)
285 TIGR00750 lao LAO/AO transport  98.2 6.7E-06 1.7E-10   59.1   7.2  172   12-190    39-270 (333)
286 cd01856 YlqF YlqF.  Proteins o  98.2 1.1E-05 2.9E-10   57.5   8.0  100   86-190     3-103 (171)
287 KOG0095 consensus               98.2 0.00017 4.4E-09   49.6  13.7  155   11-189     7-170 (213)
288 KOG0087 consensus               98.1 5.1E-05 1.3E-09   53.2  10.6  161    7-188    10-176 (222)
289 COG1703 ArgK Putative periplas  98.1 1.2E-05   3E-10   57.5   7.2  168   13-189    53-255 (323)
290 KOG0070 consensus               98.1 1.9E-05 4.9E-10   56.0   8.2  154    9-188    15-178 (181)
291 KOG0090 consensus               98.1 1.7E-05 4.4E-10   56.3   7.9  119   12-153    39-168 (238)
292 KOG1191 consensus               98.1   6E-05 1.5E-09   52.7  10.5   14   75-88    117-130 (531)
293 KOG0088 consensus               98.1 4.7E-06 1.2E-10   60.1   4.7  156   14-188    16-175 (218)
294 KOG0394 consensus               98.1 7.2E-05 1.8E-09   52.2  10.7  161   11-189     9-179 (210)
295 pfam04670 Gtr1_RagA Gtr1/RagA   98.1 0.00015 3.8E-09   50.1  12.1  115   14-146     2-127 (230)
296 cd04104 p47_IIGP_like p47 (47-  98.1  0.0001 2.6E-09   51.1  11.0  161   13-191     3-187 (197)
297 COG0536 Obg Predicted GTPase [  98.0 0.00011 2.9E-09   50.9  11.0  156    8-190   156-335 (369)
298 PRK10463 hydrogenase nickel in  98.0 2.5E-05 6.5E-10   55.2   7.4  154    9-184   102-285 (290)
299 KOG0076 consensus               98.0 3.4E-05 8.8E-10   54.3   7.6  154   13-190    19-189 (197)
300 KOG0071 consensus               98.0 0.00019 4.9E-09   49.3  11.0  148   14-187    20-177 (180)
301 TIGR03597 GTPase_YqeH ribosome  97.9 2.5E-05 6.3E-10   55.3   6.2   96   89-186    51-151 (360)
302 cd01850 CDC_Septin CDC/Septin.  97.9 0.00038 9.6E-09   47.4  11.9  136   13-157     6-171 (276)
303 KOG0079 consensus               97.9 0.00073 1.9E-08   45.4  12.4  163    8-189     5-170 (198)
304 KOG0097 consensus               97.8 0.00063 1.6E-08   45.9  11.9  158    1-182     1-168 (215)
305 COG0378 HypB Ni2+-binding GTPa  97.8   3E-05 7.7E-10   54.7   4.7  161   11-185    13-198 (202)
306 pfam00735 Septin Septin. Membe  97.8 0.00075 1.9E-08   45.3  11.8  122   13-144     6-155 (280)
307 cd03695 CysN_NodQ_II CysN_NodQ  97.8 2.6E-05 6.6E-10   55.1   4.3   81  200-285     1-81  (81)
308 PRK13796 GTP-binding protein Y  97.8 5.7E-05 1.4E-09   52.9   6.1   93   89-185    59-158 (367)
309 TIGR03596 GTPase_YlqF ribosome  97.8  0.0001 2.6E-09   51.1   7.3   99   86-189     5-104 (276)
310 KOG1532 consensus               97.8 2.8E-05 7.1E-10   54.9   4.2  174   13-187    21-263 (366)
311 COG5192 BMS1 GTP-binding prote  97.7 0.00058 1.5E-08   46.1  10.3  101   14-143    72-176 (1077)
312 cd01849 YlqF_related_GTPase Yl  97.7 0.00015 3.9E-09   50.0   6.7   86  103-190     1-87  (155)
313 PRK09563 rbgA ribosomal biogen  97.7 0.00017 4.4E-09   49.6   6.9   99   86-189     8-107 (282)
314 KOG4252 consensus               97.7 0.00035 8.9E-09   47.6   8.5  168    1-188    10-181 (246)
315 COG5019 CDC3 Septin family pro  97.6  0.0013 3.3E-08   43.8  10.9  136   13-158    25-191 (373)
316 cd03694 GTPBP_II Domain II of   97.6 6.7E-05 1.7E-09   52.4   3.9   82  202-284     3-86  (87)
317 PRK12288 ribosome-associated G  97.6 0.00021 5.4E-09   49.0   6.2   84   98-186   118-208 (344)
318 cd02036 MinD Bacterial cell di  97.5 0.00067 1.7E-08   45.6   8.4  132   14-161     2-145 (179)
319 KOG0410 consensus               97.5  0.0012 3.1E-08   43.9   9.6  147   13-190   180-343 (410)
320 PRK00098 ribosome-associated G  97.5 0.00041 1.1E-08   47.1   6.9   86   97-184    75-163 (298)
321 KOG0072 consensus               97.4 0.00076 1.9E-08   45.3   7.0  108   76-187    60-178 (182)
322 COG1162 Predicted GTPases [Gen  97.4 0.00058 1.5E-08   46.1   6.2   84  102-186    80-165 (301)
323 PRK12289 ribosome-associated G  97.4 0.00041 1.1E-08   47.1   5.3   86   99-187    86-173 (351)
324 cd01854 YjeQ_engC YjeQ/EngC.    97.3 0.00048 1.2E-08   46.6   5.6   83   98-183    74-159 (287)
325 PRK01889 ribosome-associated G  97.3 0.00071 1.8E-08   45.5   6.4   80  102-184   112-192 (353)
326 cd01858 NGP_1 NGP-1.  Autoanti  97.3 0.00086 2.2E-08   44.9   6.5   91   94-187     1-94  (157)
327 TIGR00436 era GTP-binding prot  97.2  0.0024 6.1E-08   41.9   8.1  156   14-189     3-171 (278)
328 cd01855 YqeH YqeH.  YqeH is an  97.2 0.00052 1.3E-08   46.4   4.5   97   90-188    22-125 (190)
329 TIGR02729 Obg_CgtA GTP-binding  97.2  0.0096 2.5E-07   37.9  10.6  112    8-144   155-296 (296)
330 KOG1547 consensus               97.1  0.0008   2E-08   45.1   5.0  120   13-143    48-197 (336)
331 KOG1707 consensus               97.1   0.016   4E-07   36.4  11.6  148    9-182     8-169 (625)
332 KOG2486 consensus               97.1  0.0062 1.6E-07   39.2   9.3  157    6-184   131-312 (320)
333 KOG0083 consensus               97.0  0.0012 2.9E-08   44.1   4.9  177   16-218     2-188 (192)
334 PRK05306 infB translation init  97.0   0.024 6.2E-07   35.2  11.1   63  414-476   666-738 (839)
335 PRK11537 putative GTP-binding   96.9    0.01 2.6E-07   37.7   8.7  136   15-156     8-175 (317)
336 pfam04548 AIG1 AIG1 family. Ar  96.9    0.04   1E-06   33.7  11.6  150   13-187     2-173 (200)
337 PRK01889 ribosome-associated G  96.8  0.0018 4.6E-08   42.8   4.3   11  173-183   204-214 (353)
338 cd01857 HSR1_MMR1 HSR1/MMR1.    96.8  0.0056 1.4E-07   39.5   6.8   52   93-144     3-56  (141)
339 smart00053 DYNc Dynamin, GTPas  96.8   0.033 8.3E-07   34.3  10.6  130   12-145    27-207 (240)
340 cd01849 YlqF_related_GTPase Yl  96.8  0.0025 6.4E-08   41.8   4.9   55   11-87    100-154 (155)
341 PRK12312 infB translation init  96.8   0.041   1E-06   33.7  11.1   73  415-487   439-521 (610)
342 KOG2655 consensus               96.8  0.0043 1.1E-07   40.3   6.1  135   13-157    23-186 (366)
343 CHL00189 infB translation init  96.7   0.034 8.6E-07   34.3  10.3   21  364-384   494-514 (770)
344 KOG0091 consensus               96.6   0.034 8.6E-07   34.2   9.6  152   15-187    12-172 (213)
345 cd03110 Fer4_NifH_child This p  96.6   0.011 2.7E-07   37.6   7.0   69   74-144    89-157 (179)
346 cd01854 YjeQ_engC YjeQ/EngC.    96.6  0.0046 1.2E-07   40.0   5.1   93   82-184    84-182 (287)
347 pfam03193 DUF258 Protein of un  96.5  0.0022 5.6E-08   42.2   3.2   60   12-92     36-101 (161)
348 cd01859 MJ1464 MJ1464.  This f  96.5  0.0064 1.6E-07   39.1   5.3   21   12-32    102-122 (156)
349 pfam05049 IIGP Interferon-indu  96.5    0.08   2E-06   31.7  10.9  159   12-191    36-221 (375)
350 cd01853 Toc34_like Toc34-like   96.5   0.042 1.1E-06   33.6   9.4  117    9-162    29-148 (249)
351 KOG1490 consensus               96.5   0.025 6.5E-07   35.1   8.2  159    9-187   166-340 (620)
352 KOG0096 consensus               96.3   0.011 2.7E-07   37.6   5.8  147   11-178    10-159 (216)
353 KOG0074 consensus               96.3   0.033 8.4E-07   34.3   8.3  151   10-186    17-177 (185)
354 PRK00098 ribosome-associated G  96.3  0.0071 1.8E-07   38.8   4.8   31  151-184   155-185 (298)
355 pfam07015 VirC1 VirC1 protein.  96.2   0.024   6E-07   35.3   6.8  134   18-158     9-166 (231)
356 cd01852 AIG1 AIG1 (avrRpt2-ind  96.2   0.033 8.3E-07   34.3   7.5   83   13-113     2-95  (196)
357 KOG0705 consensus               96.1   0.011 2.7E-07   37.6   4.9   89   13-128    32-122 (749)
358 cd03114 ArgK-like The function  96.1  0.0086 2.2E-07   38.2   4.3  121   14-141     2-148 (148)
359 PRK10751 molybdopterin-guanine  96.1   0.032 8.3E-07   34.4   7.0   50   13-91      4-53  (170)
360 cd03116 MobB Molybdenum is an   96.0   0.045 1.1E-06   33.4   7.6   51   12-91      2-52  (159)
361 KOG0077 consensus               96.0   0.079   2E-06   31.7   8.9   78   79-159    65-147 (193)
362 cd01858 NGP_1 NGP-1.  Autoanti  96.0   0.012 3.1E-07   37.2   4.7   20   13-32    104-123 (157)
363 PHA02518 ParA-like protein; Pr  96.0   0.034 8.6E-07   34.2   7.0   78   77-156    76-159 (211)
364 TIGR03348 VI_IcmF type VI secr  95.9   0.048 1.2E-06   33.2   7.4  113   14-143   114-256 (1169)
365 COG0523 Putative GTPases (G3E   95.9   0.055 1.4E-06   32.8   7.7  157   15-182     5-195 (323)
366 PRK09601 translation-associate  95.9    0.13 3.3E-06   30.3   9.6   89   13-115     4-110 (364)
367 cd01856 YlqF YlqF.  Proteins o  95.8   0.021 5.3E-07   35.7   5.3   20   13-32    117-136 (171)
368 TIGR00176 mobB molybdopterin-g  95.8    0.02 5.1E-07   35.8   5.2   50   14-89      2-51  (165)
369 TIGR03597 GTPase_YqeH ribosome  95.8   0.021 5.4E-07   35.6   5.2  100   78-186    69-177 (360)
370 pfam05783 DLIC Dynein light in  95.8   0.066 1.7E-06   32.3   7.6   59  129-187   214-282 (490)
371 pfam02492 cobW CobW/HypB/UreG,  95.7   0.098 2.5E-06   31.1   8.4  135   16-156     5-165 (174)
372 COG1162 Predicted GTPases [Gen  95.7   0.013 3.3E-07   37.0   3.8   13  171-183   172-184 (301)
373 PRK13849 putative crown gall t  95.7   0.032 8.1E-07   34.4   5.7   79   76-158    82-166 (231)
374 COG1763 MobB Molybdopterin-gua  95.6   0.027 6.8E-07   34.9   5.2   51   12-91      3-53  (161)
375 cd01857 HSR1_MMR1 HSR1/MMR1.    95.6   0.021 5.4E-07   35.6   4.6   58    9-88     81-138 (141)
376 KOG0081 consensus               95.6   0.099 2.5E-06   31.1   8.1  158   14-189    12-186 (219)
377 PRK12289 ribosome-associated G  95.6   0.021 5.3E-07   35.6   4.4   56  198-259     7-62  (351)
378 PRK13796 GTP-binding protein Y  95.5   0.033 8.4E-07   34.3   5.3  100   78-187    77-186 (367)
379 pfam01656 CbiA CobQ/CobB/MinD/  95.5   0.041 1.1E-06   33.6   5.8   69   76-146   111-180 (212)
380 cd03692 mtIF2_IVc mtIF2_IVc: t  95.5   0.021 5.3E-07   35.6   4.1   75  206-283     7-82  (84)
381 cd02042 ParA ParA and ParB of   95.4   0.024 6.2E-07   35.2   4.4   66   19-113     8-73  (104)
382 PRK13760 putative RNA-associat  95.3    0.07 1.8E-06   32.1   6.5   64  413-478   164-228 (233)
383 COG1161 Predicted GTPases [Gen  95.3   0.038 9.6E-07   33.9   5.0   98   82-184    14-113 (322)
384 cd01855 YqeH YqeH.  YqeH is an  95.2   0.017 4.4E-07   36.2   3.1  103   78-187    40-151 (190)
385 KOG1954 consensus               95.2    0.22 5.5E-06   28.8   8.5  128   13-143    60-224 (532)
386 PRK00131 aroK shikimate kinase  95.1   0.086 2.2E-06   31.5   6.4  145    9-187     2-169 (175)
387 cd03702 IF2_mtIF2_II This fami  95.1   0.035   9E-07   34.1   4.4   80  201-287     2-81  (95)
388 TIGR00491 aIF-2 translation in  95.0    0.02   5E-07   35.8   2.9   52  408-459   691-747 (1145)
389 KOG0448 consensus               95.0     0.3 7.7E-06   27.9   9.7  155   13-172   111-310 (749)
390 cd03278 ABC_SMC_barmotin Barmo  94.9    0.26 6.7E-06   28.2   8.4   24   14-37     25-48  (197)
391 PRK06731 flhF flagellar biosyn  94.7    0.23   6E-06   28.6   7.6  129    7-142    71-223 (270)
392 cd02037 MRP-like MRP (Multiple  94.5    0.17 4.3E-06   29.6   6.6  117   18-139     7-130 (169)
393 cd03115 SRP The signal recogni  94.5     0.4   1E-05   27.0  11.0  123   14-142     3-151 (173)
394 COG0419 SbcC ATPase involved i  94.4   0.069 1.8E-06   32.1   4.5   61   14-82     28-89  (908)
395 TIGR03371 cellulose_yhjQ cellu  94.4    0.11 2.8E-06   30.8   5.5   80   78-159   115-197 (246)
396 PRK13948 shikimate kinase; Pro  94.3    0.43 1.1E-05   26.8   8.3  154    1-189     1-175 (182)
397 TIGR00959 ffh signal recogniti  94.3     0.2 5.1E-06   29.0   6.6  123   13-143   104-260 (439)
398 PRK12727 flagellar biosynthesi  94.3    0.45 1.2E-05   26.7   9.6   12  178-189   307-318 (557)
399 cd01899 Ygr210 Ygr210 subfamil  94.2    0.47 1.2E-05   26.6  11.4  121   14-155     1-139 (318)
400 KOG1487 consensus               94.2   0.076 1.9E-06   31.9   4.3  169   13-232    61-241 (358)
401 PRK09563 rbgA ribosomal biogen  94.2   0.093 2.4E-06   31.3   4.7   24  105-128    54-77  (282)
402 cd04178 Nucleostemin_like Nucl  94.1    0.15 3.8E-06   29.9   5.6   42  103-144     1-44  (172)
403 COG0532 InfB Translation initi  94.1   0.079   2E-06   31.7   4.2   15  461-475   464-478 (509)
404 COG1149 MinD superfamily P-loo  94.0    0.25 6.4E-06   28.4   6.6   56  299-378   192-248 (284)
405 TIGR03596 GTPase_YlqF ribosome  93.9    0.15 3.7E-06   30.0   5.2   18   14-31    121-138 (276)
406 KOG1673 consensus               93.8    0.44 1.1E-05   26.8   7.5  153   13-187    22-185 (205)
407 TIGR01184 ntrCD nitrate ABC tr  93.8   0.041 1.1E-06   33.7   2.2   28   13-44     13-40  (230)
408 cd03701 IF2_IF5B_II IF2_IF5B_I  93.7     0.1 2.7E-06   30.9   4.2   77  201-284     2-78  (95)
409 PRK11568 hypothetical protein;  93.7    0.46 1.2E-05   26.6   7.5   69  409-479   133-201 (204)
410 COG0012 Predicted GTPase, prob  93.6     0.6 1.5E-05   25.9  11.7  113   13-155     4-134 (372)
411 KOG3883 consensus               93.5    0.61 1.6E-05   25.8  11.1  166    8-192     6-179 (198)
412 PRK05057 aroK shikimate kinase  93.5    0.11 2.8E-06   30.8   4.0   46    8-61      1-47  (172)
413 COG1120 FepC ABC-type cobalami  93.5    0.31 7.8E-06   27.8   6.3  126   13-148    30-170 (258)
414 cd01983 Fer4_NifH The Fer4_Nif  93.5    0.26 6.5E-06   28.3   5.9   75   14-120     2-77  (99)
415 KOG3886 consensus               93.4    0.35 8.9E-06   27.4   6.5  123   10-151     3-137 (295)
416 COG1161 Predicted GTPases [Gen  93.2    0.21 5.3E-06   28.9   5.1   19   14-32    135-153 (322)
417 KOG3887 consensus               93.1    0.12 3.1E-06   30.5   3.8  114   11-144    28-149 (347)
418 cd03246 ABCC_Protease_Secretio  93.1    0.57 1.5E-05   26.0   7.2  100   12-127    29-139 (173)
419 TIGR02782 TrbB_P P-type conjug  92.9    0.08   2E-06   31.7   2.6   22  166-187   142-163 (315)
420 pfam06431 Polyoma_lg_T_C Polyo  92.8    0.12 3.1E-06   30.5   3.3   18  145-162    99-116 (417)
421 pfam09547 Spore_IV_A Stage IV   92.5    0.86 2.2E-05   24.8   9.9  169   13-189    19-238 (492)
422 PRK08118 topology modulation p  92.4    0.13 3.3E-06   30.4   3.1   26   12-37      2-27  (167)
423 TIGR01007 eps_fam capsular exo  92.3    0.53 1.3E-05   26.2   6.2   58   80-144   133-197 (207)
424 COG1135 AbcC ABC-type metal io  92.1    0.41   1E-05   27.0   5.4   34  347-380   266-299 (339)
425 pfam04295 GD_AH_C D-galactarat  92.0    0.33 8.3E-06   27.6   4.8   45   95-141    69-119 (393)
426 PRK07261 topology modulation p  91.6    0.18 4.6E-06   29.3   3.1   24   14-37      3-26  (171)
427 KOG0393 consensus               91.5    0.71 1.8E-05   25.4   6.1  155   12-189     5-180 (198)
428 cd03112 CobW_like The function  91.4     1.1 2.9E-05   24.0   7.0  121   16-142     5-158 (158)
429 pfam00448 SRP54 SRP54-type pro  91.3     1.2 2.9E-05   23.9  11.0  154   13-179     3-182 (196)
430 CHL00175 minD septum-site dete  91.3    0.84 2.1E-05   24.9   6.2   64   76-141   123-187 (279)
431 PRK10246 exonuclease subunit S  91.2    0.68 1.7E-05   25.5   5.7   27   13-39     32-59  (1047)
432 TIGR02211 LolD_lipo_ex lipopro  90.9    0.18 4.7E-06   29.3   2.6   29   13-45     33-61  (221)
433 PRK13947 shikimate kinase; Pro  90.8    0.37 9.5E-06   27.2   4.1  143   11-187     1-165 (171)
434 PRK05703 flhF flagellar biosyn  90.8     1.3 3.3E-05   23.6  10.3   14  317-330   277-290 (412)
435 cd03288 ABCC_SUR2 The SUR doma  90.8     1.1 2.8E-05   24.1   6.4  123   12-150    48-190 (257)
436 cd03369 ABCC_NFT1 Domain 2 of   90.8     1.3 3.3E-05   23.6   9.3  127   13-158    36-168 (207)
437 TIGR01842 type_I_sec_PrtD type  90.7    0.23 5.8E-06   28.7   2.9   70  310-390   466-543 (556)
438 cd03226 ABC_cobalt_CbiO_domain  90.7    0.46 1.2E-05   26.7   4.4   24   14-40     29-52  (205)
439 PRK13631 cbiO cobalt transport  90.6    0.31 7.8E-06   27.8   3.5   25   13-40     54-78  (320)
440 cd03229 ABC_Class3 This class   90.4    0.75 1.9E-05   25.2   5.3   24   13-39     28-51  (178)
441 PRK06995 flhF flagellar biosyn  90.3     1.4 3.7E-05   23.3   9.5   12  317-328   243-254 (404)
442 TIGR02324 CP_lyasePhnL phospho  90.2    0.23 5.9E-06   28.6   2.6   23   14-37     37-59  (224)
443 COG0563 Adk Adenylate kinase a  90.2    0.35 8.8E-06   27.4   3.4  108   12-138     1-112 (178)
444 PRK06547 hypothetical protein;  90.1    0.27 6.9E-06   28.2   2.9   25   10-34     14-38  (184)
445 KOG3022 consensus               89.9     1.2   3E-05   23.9   6.0   26    6-31     41-68  (300)
446 TIGR02673 FtsE cell division A  89.8    0.23 5.7E-06   28.7   2.2   20   16-36     33-52  (215)
447 COG1428 Deoxynucleoside kinase  89.7    0.29 7.4E-06   28.0   2.8   46   12-57      5-52  (216)
448 PRK11247 ssuB aliphatic sulfon  89.3    0.97 2.5E-05   24.5   5.2   38   13-54     40-77  (257)
449 COG1134 TagH ABC-type polysacc  89.2    0.39   1E-05   27.1   3.1   25   13-40     55-79  (249)
450 cd03240 ABC_Rad50 The catalyti  89.1    0.85 2.2E-05   24.8   4.8   20   14-33     25-44  (204)
451 COG1116 TauB ABC-type nitrate/  89.1    0.38 9.8E-06   27.1   3.0   36   14-53     32-67  (248)
452 PRK13548 hmuV hemin importer A  89.1    0.59 1.5E-05   25.9   3.9   25   13-40     30-54  (257)
453 cd02023 UMPK Uridine monophosp  88.9    0.46 1.2E-05   26.6   3.3   23   14-36      2-24  (198)
454 pfam00485 PRK Phosphoribulokin  88.9    0.41   1E-05   27.0   3.0   23   14-36      2-24  (196)
455 PRK13946 shikimate kinase; Pro  88.9    0.63 1.6E-05   25.7   4.0   99   10-137    19-119 (195)
456 cd03253 ABCC_ATM1_transporter   88.9    0.32 8.1E-06   27.7   2.4   52   13-68     29-86  (236)
457 KOG0780 consensus               88.8     1.5 3.9E-05   23.1   5.9  127   11-142   100-252 (483)
458 PRK13949 shikimate kinase; Pro  88.8     1.2 3.1E-05   23.8   5.4   96   12-138     2-101 (169)
459 COG4963 CpaE Flp pilus assembl  88.8     1.8 4.7E-05   22.6   7.6   18  353-370   203-220 (366)
460 PRK09866 hypothetical protein;  88.6    0.37 9.5E-06   27.2   2.7   95   79-174   231-339 (742)
461 TIGR02857 CydD ABC transporter  88.6    0.38 9.6E-06   27.2   2.7   19   14-32    381-399 (570)
462 cd03228 ABCC_MRP_Like The MRP   88.5     1.9 4.8E-05   22.5   7.8   25   12-39     29-53  (171)
463 cd03279 ABC_sbcCD SbcCD and ot  88.4     1.4 3.6E-05   23.4   5.5   69   13-91     30-99  (213)
464 cd00464 SK Shikimate kinase (S  88.4     1.3 3.2E-05   23.7   5.3   94   13-137     1-98  (154)
465 PRK13644 cbiO cobalt transport  88.3    0.46 1.2E-05   26.6   3.0   25   13-40     30-54  (274)
466 PRK03731 aroL shikimate kinase  88.2    0.78   2E-05   25.1   4.1   97   12-137     3-100 (172)
467 COG4962 CpaF Flp pilus assembl  88.1    0.37 9.5E-06   27.2   2.4   25  166-190   176-200 (355)
468 cd02030 NDUO42 NADH:Ubiquinone  88.0    0.53 1.3E-05   26.2   3.1   24   14-37      2-25  (219)
469 cd03218 ABC_YhbG The ABC trans  87.9     0.7 1.8E-05   25.4   3.7   25   13-40     28-52  (232)
470 cd03252 ABCC_Hemolysin The ABC  87.9    0.42 1.1E-05   26.9   2.6  122   13-149    30-171 (237)
471 PRK13651 cobalt transporter AT  87.8    0.44 1.1E-05   26.8   2.6   25   13-40     35-59  (304)
472 PRK05480 uridine kinase; Provi  87.7    0.59 1.5E-05   25.9   3.2   24   13-36      8-31  (209)
473 cd03296 ABC_CysA_sulfate_impor  87.6    0.56 1.4E-05   26.1   3.1   20   12-31     29-48  (239)
474 pfam00931 NB-ARC NB-ARC domain  87.6    0.49 1.3E-05   26.4   2.8   24    9-32     17-40  (285)
475 cd03249 ABC_MTABC3_MDL1_MDL2 M  87.5    0.48 1.2E-05   26.5   2.7   53   13-68     31-88  (238)
476 COG0541 Ffh Signal recognition  87.5     2.2 5.6E-05   22.1   9.4   61   79-143   184-252 (451)
477 PRK13650 cbiO cobalt transport  87.5     1.1 2.9E-05   24.0   4.5   24   13-39     32-55  (276)
478 PRK13643 cbiO cobalt transport  87.4    0.64 1.6E-05   25.7   3.2   25   13-40     34-58  (288)
479 KOG0467 consensus               87.3  0.0057 1.5E-07   39.4  -7.3   36   83-119   252-287 (887)
480 COG2721 UxaA Altronate dehydra  87.2    0.77   2E-05   25.1   3.6   24   11-34     19-42  (381)
481 cd02038 FleN-like FleN is a me  87.2     2.3 5.8E-05   22.0   9.0  101   14-142     2-109 (139)
482 PRK13540 cytochrome c biogenes  87.2       1 2.7E-05   24.2   4.2   25   13-40     29-53  (200)
483 PRK10762 D-ribose transporter   87.1    0.81 2.1E-05   25.0   3.6   53   13-68     32-90  (501)
484 cd01130 VirB11-like_ATPase Typ  87.0    0.57 1.5E-05   26.0   2.8   26    9-34     23-48  (186)
485 COG1121 ZnuC ABC-type Mn/Zn tr  87.0     2.3   6E-05   21.9   7.8  135   14-158    33-182 (254)
486 TIGR00618 sbcc exonuclease Sbc  86.9    0.59 1.5E-05   25.9   2.8   34    7-40     26-61  (1063)
487 PRK13646 cbiO cobalt transport  86.9    0.52 1.3E-05   26.3   2.5   25   13-40     35-59  (286)
488 pfam06564 YhjQ YhjQ protein. T  86.9     2.1 5.4E-05   22.2   5.7   58   77-142   117-175 (244)
489 TIGR01526 nadR_NMN_Atrans nico  86.9    0.48 1.2E-05   26.5   2.4   66  303-373   262-335 (346)
490 cd02028 UMPK_like Uridine mono  86.8    0.63 1.6E-05   25.7   2.9   23   14-36      2-24  (179)
491 PRK13900 type IV secretion sys  86.8    0.61 1.6E-05   25.8   2.9   26  165-190   162-187 (332)
492 TIGR01846 type_I_sec_HlyB type  86.8     0.9 2.3E-05   24.7   3.7   26  207-239   387-413 (703)
493 cd03289 ABCC_CFTR2 The CFTR su  86.7    0.59 1.5E-05   25.9   2.8   22   13-34     32-53  (275)
494 TIGR00956 3a01205 Pleiotropic   86.7    0.32 8.2E-06   27.7   1.4   19   15-33    857-875 (1466)
495 cd03291 ABCC_CFTR1 The CFTR su  86.6    0.57 1.4E-05   26.0   2.6   16   14-29     66-81  (282)
496 cd03259 ABC_Carb_Solutes_like   86.5    0.69 1.8E-05   25.4   3.0   24   13-39     28-51  (213)
497 TIGR02315 ABC_phnC phosphonate  86.5    0.81 2.1E-05   25.0   3.3  116   14-145    31-184 (253)
498 COG1192 Soj ATPases involved i  86.5     2.3 5.8E-05   22.0   5.6   82   76-159   118-206 (259)
499 cd03295 ABC_OpuCA_Osmoprotecti  86.5    0.95 2.4E-05   24.5   3.7   53   14-69     30-87  (242)
500 cd03290 ABCC_SUR1_N The SUR do  86.4    0.59 1.5E-05   25.9   2.6   19   14-32     30-48  (218)

No 1  
>TIGR01393 lepA GTP-binding protein LepA; InterPro: IPR006297   LepA (GUF1 in Saccaromyces) is a GTP-binding membrane protein related to EF-G and EF-Tu. Two types of phylogenetic tree, rooted by other GTP-binding proteins, suggest that eukaryotic homologs (including GUF1 of yeast) originated within the bacterial LepA family. The function of the proteins in this family are unknown. ; GO: 0005525 GTP binding.
Probab=100.00  E-value=0  Score=2101.66  Aligned_cols=594  Identities=63%  Similarity=1.066  Sum_probs=589.9

Q ss_pred             HHCEEEEEECCCCCCHHHHHHHHHHHCCCCCCCCCCCEEECCCHHHHHHCCEEEEEEEEEEEE-CCCCCEEEEEEEECCC
Q ss_conf             253179998013898778899999982980544443113058677987195052327999974-3788438999961787
Q gi|254780321|r    9 SRIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVRLNYT-STDAKDYQLNLIDTPG   87 (606)
Q Consensus         9 ~~IRN~~IiaHvDhGKTTL~d~lL~~tg~i~~~~~~~~vlD~~~~EreRGITIka~~~~~~~~-~~~~~~y~iNlIDTPG   87 (606)
                      ++||||||||||||||||||||||+.||++++|++.+|+||+||+|||||||||||+|+|.|+ ..+|++|.||||||||
T Consensus         1 ~~IRNFsIIAHIDHGKSTLADRlle~T~~~s~R~m~~Q~LD~MDlERERGITIK~qaV~l~Yk~~~DGe~Y~LNLIDTPG   80 (598)
T TIGR01393         1 KNIRNFSIIAHIDHGKSTLADRLLEKTGAVSEREMREQVLDSMDLERERGITIKAQAVRLKYKVAKDGETYVLNLIDTPG   80 (598)
T ss_pred             CCCCCEEEEEEECCCCCHHHHHHHHHCCCCCCHHHHHCCCCCCCEEECCCCEEECCCEEEEEEEECCCCEEEEEEECCCC
T ss_conf             98752678846248932488999986174562025430577510000058201156347533753388788996452889


Q ss_pred             CCHHHHHHHHHHHHCCEEEEEEECCCCCCHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCCHHHHHHHHHHHHHHHHHH
Q ss_conf             30027999999973026899998687886558999999997099679983267887532113388877555322321000
Q gi|254780321|r   88 HVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQAIDNNHEIITVLNKADLPSADPDRVKKQIEETIGISTEDALL  167 (606)
Q Consensus        88 H~DF~~EV~r~l~a~dgaiLvVdA~~Gvq~QT~~~~~~A~~~~l~~I~viNKiD~~~A~~e~v~~ei~~~~g~~~~~ii~  167 (606)
                      ||||+|||||||+|||||||||||+|||||||++|+|+|+|++|+|||||||||||+||||+|++||+|++|+|++|++.
T Consensus        81 HVDFsYEVSRSLAACEGALL~VDA~QGvEAQT~aN~YlAlE~dLeIIPViNKIDLP~Adpe~v~~eIe~~iGld~~~ai~  160 (598)
T TIGR01393        81 HVDFSYEVSRSLAACEGALLLVDAAQGVEAQTLANVYLALENDLEIIPVINKIDLPSADPERVKKEIEEVIGLDASEAIL  160 (598)
T ss_pred             CCCCCHHHHHHHHHHCCEEEEEECCCCHHHHHHHHHHHHHHCCCEEEEEECCCCCCCCCHHHHHHHHHHHCCCCCCCCEE
T ss_conf             72127378888887164035614103235888999988756187584778253688888589999876541889643038


Q ss_pred             HHHHCCCCCCHHHHHHHHHHHCCCCHHHHH-CCCCCCCCCEEECCCCCEEEEEEECCCCCCCCCEEEEECCCCCCCCCCC
Q ss_conf             111002232006787763210001111220-1233101210114757259999816987355845887335564210122
Q gi|254780321|r  168 VSAKTGEGIPLLLERIVQQLPSPTSPEGAN-APLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVERI  246 (606)
Q Consensus       168 vSAktG~GV~~LLd~Iv~~iP~P~~~~~~~-~Pl~alVfds~~D~~~G~I~~~RV~sG~lk~Gd~I~~~~~g~~~~v~~i  246 (606)
                      ||||||+||++|||+||+++|||++  +++ +||||||||||||+|+|+|+|+||++|++++||+|++|+||++|+|.++
T Consensus       161 ~SAKtG~Gi~e~LEaIv~~vPpP~G--d~~DapLkALIFDS~YD~YrGVv~~vRv~~G~ik~gD~I~~Mstgk~y~V~ev  238 (598)
T TIGR01393       161 ASAKTGIGIEEILEAIVKRVPPPKG--DPDDAPLKALIFDSHYDNYRGVVVLVRVFEGTIKKGDKIRFMSTGKEYEVDEV  238 (598)
T ss_pred             EEECCCCCHHHHHHHHHHCCCCCCC--CCCCCCCEEEEEEEEECCCCEEEEEEEEEECEECCCCEEEEEECCCEEEEEEE
T ss_conf             7503678889998897101810011--38886632278843543865089999995268646988999534876667550


Q ss_pred             CCCCCCE-EEEHHCCCCCHHHHHHCCCCCCCCCCCCEECCCCCCCCCCCCCCCCCCCEEEEEECCCCHHHHHHHHHHHHH
Q ss_conf             2335541-240101247123322011002444454200046678532364552222126642126770245788999988
Q gi|254780321|r  247 GILTPKM-IDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVVFCGLFPVDATQFENLRTAINK  325 (606)
Q Consensus       247 g~~~~~~-~~v~~l~aGdVG~ii~gik~l~~~~vGDTl~~~~~p~~~~Lp~~~~~~P~v~~~i~p~~~~d~~~L~~aL~k  325 (606)
                      |+|.|+. .+.++|.||||||++||||+++|++||||||+.++|+.+|||||++++||||+|+||+++++|+.|++||+|
T Consensus       239 G~~~P~~~~~~~~L~aGeVGy~~AgIK~v~D~~VGDTiT~~~~Pa~eplpGF~~~KP~VFaGlYPid~~~Ye~LrdALeK  318 (598)
T TIGR01393       239 GVFTPKLEVKTQELSAGEVGYIIAGIKDVSDVKVGDTITSVKNPAKEPLPGFKEVKPMVFAGLYPIDTEDYEDLRDALEK  318 (598)
T ss_pred             EEECCCCCCCCCCEECCCEEEEEEEEEECCCEECCCEEECCCCCCCCCCCCCCCCCCEEEECCCCCCCHHHHHHHHHHHH
T ss_conf             03434520146620016305999865310411205445256787376788861257658601258880346899999755


Q ss_pred             HHHHCCCCCCCCCCCCCCCCEEEEEECCHHHHHHHHHHHHHHCCCEEEEECCCCCEEEEEECCCEEECCCHHHCCCHHHH
Q ss_conf             86411221112567600042028996376789888988866449506973782330335315645412696662586778
Q gi|254780321|r  326 LRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERLEREFSLNLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKI  405 (606)
Q Consensus       326 L~~~D~sl~~e~Ets~aLg~Gfr~gglG~LHLeVi~eRL~rEfg~ev~~t~P~V~Ykv~~~dG~~~~Vd~p~~~p~~~~i  405 (606)
                      |+|||+||+||+|||.||||||||||||+|||||++|||+||||+++|+|+|+|.|||.++||+...|+||++||+.+.|
T Consensus       319 L~LNDAsL~yE~E~S~ALGFGFRCGFLGLLHmEiiqERLeREFnldlI~TAP~V~Y~V~~~~G~~~~v~nP~~~P~~~~I  398 (598)
T TIGR01393       319 LKLNDASLTYEPESSPALGFGFRCGFLGLLHMEIIQERLEREFNLDLITTAPSVVYKVYLTDGEVIEVDNPSDLPDPNKI  398 (598)
T ss_pred             HHHHHHHHHCCCCCCCCCCCCEEECCCCCHHHHHHHHHHHHHCCCEEEEECCCEEEEEEEECCCEEEEECCHHCCCCCCC
T ss_conf             54402542102236300374043326663368999876544308706872781599999707818997183006850157


Q ss_pred             HHHHCCEEEEEEEECCCCCHHHHHHHHHHHHEEECCCCCC-CEEEEEEEECHHHHHHHHHHHHHHHCCCEEEEEEEECCC
Q ss_conf             8862326999998083100038999886300142443368-369999996043332204687676357418889854354
Q gi|254780321|r  406 AELREPWIQVTIITPNEYLGSILKLCQERRGIQIDMSHLD-NRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDY  484 (606)
Q Consensus       406 ~~i~EPi~~~~I~~P~ey~G~Vm~~l~~RRG~~~~m~~~~-~~~~i~~~vPl~Eli~~f~~~LkS~T~G~as~~ye~~~Y  484 (606)
                      .+++|||++++|++|+||+|+||+||++|||.+.+|+|+| +||.|.|+|||+|||+||||+|||+|+|||||||||.+|
T Consensus       399 ~~v~EPyv~~~IitP~ey~G~iM~LC~~KRG~~~~~~Y~d~~RV~L~YemPL~EI~~DFfDkLKS~skGYASfDYE~~~y  478 (598)
T TIGR01393       399 EHVEEPYVKATIITPSEYLGAIMELCQEKRGVQTNMEYLDPNRVELIYEMPLAEIVYDFFDKLKSISKGYASFDYELIGY  478 (598)
T ss_pred             CEEECCEEEEEEECCCCHHHHHHHHHHHCCEEEEEEEECCCCEEEEEEECCCCCEEEEEECCCCCCCCCCCCCCCCCCCC
T ss_conf             77844749999435830124688876301514634363189559999975753063301063202223532112321357


Q ss_pred             EECCEEEEEEEECCCCCCEEEEEEEHHHHHHHHHHHHHHHHHCCCHHHCCCCCEEEECCEEEEEECCCCCCCCEEEEECC
Q ss_conf             64366797488628824356874215779999999999987408701020022045647889741256420320323017
Q gi|254780321|r  485 RDSDLVKLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGGRIIARETVKARRKDVTAKCYG  564 (606)
Q Consensus       485 ~~~dlvk~~ilin~~~vdals~i~h~~~a~~~gr~~~~~L~~~iprq~F~v~iqa~~~~~iiare~i~~~rkdvt~kcyg  564 (606)
                      |++||||+|||||||+|||||+||||++|+.+||.+|+||||+||||||+|||||+||+||||||||||+||||||||||
T Consensus       479 r~~dLVKlDIL~Nge~VDALS~IVH~d~A~~~gr~~~~KLKE~IPRQqF~ipIQA~IG~KIIARETiKa~RKdVtAKCYG  558 (598)
T TIGR01393       479 RESDLVKLDILINGEPVDALSFIVHRDKAYSRGREIVEKLKELIPRQQFEIPIQAAIGGKIIARETIKALRKDVTAKCYG  558 (598)
T ss_pred             CCCCEEEEEEEECCCCCCEEEEECCCHHHHHHHHHHHHHHHHCCCCCCCCCCHHEECCCEEEEECCCCCCCCCEEEEECC
T ss_conf             43262899999848943368771235135889999998866228634666411022188068750354122550235208


Q ss_pred             CCCCHHHHHHHHHHHHHHHHHHCCCEECCHHHHHHHHCCC
Q ss_conf             7734787756898842178751077445889999974246
Q gi|254780321|r  565 GDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISILKTD  604 (606)
Q Consensus       565 Gd~trk~KLl~~qk~GKkrmk~~g~v~ip~~af~~~l~~~  604 (606)
                      |||||||||||||||||||||++|+|+||||||++|||.|
T Consensus       559 GDiTRKrKLLEKQKEGKKRMK~~G~VevPQeAFLaVLK~~  598 (598)
T TIGR01393       559 GDITRKRKLLEKQKEGKKRMKQIGKVEVPQEAFLAVLKVD  598 (598)
T ss_pred             CCCCHHHHHHHHHHHHHHHCCCCCCEECCHHHHHHHHCCC
T ss_conf             7704324545521021032157775315646865431279


No 2  
>PRK05433 GTP-binding protein LepA; Provisional
Probab=100.00  E-value=0  Score=1768.65  Aligned_cols=599  Identities=63%  Similarity=1.063  Sum_probs=592.8

Q ss_pred             CCHHHCEEEEEECCCCCCHHHHHHHHHHHCCCCCCCCCCCEEECCCHHHHHHCCEEEEEEEEEEEECCCCCEEEEEEEEC
Q ss_conf             98525317999801389877889999998298054444311305867798719505232799997437884389999617
Q gi|254780321|r    6 TPLSRIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVRLNYTSTDAKDYQLNLIDT   85 (606)
Q Consensus         6 ~p~~~IRN~~IiaHvDhGKTTL~d~lL~~tg~i~~~~~~~~vlD~~~~EreRGITIka~~~~~~~~~~~~~~y~iNlIDT   85 (606)
                      .++++|||||||||||||||||+||||+.||+++++++++|+||+|++|||||||||||++++.|.+.+|++|.+|||||
T Consensus         2 ~~~~~IRNf~IiAHIDhGKSTLaDrlL~~tg~i~~~~~~~q~lD~m~~ErERGITIka~~v~~~y~~~~g~~y~lNLIDT   81 (601)
T PRK05433          2 MDMKNIRNFSIIAHIDHGKSTLADRLIELTGTLSEREMKAQVLDSMDLERERGITIKAQAVRLNYKAKDGETYQLNLIDT   81 (601)
T ss_pred             CCHHCCCEEEEEEECCCCHHHHHHHHHHHCCCCCCCCCHHHCCCCHHHHHHCCCEEEEEEEEEEEECCCCCEEEEEEECC
T ss_conf             63320455899994378888899999997099774432333145415576558369786799998848996799998548


Q ss_pred             CCCCHHHHHHHHHHHHCCEEEEEEECCCCCCHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCCHHHHHHHHHHHHHHHH
Q ss_conf             87300279999999730268999986878865589999999970996799832678875321133888775553223210
Q gi|254780321|r   86 PGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQAIDNNHEIITVLNKADLPSADPDRVKKQIEETIGISTEDA  165 (606)
Q Consensus        86 PGH~DF~~EV~r~l~a~dgaiLvVdA~~Gvq~QT~~~~~~A~~~~l~~I~viNKiD~~~A~~e~v~~ei~~~~g~~~~~i  165 (606)
                      |||+||+|||+|||+|||||||||||++||||||++||++|++++|++||||||||+|+||||+|.+||++++|++++++
T Consensus        82 PGHVDF~~EVsRSL~aceGalLlVDa~qGVqaQT~an~~~A~~~~L~iIpviNKIDlp~Ad~e~v~~qi~~~igl~~~ei  161 (601)
T PRK05433         82 PGHVDFSYEVSRSLAACEGALLVVDASQGVEAQTLANVYLALENDLEIIPVLNKIDLPAADPERVKQEIEDIIGIDASDA  161 (601)
T ss_pred             CCCCCCCEEEEEEHHHCCCEEEEEECCCCCCCHHHHHHHHHHHCCCCEEEEEECCCCCCCCHHHHHHHHHHHHCCCHHHH
T ss_conf             98566450455603340725999976878560069999999987996577786146888998999999998868964777


Q ss_pred             HHHHHHCCCCCCHHHHHHHHHHHCCCCHHHHHCCCCCCCCCEEECCCCCEEEEEEECCCCCCCCCEEEEECCCCCCCCCC
Q ss_conf             00111002232006787763210001111220123310121011475725999981698735584588733556421012
Q gi|254780321|r  166 LLVSAKTGEGIPLLLERIVQQLPSPTSPEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVER  245 (606)
Q Consensus       166 i~vSAktG~GV~~LLd~Iv~~iP~P~~~~~~~~Pl~alVfds~~D~~~G~I~~~RV~sG~lk~Gd~I~~~~~g~~~~v~~  245 (606)
                      +++|||+|.||++|||+|++++|||++  ++++||+|||||||||+|+|+|+++||++|+|++||+|.+++++++|++.+
T Consensus       162 l~vSAKtG~GV~~lLdaIV~~iP~P~g--d~~~PL~ALIFDS~yD~YrGvV~~vRV~~G~lk~Gd~I~~~~t~~~~~v~e  239 (601)
T PRK05433        162 VLVSAKTGIGIEEVLEAIVERIPPPKG--DPDAPLKALIFDSWYDPYRGVVVLVRVVDGTLKKGDKIKMMSTGKEYEVDE  239 (601)
T ss_pred             HHHHHHCCCCHHHHHHHHHHHCCCCCC--CCCCCHHHHHHHCCCCCCCCEEEEEEEECCEECCCCEEEEECCCCEEEEEE
T ss_conf             777523388879999999974799999--987343120123030467880799994088772585256412697167202


Q ss_pred             CCCCCCCEEEEHHCCCCCHHHHHHCCCCCCCCCCCCEECCCCCCCCCCCCCCCCCCCEEEEEECCCCHHHHHHHHHHHHH
Q ss_conf             22335541240101247123322011002444454200046678532364552222126642126770245788999988
Q gi|254780321|r  246 IGILTPKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVVFCGLFPVDATQFENLRTAINK  325 (606)
Q Consensus       246 ig~~~~~~~~v~~l~aGdVG~ii~gik~l~~~~vGDTl~~~~~p~~~~Lp~~~~~~P~v~~~i~p~~~~d~~~L~~aL~k  325 (606)
                      +|+|+|++.++++|.||||||+++|+|++.++++|||||+.++|..+|||||++++||||+|+||.+++||++|++||+|
T Consensus       240 vGi~~p~~~~~~~L~aGeVGyiiagiK~~~d~~vGDTit~~~~~~~~pLpGf~~~kP~Vfagi~P~~~~d~~~Lr~AL~K  319 (601)
T PRK05433        240 VGVFTPKMVPVDELSAGEVGYIIAGIKDVRDARVGDTITLAKNPAEEPLPGFKEVKPMVFAGLYPVDSDDYEDLRDALEK  319 (601)
T ss_pred             EECCCCCCCCCCEECCCCEEEEEECCCCHHHCCCCCEEECCCCCCCCCCCCCCCCCCEEEECCCCCCHHHHHHHHHHHHH
T ss_conf             42568985274501378447998245444323347605547777753467788999869972342770068999999998


Q ss_pred             HHHHCCCCCCCCCCCCCCCCEEEEEECCHHHHHHHHHHHHHHCCCEEEEECCCCCEEEEEECCCEEECCCHHHCCCHHHH
Q ss_conf             86411221112567600042028996376789888988866449506973782330335315645412696662586778
Q gi|254780321|r  326 LRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERLEREFSLNLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKI  405 (606)
Q Consensus       326 L~~~D~sl~~e~Ets~aLg~Gfr~gglG~LHLeVi~eRL~rEfg~ev~~t~P~V~Ykv~~~dG~~~~Vd~p~~~p~~~~i  405 (606)
                      |++|||||+||+|+|+|||+||||||||+|||||++|||+||||+++++|+|+|+||++++||+.+.|+||++||+.+.|
T Consensus       320 L~LnD~Sl~~e~Ets~aLG~GfRcGFLGlLHmeIi~ERLeREf~~~vI~TaPsV~Y~v~~~~g~~~~v~nP~~~Pd~~~i  399 (601)
T PRK05433        320 LQLNDASLTYEPETSQALGFGFRCGFLGLLHMEIIQERLEREFDLDLITTAPSVVYEVTLTDGEVIEVDNPSKLPDPGKI  399 (601)
T ss_pred             HHHCCCCEEEEECCCHHHCCCCHHCCCCHHHHHHHHHHHHHHCCCCEEEECCCEEEEEEECCCCEEEEECHHHCCCCCCC
T ss_conf             86357753763145444327621134306779999999998729846842795689999779979999685656886652


Q ss_pred             HHHHCCEEEEEEEECCCCCHHHHHHHHHHHHEEECCCCCC-CEEEEEEEECHHHHHHHHHHHHHHHCCCEEEEEEEECCC
Q ss_conf             8862326999998083100038999886300142443368-369999996043332204687676357418889854354
Q gi|254780321|r  406 AELREPWIQVTIITPNEYLGSILKLCQERRGIQIDMSHLD-NRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDY  484 (606)
Q Consensus       406 ~~i~EPi~~~~I~~P~ey~G~Vm~~l~~RRG~~~~m~~~~-~~~~i~~~vPl~Eli~~f~~~LkS~T~G~as~~ye~~~Y  484 (606)
                      ++++|||++++|++|+||+|+||+||.+|||++.+|+|++ +|++++|++||+|+++||||+|||+|+||||||||+.+|
T Consensus       400 ~~i~EP~v~~~I~~P~ey~G~vm~Lc~~rRG~~~~~~y~~~~rv~l~y~lPL~Eii~DFfDkLKS~s~GYAS~dYe~~~y  479 (601)
T PRK05433        400 EEIEEPIVKATIIVPQEYLGAVMELCQEKRGVQIDMEYLGNTRVMLTYELPLAEIVFDFFDRLKSVSRGYASLDYEFIGY  479 (601)
T ss_pred             EEEECCEEEEEEECCHHHHHHHHHHHHHHHCEEECCCCCCCCEEEEEEECCHHHHHHHHHHHHHCCCCCCEEEECCCCCC
T ss_conf             18985668999966389889999999985326531413678759999956589998878787541165515760210344


Q ss_pred             EECCEEEEEEEECCCCCCEEEEEEEHHHHHHHHHHHHHHHHHCCCHHHCCCCCEEEECCEEEEEECCCCCCCCEEEEECC
Q ss_conf             64366797488628824356874215779999999999987408701020022045647889741256420320323017
Q gi|254780321|r  485 RDSDLVKLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGGRIIARETVKARRKDVTAKCYG  564 (606)
Q Consensus       485 ~~~dlvk~~ilin~~~vdals~i~h~~~a~~~gr~~~~~L~~~iprq~F~v~iqa~~~~~iiare~i~~~rkdvt~kcyg  564 (606)
                      +++||||++|||||++|||||+||||++|+.+||++|+|||++||||||+|||||++||||||||||+|+||||||||||
T Consensus       480 ~~sdLvKldIliNg~~Vdals~i~h~~~a~~~gr~~~~kLk~~IPrq~f~v~IQA~ig~kiiAreti~a~RKdVtaKcyG  559 (601)
T PRK05433        480 RESDLVKLDILINGEPVDALSFIVHRDKAYERGRALVEKLKELIPRQQFEIPIQAAIGSKIIARETIKALRKDVLAKCYG  559 (601)
T ss_pred             CCCCEEEEEEEECCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHCCHHHCCCHHHHHHCCEEEEEECCCHHHCCEEEECCC
T ss_conf             51687899999888542466511228889999999999998558874414477675678689932151320642335138


Q ss_pred             CCCCHHHHHHHHHHHHHHHHHHCCCEECCHHHHHHHHCCCCC
Q ss_conf             773478775689884217875107744588999997424689
Q gi|254780321|r  565 GDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISILKTDNE  606 (606)
Q Consensus       565 Gd~trk~KLl~~qk~GKkrmk~~g~v~ip~~af~~~l~~~~~  606 (606)
                      ||||||||||+|||+||||||++|+|+||||||+++||+|++
T Consensus       560 GDitRK~KLLekQkeGKkrmk~iG~V~ipqeaF~~vLk~~~~  601 (601)
T PRK05433        560 GDISRKRKLLEKQKEGKKRMKQIGNVEIPQEAFLAVLKVDDD  601 (601)
T ss_pred             CCHHHHHHHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHCCCC
T ss_conf             981688999999865268787158970799999999716799


No 3  
>COG0481 LepA Membrane GTPase LepA [Cell envelope biogenesis, outer membrane]
Probab=100.00  E-value=0  Score=1726.43  Aligned_cols=601  Identities=65%  Similarity=1.079  Sum_probs=595.5

Q ss_pred             CCCCHHHCEEEEEECCCCCCHHHHHHHHHHHCCCCCCCCCCCEEECCCHHHHHHCCEEEEEEEEEEEECCCCCEEEEEEE
Q ss_conf             89985253179998013898778899999982980544443113058677987195052327999974378843899996
Q gi|254780321|r    4 KPTPLSRIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVRLNYTSTDAKDYQLNLI   83 (606)
Q Consensus         4 ~~~p~~~IRN~~IiaHvDhGKTTL~d~lL~~tg~i~~~~~~~~vlD~~~~EreRGITIka~~~~~~~~~~~~~~y~iNlI   83 (606)
                      ..+|+++|||||||||+|||||||+||||+.||++++|++.+|+||+|++|||||||||+|++++.|+..+|++|.+|||
T Consensus         2 ~~~~~~~IRNFsIIAHIDHGKSTLaDRlle~t~~~~~Rem~~Q~LDsMdiERERGITIKaq~v~l~Yk~~~g~~Y~lnlI   81 (603)
T COG0481           2 TFTPQKNIRNFSIIAHIDHGKSTLADRLLELTGGLSEREMRAQVLDSMDIERERGITIKAQAVRLNYKAKDGETYVLNLI   81 (603)
T ss_pred             CCCCHHHCCCEEEEEEECCCCCHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHCCCEEEEEEEEEEEEECCCCEEEEEEC
T ss_conf             86725442322799984278204889999984676767888875221346766284587327899999479977999972


Q ss_pred             ECCCCCHHHHHHHHHHHHCCEEEEEEECCCCCCHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCCHHHHHHHHHHHHHH
Q ss_conf             17873002799999997302689999868788655899999999709967998326788753211338887755532232
Q gi|254780321|r   84 DTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQAIDNNHEIITVLNKADLPSADPDRVKKQIEETIGISTE  163 (606)
Q Consensus        84 DTPGH~DF~~EV~r~l~a~dgaiLvVdA~~Gvq~QT~~~~~~A~~~~l~~I~viNKiD~~~A~~e~v~~ei~~~~g~~~~  163 (606)
                      |||||+||+|||||||+||+||||||||+|||||||++|+|+|++++|++||||||||+|+||||++++||++.+|++++
T Consensus        82 DTPGHVDFsYEVSRSLAACEGalLvVDAsQGveAQTlAN~YlAle~~LeIiPViNKIDLP~Adpervk~eIe~~iGid~~  161 (603)
T COG0481          82 DTPGHVDFSYEVSRSLAACEGALLVVDASQGVEAQTLANVYLALENNLEIIPVLNKIDLPAADPERVKQEIEDIIGIDAS  161 (603)
T ss_pred             CCCCCCCEEEEEHHHHHHCCCCEEEEECCCCHHHHHHHHHHHHHHCCCEEEEEEECCCCCCCCHHHHHHHHHHHHCCCCC
T ss_conf             79984436777613376377718999876553788999999998769679975322568878978999999987098952


Q ss_pred             HHHHHHHHCCCCCCHHHHHHHHHHHCCCCHHHHHCCCCCCCCCEEECCCCCEEEEEEECCCCCCCCCEEEEECCCCCCCC
Q ss_conf             10001110022320067877632100011112201233101210114757259999816987355845887335564210
Q gi|254780321|r  164 DALLVSAKTGEGIPLLLERIVQQLPSPTSPEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQV  243 (606)
Q Consensus       164 ~ii~vSAktG~GV~~LLd~Iv~~iP~P~~~~~~~~Pl~alVfds~~D~~~G~I~~~RV~sG~lk~Gd~I~~~~~g~~~~v  243 (606)
                      +++.+|||+|.||+++|++|++++|||++  ++++||+|||||||||+|+|+|+++||++|++++||+|.+|++|++|+|
T Consensus       162 dav~~SAKtG~gI~~iLe~Iv~~iP~P~g--~~~~pLkALifDS~yD~Y~GVv~~vRi~dG~ik~gdki~~m~tg~~y~V  239 (603)
T COG0481         162 DAVLVSAKTGIGIEDVLEAIVEKIPPPKG--DPDAPLKALIFDSWYDNYLGVVVLVRIFDGTLKKGDKIRMMSTGKEYEV  239 (603)
T ss_pred             CCEEEECCCCCCHHHHHHHHHHHCCCCCC--CCCCCCEEEEEECCCCCCCEEEEEEEEEECEECCCCEEEEEECCCEEEE
T ss_conf             00467634689979999999962898989--9987515888841234554289999986243447998999746976888


Q ss_pred             CCCCCCCCCEEEEHHCCCCCHHHHHHCCCCCCCCCCCCEECCCCCCCCCCCCCCCCCCCEEEEEECCCCHHHHHHHHHHH
Q ss_conf             12223355412401012471233220110024444542000466785323645522221266421267702457889999
Q gi|254780321|r  244 ERIGILTPKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVVFCGLFPVDATQFENLRTAI  323 (606)
Q Consensus       244 ~~ig~~~~~~~~v~~l~aGdVG~ii~gik~l~~~~vGDTl~~~~~p~~~~Lp~~~~~~P~v~~~i~p~~~~d~~~L~~aL  323 (606)
                      .++|+|.|++.++++|.||||||++++||++.++++|||+|+.++|..+|||||++++||||+|+||++++||+.|++||
T Consensus       240 ~evGvftP~~~~~~~L~aGeVG~~~a~iK~v~d~~VGDTiT~~~~p~~e~LpGfk~~~P~Vf~GlyPid~~dye~LrdAl  319 (603)
T COG0481         240 DEVGIFTPKMVKVDELKAGEVGYIIAGIKDVRDARVGDTITLASNPATEPLPGFKEVKPMVFAGLYPVDSDDYEDLRDAL  319 (603)
T ss_pred             EEEEECCCCCCCCCCCCCCCEEEEEEEEEECCCCCCCCEEECCCCCCCCCCCCCCCCCCEEEEEECCCCHHHHHHHHHHH
T ss_conf             88751167633246445773448998511115686555675067877666888776785599841116666789999999


Q ss_pred             HHHHHHCCCCCCCCCCCCCCCCEEEEEECCHHHHHHHHHHHHHHCCCEEEEECCCCCEEEEEECCCEEECCCHHHCCCHH
Q ss_conf             88864112211125676000420289963767898889888664495069737823303353156454126966625867
Q gi|254780321|r  324 NKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERLEREFSLNLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVT  403 (606)
Q Consensus       324 ~kL~~~D~sl~~e~Ets~aLg~Gfr~gglG~LHLeVi~eRL~rEfg~ev~~t~P~V~Ykv~~~dG~~~~Vd~p~~~p~~~  403 (606)
                      +||++||+||+||+|||.||||||||||||+|||||++|||+||||+++|+|+|+|+|+|.++||+...|+||++||+.+
T Consensus       320 eKL~LNDasl~~E~EtS~ALGfGfRcGFLGlLHmeiiqERLeREf~ldlI~TaPsV~Y~v~~~~g~~~~i~NPs~~P~~~  399 (603)
T COG0481         320 EKLQLNDASLTYEPETSQALGFGFRCGFLGLLHMEIIQERLEREFDLDLITTAPSVVYKVELTDGEEIEVDNPSDLPDPN  399 (603)
T ss_pred             HHCCCCCCEEEECCCCCHHCCCCEEEHHHHHHHHHHHHHHHHHHHCCCEEECCCCEEEEEEECCCCEEEECCHHHCCCHH
T ss_conf             74433530156322521330575630102278999999999876086348438946899997389689952857688831


Q ss_pred             HHHHHHCCEEEEEEEECCCCCHHHHHHHHHHHHEEECCCCCC-CEEEEEEEECHHHHHHHHHHHHHHHCCCEEEEEEEEC
Q ss_conf             788862326999998083100038999886300142443368-3699999960433322046876763574188898543
Q gi|254780321|r  404 KIAELREPWIQVTIITPNEYLGSILKLCQERRGIQIDMSHLD-NRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVI  482 (606)
Q Consensus       404 ~i~~i~EPi~~~~I~~P~ey~G~Vm~~l~~RRG~~~~m~~~~-~~~~i~~~vPl~Eli~~f~~~LkS~T~G~as~~ye~~  482 (606)
                      .|++++|||++++|++|+||+|+||+||++|||.+.+|+|++ +|+.|.|++||+|+++||||+|||.|+|||||||||.
T Consensus       400 ~I~~i~EP~v~~~ii~P~eylG~vm~Lcq~kRG~~~~m~yl~~~rv~l~Y~lPl~Eiv~DFfDkLKS~skGYAS~DYe~~  479 (603)
T COG0481         400 KIEEIEEPYVKATIITPQEYLGNVMELCQEKRGIQIDMEYLDQNRVMLTYELPLAEIVFDFFDKLKSISKGYASFDYEFI  479 (603)
T ss_pred             HHHEEECCEEEEEEECCHHHHHHHHHHHHHHCCCEECCEEECCCEEEEEEECCHHHHHHHHHHHHHCCCCCEEEECCCCC
T ss_conf             32105176569999570788789999998722764633670376499999464788888876764222465064311002


Q ss_pred             CCEECCEEEEEEEECCCCCCEEEEEEEHHHHHHHHHHHHHHHHHCCCHHHCCCCCEEEECCEEEEEECCCCCCCCEEEEE
Q ss_conf             54643667974886288243568742157799999999999874087010200220456478897412564203203230
Q gi|254780321|r  483 DYRDSDLVKLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGGRIIARETVKARRKDVTAKC  562 (606)
Q Consensus       483 ~Y~~~dlvk~~ilin~~~vdals~i~h~~~a~~~gr~~~~~L~~~iprq~F~v~iqa~~~~~iiare~i~~~rkdvt~kc  562 (606)
                      +|+++||||++||+||++|||||+|+||++|+.+||++|+|||++||||||+|||||++|+||||||||+|+||||||||
T Consensus       480 ~y~~~~lVK~dIlvNge~VDALs~ivHrd~A~~rgr~~~~KlKelIPrq~FeipIQAaIg~kiIARetIkalRKdVlAKC  559 (603)
T COG0481         480 GYRESDLVKVDILVNGEKVDALSFIVHRDNAYERGRELVEKLKELIPRQQFEIPIQAAIGSKIIARETIKALRKDVLAKC  559 (603)
T ss_pred             CCCCCCEEEEEEEECCCCCCCEEEEECHHHHHHHHHHHHHHHHHHCCHHHEEEEEEHHHCCEEEEHHHHHHHHCCHHHHH
T ss_conf             46405658999995586334122341056689989999999986564744104002233784787444577641411200


Q ss_pred             CCCCCCHHHHHHHHHHHHHHHHHHCCCEECCHHHHHHHHCCCCC
Q ss_conf             17773478775689884217875107744588999997424689
Q gi|254780321|r  563 YGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISILKTDNE  606 (606)
Q Consensus       563 ygGd~trk~KLl~~qk~GKkrmk~~g~v~ip~~af~~~l~~~~~  606 (606)
                      ||||||||||||+||||||||||++|+|+||||||+++||.|++
T Consensus       560 YGGDisRKrKLLeKQKeGKKRMK~iG~VeiPQeAFlavLk~~~~  603 (603)
T COG0481         560 YGGDISRKRKLLEKQKEGKKRMKQIGNVEIPQEAFLAVLKMDDD  603 (603)
T ss_pred             CCCCCHHHHHHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHCCCC
T ss_conf             17751178899987666668887247871688999999842599


No 4  
>KOG0462 consensus
Probab=100.00  E-value=0  Score=1489.60  Aligned_cols=594  Identities=51%  Similarity=0.864  Sum_probs=583.8

Q ss_pred             CCHHHCEEEEEECCCCCCHHHHHHHHHHHCCCCCCCCCCCEEECCCHHHHHHCCEEEEEEEEEEEECCCCCEEEEEEEEC
Q ss_conf             98525317999801389877889999998298054444311305867798719505232799997437884389999617
Q gi|254780321|r    6 TPLSRIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVRLNYTSTDAKDYQLNLIDT   85 (606)
Q Consensus         6 ~p~~~IRN~~IiaHvDhGKTTL~d~lL~~tg~i~~~~~~~~vlD~~~~EreRGITIka~~~~~~~~~~~~~~y~iNlIDT   85 (606)
                      .|.+|||||+||||||||||||+||||++||++..+.+++|+||++++|||||||||||+++|.|.+  ++.|.+|||||
T Consensus        55 ~P~~~iRNfsIIAHVDHGKSTLaDrLLe~tg~i~~~~~q~q~LDkl~vERERGITIkaQtasify~~--~~~ylLNLIDT  132 (650)
T KOG0462          55 DPVENIRNFSIIAHVDHGKSTLADRLLELTGTIDNNIGQEQVLDKLQVERERGITIKAQTASIFYKD--GQSYLLNLIDT  132 (650)
T ss_pred             CCHHHCCCEEEEEEECCCCCHHHHHHHHHHCCCCCCCCHHHHHHHHHHHHHCCCEEEEEEEEEEEEC--CCCEEEEEECC
T ss_conf             9066313137999842770168999999828778887556642454456652847875123799975--87328875058


Q ss_pred             CCCCHHHHHHHHHHHHCCEEEEEEECCCCCCHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCCHHHHHHHHHHHHHHHH
Q ss_conf             87300279999999730268999986878865589999999970996799832678875321133888775553223210
Q gi|254780321|r   86 PGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQAIDNNHEIITVLNKADLPSADPDRVKKQIEETIGISTEDA  165 (606)
Q Consensus        86 PGH~DF~~EV~r~l~a~dgaiLvVdA~~Gvq~QT~~~~~~A~~~~l~~I~viNKiD~~~A~~e~v~~ei~~~~g~~~~~i  165 (606)
                      |||+||+|||+|+|+|||||||||||.|||||||++|+|+|+++||.+||||||||+|+||||+|..|++++|+++++++
T Consensus       133 PGHvDFs~EVsRslaac~G~lLvVDA~qGvqAQT~anf~lAfe~~L~iIpVlNKIDlp~adpe~V~~q~~~lF~~~~~~~  212 (650)
T KOG0462         133 PGHVDFSGEVSRSLAACDGALLVVDASQGVQAQTVANFYLAFEAGLAIIPVLNKIDLPSADPERVENQLFELFDIPPAEV  212 (650)
T ss_pred             CCCCCCCCEEHEHHHHCCCEEEEEECCCCCHHHHHHHHHHHHHCCCEEEEEEECCCCCCCCHHHHHHHHHHHHCCCCCCE
T ss_conf             98555541000126535715999976768128899999999985974888653157898898999999999866896124


Q ss_pred             HHHHHHCCCCCCHHHHHHHHHHHCCCCHHHHHCCCCCCCCCEEECCCCCEEEEEEECCCCCCCCCEEEEECCCCCCCCCC
Q ss_conf             00111002232006787763210001111220123310121011475725999981698735584588733556421012
Q gi|254780321|r  166 LLVSAKTGEGIPLLLERIVQQLPSPTSPEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVER  245 (606)
Q Consensus       166 i~vSAktG~GV~~LLd~Iv~~iP~P~~~~~~~~Pl~alVfds~~D~~~G~I~~~RV~sG~lk~Gd~I~~~~~g~~~~v~~  245 (606)
                      +++|||+|.|++.||++|++++|||++  ..++|||||+||||||.|+|+|+++||.+|.+++||+|..++++++|.+.+
T Consensus       213 i~vSAK~G~~v~~lL~AII~rVPpP~~--~~d~plr~Lifds~yD~y~G~I~~vrv~~G~vrkGdkV~~~~t~~~yev~~  290 (650)
T KOG0462         213 IYVSAKTGLNVEELLEAIIRRVPPPKG--IRDAPLRMLIFDSEYDEYRGVIALVRVVDGVVRKGDKVQSAATGKSYEVKV  290 (650)
T ss_pred             EEEEECCCCCHHHHHHHHHHHCCCCCC--CCCCCHHHHHHHHHHHHHCCEEEEEEEEEEEEECCCEEEEEECCCCEEEEE
T ss_conf             888702575688899999963799988--888516777666335442535899998634462187888861376067677


Q ss_pred             CCCCCCCEEEEHHCCCCCHHHHHHCCCCCCCCCCCCEECCCCC-CCCCCCCCCCCCCCEEEEEECCCCHHHHHHHHHHHH
Q ss_conf             2233554124010124712332201100244445420004667-853236455222212664212677024578899998
Q gi|254780321|r  246 IGILTPKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSS-PTTSALPGFKPIQPVVFCGLFPVDATQFENLRTAIN  324 (606)
Q Consensus       246 ig~~~~~~~~v~~l~aGdVG~ii~gik~l~~~~vGDTl~~~~~-p~~~~Lp~~~~~~P~v~~~i~p~~~~d~~~L~~aL~  324 (606)
                      +|+|.|+++++.++.||+||||+|++++++++.|||||++... ...++||+|++.+||||++.||.+.+||..|+++++
T Consensus       291 vgvm~p~~~~~~~l~agqvGyIi~~mr~~~ea~IGdTi~~~~~~~~v~tl~~~~~~~pMvFvg~fP~dgsd~~~l~~a~e  370 (650)
T KOG0462         291 VGVMRPEMTPVVELDAGQVGYIICNMRNVKEAQIGDTIAHKSVTKAVETLPGFEPTKPMVFVGLFPLDGSDYETLRDAIE  370 (650)
T ss_pred             EEEECCCCEEEEEECCCCCCEEEECCCCCCCCCCCCEEEECCCCCCCCCCCCCCCCCCEEEECCCCCCCCHHHHHHHHHH
T ss_conf             57763576143232145425367504466545002300000357646757888887624885366676205555777999


Q ss_pred             HHHHHCCCCCCCCCCCCCCCCEEEEEECCHHHHHHHHHHHHHHCCCEEEEECCCCCEEEEEECCCEEECCCHHHCCCHHH
Q ss_conf             88641122111256760004202899637678988898886644950697378233033531564541269666258677
Q gi|254780321|r  325 KLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERLEREFSLNLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTK  404 (606)
Q Consensus       325 kL~~~D~sl~~e~Ets~aLg~Gfr~gglG~LHLeVi~eRL~rEfg~ev~~t~P~V~Ykv~~~dG~~~~Vd~p~~~p~~~~  404 (606)
                      ||++||+|+.+++|+|.|||+||||||||+|||+|++|||+||||.++++|+|+|+||+...||++..+.||+.||+...
T Consensus       371 rL~lnd~sv~v~~~~s~aLg~gwr~gflG~LHm~Vf~erle~Eyg~elivt~PtV~Yr~~~~~~~~~~i~np~~fp~~~~  450 (650)
T KOG0462         371 RLVLNDESVTVIKESSGALGQGWRLGFLGLLHMEVFIERLEREYGAELIVTPPTVPYRVVYSNGDEILISNPALFPDPSD  450 (650)
T ss_pred             HHHCCCCCCEEEECCCCCCCCCEEEECCCEEEHHHHHHHHHHHCCCEEEECCCCCEEEEEECCCCEEEECCHHHCCCCCC
T ss_conf             87515501145524773003645860312123899998788861953664389632799845886255228533898223


Q ss_pred             HHHHHCCEEEEEEEECCCCCHHHHHHHHHHHHEEECCCCCC-CEEEEEEEECHHHHHHHHHHHHHHHCCCEEEEEEEECC
Q ss_conf             88862326999998083100038999886300142443368-36999999604333220468767635741888985435
Q gi|254780321|r  405 IAELREPWIQVTIITPNEYLGSILKLCQERRGIQIDMSHLD-NRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVID  483 (606)
Q Consensus       405 i~~i~EPi~~~~I~~P~ey~G~Vm~~l~~RRG~~~~m~~~~-~~~~i~~~vPl~Eli~~f~~~LkS~T~G~as~~ye~~~  483 (606)
                      +.+++||++.++|++|+||+|.||++|++|||++.+|.+.+ +|++|.|.+||+||+.|||++|||+|+|||||||||++
T Consensus       451 v~~~lEP~v~~tii~P~Ey~G~Vi~Lc~~rRgeq~dm~~i~~nr~~lky~lPl~elv~df~~~lks~tsGyAs~dye~~g  530 (650)
T KOG0462         451 VKEFLEPYVEATIITPDEYVGAVIELCSERRGEQKDMTYIDGNRVMLKYQLPLRELVGDFFDRLKSLTSGYASFDYEDAG  530 (650)
T ss_pred             CHHHCCCEEEEEEECCHHHHHHHHHHHHHHHHHEECCEECCCCEEEEEEECCHHHHHHHHHHHHHCCCCCEEEEEECCCC
T ss_conf             30111755799997768988999999987221000324415876999995676888999998874036550577621356


Q ss_pred             CEECCEEEEEEEECCCCCCEEEEEEEHHHHHHHHHHHHHHHHHCCCHHHCCCCCEEEECCEEEEEECCCCCCCCEEEEEC
Q ss_conf             46436679748862882435687421577999999999998740870102002204564788974125642032032301
Q gi|254780321|r  484 YRDSDLVKLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGGRIIARETVKARRKDVTAKCY  563 (606)
Q Consensus       484 Y~~~dlvk~~ilin~~~vdals~i~h~~~a~~~gr~~~~~L~~~iprq~F~v~iqa~~~~~iiare~i~~~rkdvt~kcy  563 (606)
                      |+++||||++|++|++.||+||.|+|+++|+++||.+|++||+++|||||+|+|||++|+++||||+|+|+||||+||||
T Consensus       531 Y~~sdLvkldil~n~~~vd~l~tivh~~~a~~rGr~~v~klk~~ip~Q~~ev~iqa~igsk~iare~i~a~rKdv~akl~  610 (650)
T KOG0462         531 YQASDLVKLDILLNGKMVDGLSTIVHLSKAESRGREFVQKLKDLIPRQIFEVHIQACIGSKNIARETISAYRKDVLAKLY  610 (650)
T ss_pred             CCCCCCEEEEEECCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHCCCCHHHHHHHHHHCCCEEEEEC
T ss_conf             65455157776403102456777878987999999999876664412432121364236305568999873556156765


Q ss_pred             CCCCCHHHHHHHHHHHHHHHHHHCCCEECCHHHHHHHHCC
Q ss_conf             7773478775689884217875107744588999997424
Q gi|254780321|r  564 GGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISILKT  603 (606)
Q Consensus       564 gGd~trk~KLl~~qk~GKkrmk~~g~v~ip~~af~~~l~~  603 (606)
                      |||+||++|||++|||||||||++|||+||||||+++||+
T Consensus       611 ggdv~r~~klL~~q~egkk~mk~vgnI~ipkeaf~~vlKr  650 (650)
T KOG0462         611 GGDVTRLKKLLKKQAEGKKRMKTVGNIRIPKEAFINVLKR  650 (650)
T ss_pred             CCCHHHHHHHHHHHHCCCEEEECCCCEECCHHHHHHHHCC
T ss_conf             8732459999876643855663255274377998887419


No 5  
>TIGR01394 TypA_BipA GTP-binding protein TypA; InterPro: IPR006298   This bacterial (and Arabidopsis) protein, termed TypA or BipA, is a GTP-binding protein. It is phosphorylated on a tyrosine residue under some cellular conditions. Mutants show altered regulation of some pathways, but the precise function is unknown.; GO: 0005525 GTP binding, 0005622 intracellular.
Probab=100.00  E-value=0  Score=1165.12  Aligned_cols=518  Identities=29%  Similarity=0.500  Sum_probs=471.7

Q ss_pred             CEEEEEECCCCCCHHHHHHHHHHHCC-CCCC-CC-CCCEEECCCHHHHHHCCEEEEEEEEEEEECCCCCEEEEEEEECCC
Q ss_conf             31799980138987788999999829-8054-44-431130586779871950523279999743788438999961787
Q gi|254780321|r   11 IRNFSIVAHIDHGKSTLADRFIQHCR-GLTE-RE-MSSQVLDNMDIERERGITIKAQTVRLNYTSTDAKDYQLNLIDTPG   87 (606)
Q Consensus        11 IRN~~IiaHvDhGKTTL~d~lL~~tg-~i~~-~~-~~~~vlD~~~~EreRGITIka~~~~~~~~~~~~~~y~iNlIDTPG   87 (606)
                      |||||||||||||||||+|+||.+|| ++.+ ++ ..+++|||+|+||||||||.|+++++.|.+.+| .++||||||||
T Consensus         1 iRNIAIIAHVDHGKTTLVD~LL~Qsgf~f~~~~~~~~ER~MDSNDLErERGITILaKNTav~y~g~dG-~~~INIvDTPG   79 (609)
T TIGR01394         1 IRNIAIIAHVDHGKTTLVDALLKQSGFTFRADNEAVAERVMDSNDLERERGITILAKNTAVRYNGKDG-VTKINIVDTPG   79 (609)
T ss_pred             CCCEEEEEEECCCCHHHHHHHHHHHHHHHHHCCCCCEEEEECCCCCCHHCCCCCCCEEEEEEECCCCC-EEEEEEEECCC
T ss_conf             97189998806994368988888765886415883213540676521001552013003662528897-18997781689


Q ss_pred             CCHHHHHHHHHHHHCCEEEEEEECCCCCCHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCCHHHHHHHHH-HHHHHH--
Q ss_conf             30027999999973026899998687886558999999997099679983267887532113388877555-322321--
Q gi|254780321|r   88 HVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQAIDNNHEIITVLNKADLPSADPDRVKKQIEETI-GISTED--  164 (606)
Q Consensus        88 H~DF~~EV~r~l~a~dgaiLvVdA~~Gvq~QT~~~~~~A~~~~l~~I~viNKiD~~~A~~e~v~~ei~~~~-g~~~~~--  164 (606)
                      |+||+|||+|.|+|+|||||||||.+||||||++++.+|+++||++|+||||||||+|||++|.++++||| +++++|  
T Consensus        80 HADFGGEVERvL~MVDGvlLlVDA~EGPMPQTrFVL~KAL~~gLkPIVViNKiDrp~ARP~eV~d~vFDLF~~LgA~deQ  159 (609)
T TIGR01394        80 HADFGGEVERVLGMVDGVLLLVDASEGPMPQTRFVLKKALELGLKPIVVINKIDRPSARPDEVVDEVFDLFIELGADDEQ  159 (609)
T ss_pred             CCCCCCEEEEECEEEEEEEEEEECCCCCCCCCHHHHHHHHHCCCCEEEEECCCCCCCCCHHHHHHHHHHHHHHCCCCCCC
T ss_conf             88788658873302405899985788898853478999995689369997134788788378875787888853888001


Q ss_pred             ----HHHHHHHCCC---------------CCCHHHHHHHHHHHCCCCHHHHHCCCCCCCCCEEECCCCCEEEEEEECCCC
Q ss_conf             ----0001110022---------------320067877632100011112201233101210114757259999816987
Q gi|254780321|r  165 ----ALLVSAKTGE---------------GIPLLLERIVQQLPSPTSPEGANAPLKALLIDSWYNSYLGVMVLVRIINGQ  225 (606)
Q Consensus       165 ----ii~vSAktG~---------------GV~~LLd~Iv~~iP~P~~~~~~~~Pl~alVfds~~D~~~G~I~~~RV~sG~  225 (606)
                          ++|+||+.|.               +++||||+|++|+|+|++  ++|+||||||+...||+|+|||++|||++|+
T Consensus       160 LDFP~vYASa~~G~A~l~~~~dg~~~~~~~m~PLFd~I~~hvPaP~~--~~d~PlQmlvt~ldy~~y~GRI~~GRv~~G~  237 (609)
T TIGR01394       160 LDFPIVYASARAGWASLDKDKDGLDDDSEDMAPLFDAILRHVPAPKG--DLDEPLQMLVTNLDYDEYLGRIAIGRVHRGT  237 (609)
T ss_pred             CCHHHHHHHHCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCCCC--CCCCCHHHEEEECCCCCCCCEEEEEEEEECE
T ss_conf             01256766523672014466577887220178999898640688898--8876242100011014677669999875056


Q ss_pred             CCCCCEEEEECCC-CCC---CCCCC-CCCCCCEEEEHHCCCCCHHHHHHCCCCCCCCCCCCEECCCCCCCCCCCCCCCCC
Q ss_conf             3558458873355-642---10122-233554124010124712332201100244445420004667853236455222
Q gi|254780321|r  226 LTKGQSIRLMGTN-AKY---QVERI-GILTPKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPI  300 (606)
Q Consensus       226 lk~Gd~I~~~~~g-~~~---~v~~i-g~~~~~~~~v~~l~aGdVG~ii~gik~l~~~~vGDTl~~~~~p~~~~Lp~~~~~  300 (606)
                      ||+||+|.+++.. ++.   ||+++ ++.+.++.++|++.||||    |.+.++.++.||||||++++|  +|||.++.+
T Consensus       238 vk~Gq~V~~~~~d~g~~~~~ri~~L~~f~GL~R~~~d~A~AGDI----vAvaG~~~~~IGeTiad~~~~--~ALP~~~vD  311 (609)
T TIGR01394       238 VKKGQQVALMKRDDGTIENGRISKLLGFEGLERVEIDEAGAGDI----VAVAGLEDINIGETIADPEAP--EALPLITVD  311 (609)
T ss_pred             ECCCCEEEEEECCCCEEEEEEEEEEEECCCCEEEECCCCCCCCE----EEEECCCCCCCCCEECCCCCC--CCCCCCCCC
T ss_conf             54686479872469689777764542015711000455798778----999077988735211333346--788711258


Q ss_pred             CCEEEEEECCCCHHHHH-----------HHHHHHHHHHHHCCCCCCCCCCCCCCCCEEEEEECCHHHHHHHHHHHHHHCC
Q ss_conf             21266421267702457-----------8899998886411221112567600042028996376789888988866449
Q gi|254780321|r  301 QPVVFCGLFPVDATQFE-----------NLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERLEREFS  369 (606)
Q Consensus       301 ~P~v~~~i~p~~~~d~~-----------~L~~aL~kL~~~D~sl~~e~Ets~aLg~Gfr~gglG~LHLeVi~eRL~rEfg  369 (606)
                      +|+++| .|.+|+|||+           +++++|.|..+.+-||+|++-.+.-   .|+|||||||||.|++|+|||| |
T Consensus       312 EPT~sM-tF~vN~SPlAG~EVGk~VTSR~i~dRL~rEL~~NvALrVe~t~~~D---~f~VsGRGELhLsILiEtMRRE-G  386 (609)
T TIGR01394       312 EPTLSM-TFSVNDSPLAGKEVGKFVTSRQIRDRLERELETNVALRVEDTESAD---KFEVSGRGELHLSILIETMRRE-G  386 (609)
T ss_pred             CCCEEE-EEEECCCCCCCCCCCCEECCCCHHHHHHHHHHCCCEEEEECCCCCC---CEEEECCEEEHHHHHHHCCCCC-C
T ss_conf             881289-9875288765532573032441578999986317145640389887---3487201113023454203444-4


Q ss_pred             CEEEEECCCCCEEEEEECCCEEECCCHHHCCCHHHHHHHHCCEEEEEEEECCCCCHHHHHHHHHHHHEEECCCCC-C-CE
Q ss_conf             506973782330335315645412696662586778886232699999808310003899988630014244336-8-36
Q gi|254780321|r  370 LNLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEYLGSILKLCQERRGIQIDMSHL-D-NR  447 (606)
Q Consensus       370 ~ev~~t~P~V~Ykv~~~dG~~~~Vd~p~~~p~~~~i~~i~EPi~~~~I~~P~ey~G~Vm~~l~~RRG~~~~m~~~-~-~~  447 (606)
                      ||+.+++|+|+||  ..||+.                  +|||+.++|+|||||+|.||+.|+.|||+|.+|.+. + ||
T Consensus       387 fEl~Vg~P~Vi~k--~~dG~k------------------~EP~E~~~IDVPEe~~G~V~e~Lg~RKgEm~~M~~~g~EG~  446 (609)
T TIGR01394       387 FELQVGRPQVIYK--EIDGKK------------------LEPIEELTIDVPEEHVGAVIEKLGKRKGEMKDMEPSGNEGR  446 (609)
T ss_pred             EEEEECCCEEEEE--EECCEE------------------ECCEEEEEEECCCCCCCHHHHHHCCCCEEEEECCCCCCCCE
T ss_conf             1475359778998--458853------------------18756999802853354666531478347772567699646


Q ss_pred             EEEEEEECHHHHHHHHHHHHHHHCCCEEEEEEEECCCEE---CCE--EEEEEEECCCCCCEEEEEEEHHHHHHHHHHHHH
Q ss_conf             999999604333220468767635741888985435464---366--797488628824356874215779999999999
Q gi|254780321|r  448 AMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDYRD---SDL--VKLTILVNNETIDALSILVHRSVSEKRGRGICE  522 (606)
Q Consensus       448 ~~i~~~vPl~Eli~~f~~~LkS~T~G~as~~ye~~~Y~~---~dl--vk~~ilin~~~vdals~i~h~~~a~~~gr~~~~  522 (606)
                      ++|+|.+|+|+|| ||++++.|+|+|+|.|++.|.+|+|   ++|  +.+|+||+.+.                |.+++|
T Consensus       447 tRl~F~~PsRGLI-Gfr~~FlT~TrG~Gimn~~F~~Y~P~~pG~i~~R~~GsLVs~~~----------------G~a~~Y  509 (609)
T TIGR01394       447 TRLEFVIPSRGLI-GFRTEFLTDTRGTGIMNHVFDEYEPWKPGEIETRRNGSLVSMED----------------GTATAY  509 (609)
T ss_pred             EEEEEECCCCCHH-HHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCEEEEECC----------------CCHHHH
T ss_conf             9999981664001-22024544102131120121025788876877751415899268----------------810667


Q ss_pred             HHHHCCCHH-HCCCCCEEEECCEEEEEECCCCCCCCEEEEECCCCCCHHHHHHHHHHHHHHHHHHC
Q ss_conf             987408701-02002204564788974125642032032301777347877568988421787510
Q gi|254780321|r  523 KLKNLIPQQ-MFQIAIQAAIGGRIIARETVKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRF  587 (606)
Q Consensus       523 ~L~~~iprq-~F~v~iqa~~~~~iiare~i~~~rkdvt~kcygGd~trk~KLl~~qk~GKkrmk~~  587 (606)
                      +|.+|+.|. ||.-|.+.+|.|||||   +|++.+|+.+|     |+|+|||+|.|++||.-.-.+
T Consensus       510 aL~nLqeRG~~Fv~pG~~VY~GMIiG---EhsR~~DL~VN-----~~K~K~LTN~RsSg~D~~~~L  567 (609)
T TIGR01394       510 ALWNLQERGRLFVSPGTEVYEGMIIG---EHSRENDLDVN-----VCKAKKLTNVRSSGKDEAVKL  567 (609)
T ss_pred             HHHHHHHCCCEEECCCCCEECCEEEE---ECCCCCCCEEC-----CCCCCCCCEEEECCCCCEEEE
T ss_conf             68738753843307886263347887---23886666027-----516764210340377741686


No 6  
>PRK10218 GTP-binding protein; Provisional
Probab=100.00  E-value=0  Score=1101.55  Aligned_cols=535  Identities=28%  Similarity=0.470  Sum_probs=472.6

Q ss_pred             HHHCEEEEEECCCCCCHHHHHHHHHHHCCCCCCC-CCCCEEECCCHHHHHHCCEEEEEEEEEEEECCCCCEEEEEEEECC
Q ss_conf             5253179998013898778899999982980544-443113058677987195052327999974378843899996178
Q gi|254780321|r    8 LSRIRNFSIVAHIDHGKSTLADRFIQHCRGLTER-EMSSQVLDNMDIERERGITIKAQTVRLNYTSTDAKDYQLNLIDTP   86 (606)
Q Consensus         8 ~~~IRN~~IiaHvDhGKTTL~d~lL~~tg~i~~~-~~~~~vlD~~~~EreRGITIka~~~~~~~~~~~~~~y~iNlIDTP   86 (606)
                      +++|||||||||||||||||+||||++||++.++ +..+|+||+|++||||||||+|+++++.|     ++|+|||||||
T Consensus         2 ie~IRNiaIIAHvDhGKTTL~d~lL~~tG~~~~~~~~~~~~mD~~~~ErERGITI~a~~~~~~~-----~~~~iNiIDTP   76 (607)
T PRK10218          2 IEKLRNIAIIAHVDHGKTTLVDKLLQQSGTFDSRAETQERVMDSNDLEKERGITILAKNTAIKW-----NDYRINIVDTP   76 (607)
T ss_pred             CCCCCEEEEEECCCCCHHHHHHHHHHHHCCCCCCCCCHHHCCCCCHHHHHCCCEEEEEEEEEEE-----CCEEEEEECCC
T ss_conf             7544248999756889889999999972898644541120147868898759726230489960-----87899786599


Q ss_pred             CCCHHHHHHHHHHHHCCEEEEEEECCCCCCHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCCHHHHHHHHH-HHHHHH-
Q ss_conf             730027999999973026899998687886558999999997099679983267887532113388877555-322321-
Q gi|254780321|r   87 GHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQAIDNNHEIITVLNKADLPSADPDRVKKQIEETI-GISTED-  164 (606)
Q Consensus        87 GH~DF~~EV~r~l~a~dgaiLvVdA~~Gvq~QT~~~~~~A~~~~l~~I~viNKiD~~~A~~e~v~~ei~~~~-g~~~~~-  164 (606)
                      ||+||+|||+|+|+|||||||||||++||||||+++|++|+++||++|+||||||+|+|+|++|.+|++|+| ++++++ 
T Consensus        77 GH~DF~gEVeR~L~~~DGalLvVDA~eGv~pQT~~V~~~Al~~~l~~IvvINKiDr~~A~~~~V~~ei~dlfi~L~a~de  156 (607)
T PRK10218         77 GHADFGGEVERVMSMVDSVLLVVDAFDGPMPQTRFVTKKAFAYGLKPIVVINKVDRPGARPDWVVDQVFDLFVNLDATDE  156 (607)
T ss_pred             CCCCCHHHHHHHHHHCCEEEEEEECCCCCCHHHHHHHHHHHHCCCCEEEEECCCCCCCCCHHHHHHHHHHHHHCCCCCHH
T ss_conf             85430148897897668489999788786245899999999879975997216676655357899999988740498567


Q ss_pred             -----HHHHHHHCCC----------CCCHHHHHHHHHHHCCCCHHHHHCCCCCCCCCEEECCCCCEEEEEEECCCCCCCC
Q ss_conf             -----0001110022----------3200678776321000111122012331012101147572599998169873558
Q gi|254780321|r  165 -----ALLVSAKTGE----------GIPLLLERIVQQLPSPTSPEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKG  229 (606)
Q Consensus       165 -----ii~vSAktG~----------GV~~LLd~Iv~~iP~P~~~~~~~~Pl~alVfds~~D~~~G~I~~~RV~sG~lk~G  229 (606)
                           ++++||++|.          ++.+|||+|++++|+|.+  ++++||+|+||++|||+|+|+|+++||++|++++|
T Consensus       157 qld~Pi~~asa~~G~a~~~~~~~~~dl~pLldaIv~~IPaP~~--d~d~Plq~lV~~ldyD~YvGrI~igRV~sG~ik~G  234 (607)
T PRK10218        157 QLDFPIVYASALNGIAGLDHEDMAEDMTPLYQAIVDHVPAPDV--DLDGPFQMQISQLDYNSYVGVIGIGRIKRGKVKPN  234 (607)
T ss_pred             HHCCHHHHHHHHCCEECCCHHHHHHHCCHHHHHHHHHCCCCCC--CCCCCCCCEECCCCCCCCCCEEEEEEEECCEECCC
T ss_conf             7444355655406501268234333136088999854879899--98888410101123567676489999965748589


Q ss_pred             CEEEEECCCCCCCCCCCC---C-CCCCEEEEHHCCCCCHHHHHHCCCCCCCCCCCCEECCCCCCCCCCCCCCCCCCCEEE
Q ss_conf             458873355642101222---3-355412401012471233220110024444542000466785323645522221266
Q gi|254780321|r  230 QSIRLMGTNAKYQVERIG---I-LTPKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVVF  305 (606)
Q Consensus       230 d~I~~~~~g~~~~v~~ig---~-~~~~~~~v~~l~aGdVG~ii~gik~l~~~~vGDTl~~~~~p~~~~Lp~~~~~~P~v~  305 (606)
                      |+|.+++++.+++..+++   . .+.++.+++++.||||.    ++++++++.||||||++++|  +|||+++.++|+++
T Consensus       235 d~V~~~~~~g~~~~~kV~kl~~~~gl~r~ev~~a~AGDIV----AIaGl~d~~iGDTl~d~~~p--~~Lp~~~i~ePtvs  308 (607)
T PRK10218        235 QQVTIIDSEGKTRNAKVGKVLGHLGLERIETDLAEAGDIV----AITGLGELNISDTVCDTQNV--EALPALSVDEPTVS  308 (607)
T ss_pred             CEEEEECCCCEEEEEEEEEEEECCCCCCCCCCEECCEEEE----EEECCCCCCCCCEECCCCCC--CCCCCCCCCCCCCC
T ss_conf             8436632796388434679951157774005465240599----99423357777652157765--56766677899651


Q ss_pred             EEECCCCHHHH----------HHHHHHHHHHHHHCCCCCCCCCCCCCCCCEEEEEECCHHHHHHHHHHHHHHCCCEEEEE
Q ss_conf             42126770245----------78899998886411221112567600042028996376789888988866449506973
Q gi|254780321|r  306 CGLFPVDATQF----------ENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERLEREFSLNLIGT  375 (606)
Q Consensus       306 ~~i~p~~~~d~----------~~L~~aL~kL~~~D~sl~~e~Ets~aLg~Gfr~gglG~LHLeVi~eRL~rEfg~ev~~t  375 (606)
                      | .|++|+++|          .+++++|.|+.++|+||++++..+ +  .+|||||||+|||+|++|||||| |+|+++|
T Consensus       309 m-~f~vn~sPfaG~egk~~t~r~i~erL~ke~~~nvsl~vee~~~-~--~~f~v~grGeLHLeIliErmrRE-G~El~vs  383 (607)
T PRK10218        309 M-FFCVNTSPFCGKEGKFVTSRQILDRLNKELVHNVALRVEETED-A--DAFRVSGRGELHLSVLIENMRRE-GFELAVS  383 (607)
T ss_pred             E-EEECCCCCCCCCCCCCCCHHHHHHHHHHHHHHCCCEEEEECCC-C--CEEEEECCHHHHHHHHHHHHHHC-CCEEEEC
T ss_conf             5-7611687766644542038999999987653076268870688-8--64797044287899999998645-8479973


Q ss_pred             CCCCCEEEEEECCCEEECCCHHHCCCHHHHHHHHCCEEEEEEEECCCCCHHHHHHHHHHHHEEECCCCCC-CEEEEEEEE
Q ss_conf             7823303353156454126966625867788862326999998083100038999886300142443368-369999996
Q gi|254780321|r  376 SPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEYLGSILKLCQERRGIQIDMSHLD-NRAMIVYEL  454 (606)
Q Consensus       376 ~P~V~Ykv~~~dG~~~~Vd~p~~~p~~~~i~~i~EPi~~~~I~~P~ey~G~Vm~~l~~RRG~~~~m~~~~-~~~~i~~~v  454 (606)
                      +|+|+||  ..||+.                  +|||++++|++|+||+|+||++|++|||++.+|+|.+ +|++|+|++
T Consensus       384 ~P~Viyr--e~dG~~------------------~EP~e~~~I~vP~ey~G~Vme~l~~RrG~~~~M~~~~~grv~L~f~i  443 (607)
T PRK10218        384 RPKVIFR--EIDGRK------------------QEPYENVTLDVEEQHQGSVMQALGERKGDLKNMNPDGKGRVRLDYVI  443 (607)
T ss_pred             CCCEEEE--ECCCCC------------------CCCEEEEEEEECHHHHHHHHHHHHHHCCEEEEEEECCCCEEEEEEEC
T ss_conf             8836899--138946------------------18707999972625549999998851779975589899979999977


Q ss_pred             CHHHHHHHHHHHHHHHCCCEEEEEEEECCCEE---CCE--EEEEEEECCCCCCEEEEEEEHHHHHHHHHHHHHHHHHCCC
Q ss_conf             04333220468767635741888985435464---366--7974886288243568742157799999999999874087
Q gi|254780321|r  455 PLNEVIFDFYDRLKSVSKGYASFDYNVIDYRD---SDL--VKLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIP  529 (606)
Q Consensus       455 Pl~Eli~~f~~~LkS~T~G~as~~ye~~~Y~~---~dl--vk~~ilin~~~vdals~i~h~~~a~~~gr~~~~~L~~~ip  529 (606)
                      |+|+|| ||+++|+|+|+|+|+|++.|.+|+|   +++  ++.+.||+.+.                |.++.|+|..+++
T Consensus       444 PsRgLi-G~r~~~lt~TrG~g~~~~~f~~y~~~~~g~~~~r~~G~lis~~~----------------g~~t~yal~~lq~  506 (607)
T PRK10218        444 PSRGLI-GFRSEFMTMTSGTGLLYSTFSHYDDVRPGEVGQRQNGVLISNGQ----------------GKAVAFALFGLQD  506 (607)
T ss_pred             CCHHHC-CCHHHEEECCCCEEEEEECCCCCCCCCCCCCCCCCCEEEEECCC----------------CEEHHHHHHHHHH
T ss_conf             653543-87254042477418998602256778788756666513797577----------------6178987753875


Q ss_pred             HH-HCCCCCEEEECCEEEEEECCCCCCCCEEEEECCCCCCHHHHHHHHHHHHHHHHHHC-CCEECCHHHHHHHHCCCC
Q ss_conf             01-02002204564788974125642032032301777347877568988421787510-774458899999742468
Q gi|254780321|r  530 QQ-MFQIAIQAAIGGRIIARETVKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRF-GRVDIPQSAFISILKTDN  605 (606)
Q Consensus       530 rq-~F~v~iqa~~~~~iiare~i~~~rkdvt~kcygGd~trk~KLl~~qk~GKkrmk~~-g~v~ip~~af~~~l~~~~  605 (606)
                      |. +|.-|...+|+|||||.   +++.+|+.+|     ++|.|||+|+|++|+...-.+ --....-|-.++++..|+
T Consensus       507 rg~lfv~pg~~vy~GmivGe---~~r~~dl~vN-----~~k~k~ltn~r~~~~d~~~~l~p~~~~sle~~~~~i~~de  576 (607)
T PRK10218        507 RGKLFLGHGAEVYEGQIIGI---HSRSNDLTVN-----CLTGKKLTNMRASGTDEAVVLVPPIRMTLEQALEFIDDDE  576 (607)
T ss_pred             CCCEEECCCCCEECCEEEEE---ECCCCCCEEC-----CCCCCCCCCCCCCCCCCCCEECCCCCCCHHHHHHHCCCCE
T ss_conf             45367369996688758676---0786773244-----5545445255455766562017984079999985357775


No 7  
>COG1217 TypA Predicted membrane GTPase involved in stress response [Signal transduction mechanisms]
Probab=100.00  E-value=0  Score=963.29  Aligned_cols=514  Identities=32%  Similarity=0.519  Sum_probs=464.9

Q ss_pred             HHHCEEEEEECCCCCCHHHHHHHHHHHCCCCCCCC-CCCEEECCCHHHHHHCCEEEEEEEEEEEECCCCCEEEEEEEECC
Q ss_conf             52531799980138987788999999829805444-43113058677987195052327999974378843899996178
Q gi|254780321|r    8 LSRIRNFSIVAHIDHGKSTLADRFIQHCRGLTERE-MSSQVLDNMDIERERGITIKAQTVRLNYTSTDAKDYQLNLIDTP   86 (606)
Q Consensus         8 ~~~IRN~~IiaHvDhGKTTL~d~lL~~tg~i~~~~-~~~~vlD~~~~EreRGITIka~~~~~~~~~~~~~~y~iNlIDTP   86 (606)
                      +.+|||||||||||||||||+|+||.++|++.+++ ..+++||++++||||||||.|+++++.|     ++|+||++|||
T Consensus         2 ~~~iRNIAIIAHVDHGKTTLVD~LLkQSGtf~~~e~v~ERvMDSnDlEkERGITILaKnTav~~-----~~~~INIvDTP   76 (603)
T COG1217           2 MEDIRNIAIIAHVDHGKTTLVDALLKQSGTFREREEVAERVMDSNDLEKERGITILAKNTAVNY-----NGTRINIVDTP   76 (603)
T ss_pred             CCCCCEEEEEEEECCCCCHHHHHHHHHCCCCCCCCCHHHHHCCCCCHHHHCCCEEEECCCEEEC-----CCEEEEEECCC
T ss_conf             7665306899984488102899998731654456520144037642344349389851524620-----88389876589


Q ss_pred             CCCHHHHHHHHHHHHCCEEEEEEECCCCCCHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCCHHHHHHHHH-HHHH--H
Q ss_conf             730027999999973026899998687886558999999997099679983267887532113388877555-3223--2
Q gi|254780321|r   87 GHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQAIDNNHEIITVLNKADLPSADPDRVKKQIEETI-GIST--E  163 (606)
Q Consensus        87 GH~DF~~EV~r~l~a~dgaiLvVdA~~Gvq~QT~~~~~~A~~~~l~~I~viNKiD~~~A~~e~v~~ei~~~~-g~~~--~  163 (606)
                      ||+||+|||+|.|+|+||+||||||.+|+||||++++.+|+++||++|+||||||+|+|+|+||.+|++|+| ++.+  +
T Consensus        77 GHADFGGEVERvl~MVDgvlLlVDA~EGpMPQTrFVlkKAl~~gL~PIVVvNKiDrp~Arp~~Vvd~vfDLf~~L~A~de  156 (603)
T COG1217          77 GHADFGGEVERVLSMVDGVLLLVDASEGPMPQTRFVLKKALALGLKPIVVINKIDRPDARPDEVVDEVFDLFVELGATDE  156 (603)
T ss_pred             CCCCCCCHHHHHHHHCCEEEEEEECCCCCCCCHHHHHHHHHHCCCCCEEEEECCCCCCCCHHHHHHHHHHHHHHHCCCHH
T ss_conf             86776625451143233489999755588873144489999749984899967789998878999999999998199745


Q ss_pred             H----HHHHHHHCCC----------CCCHHHHHHHHHHHCCCCHHHHHCCCCCCCCCEEECCCCCEEEEEEECCCCCCCC
Q ss_conf             1----0001110022----------3200678776321000111122012331012101147572599998169873558
Q gi|254780321|r  164 D----ALLVSAKTGE----------GIPLLLERIVQQLPSPTSPEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKG  229 (606)
Q Consensus       164 ~----ii~vSAktG~----------GV~~LLd~Iv~~iP~P~~~~~~~~Pl~alVfds~~D~~~G~I~~~RV~sG~lk~G  229 (606)
                      +    ++|+||+.|.          .+++|+|+|++++|+|.+  +.++|||++|+...|++|+|+|.++||++|++|+|
T Consensus       157 QLdFPivYAS~~~G~a~~~~~~~~~~m~pLfe~I~~hvp~P~~--~~d~PlQ~qvt~Ldyn~y~GrIgigRi~~G~vk~~  234 (603)
T COG1217         157 QLDFPIVYASARNGTASLDPEDEADDMAPLFETILDHVPAPKG--DLDEPLQMQVTQLDYNSYVGRIGIGRIFRGTVKPN  234 (603)
T ss_pred             HCCCEEEEEECCCCEECCCCCCCCCCHHHHHHHHHHHCCCCCC--CCCCCEEEEEEEECCCCCCCEEEEEEEECCCCCCC
T ss_conf             5787079854147510158655555316899999975899989--99888078998522445452268999852725489


Q ss_pred             CEEEEECCCCC---CCCCCC-CCCCCCEEEEHHCCCCCHHHHHHCCCCCCCCCCCCEECCCCCCCCCCCCCCCCCCCEEE
Q ss_conf             45887335564---210122-23355412401012471233220110024444542000466785323645522221266
Q gi|254780321|r  230 QSIRLMGTNAK---YQVERI-GILTPKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVVF  305 (606)
Q Consensus       230 d~I~~~~~g~~---~~v~~i-g~~~~~~~~v~~l~aGdVG~ii~gik~l~~~~vGDTl~~~~~p~~~~Lp~~~~~~P~v~  305 (606)
                      |++.++..+.+   .+++++ ++++.++.+++++.||||    ..+.++.++.+|||+|++++|  +|||.+..++|+++
T Consensus       235 q~V~~i~~~g~~~~gri~kll~f~GL~R~ei~eA~AGDI----vaiaG~~~~~igdTi~d~~~~--~aLp~l~iDePTls  308 (603)
T COG1217         235 QQVALIKSDGTTENGRITKLLGFLGLERIEIEEAEAGDI----VAIAGLEDINIGDTICDPDNP--EALPALSVDEPTLS  308 (603)
T ss_pred             CEEEEECCCCCEEEEEEEEEEECCCEEEEEHHHCCCCCE----EEECCCCCCCCCCCCCCCCCC--CCCCCCCCCCCCEE
T ss_conf             768998479947755776665505423335001255678----998276435543413587776--67887336898468


Q ss_pred             EEECCCCHHHHH----------HHHHHHHHHHHHCCCCCCCCCCCCCCCCEEEEEECCHHHHHHHHHHHHHHCCCEEEEE
Q ss_conf             421267702457----------8899998886411221112567600042028996376789888988866449506973
Q gi|254780321|r  306 CGLFPVDATQFE----------NLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERLEREFSLNLIGT  375 (606)
Q Consensus       306 ~~i~p~~~~d~~----------~L~~aL~kL~~~D~sl~~e~Ets~aLg~Gfr~gglG~LHLeVi~eRL~rEfg~ev~~t  375 (606)
                      | .|.+|+|+|.          +++++|.|..+.+.||++|+..+..   .|+|||+|||||.|++|.|||| |+|+.++
T Consensus       309 M-tf~vN~SPfAG~EGk~vTSR~i~dRL~~El~~NValrVe~t~~pd---~f~VsGRGELhLsILiE~MRRE-GfEl~Vs  383 (603)
T COG1217         309 M-TFSVNDSPFAGKEGKFVTSRQIRDRLNKELETNVALRVEETESPD---AFEVSGRGELHLSILIENMRRE-GFELQVS  383 (603)
T ss_pred             E-EEEECCCCCCCCCCCEEEHHHHHHHHHHHHHHCEEEEEEECCCCC---EEEEECCCEEEHHHHHHHHHHC-CEEEEEC
T ss_conf             9-999568877776785655899999999876416359987369997---3798056444578888876423-4177725


Q ss_pred             CCCCCEEEEEECCCEEECCCHHHCCCHHHHHHHHCCEEEEEEEECCCCCHHHHHHHHHHHHEEECCCCCC-CEEEEEEEE
Q ss_conf             7823303353156454126966625867788862326999998083100038999886300142443368-369999996
Q gi|254780321|r  376 SPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEYLGSILKLCQERRGIQIDMSHLD-NRAMIVYEL  454 (606)
Q Consensus       376 ~P~V~Ykv~~~dG~~~~Vd~p~~~p~~~~i~~i~EPi~~~~I~~P~ey~G~Vm~~l~~RRG~~~~m~~~~-~~~~i~~~v  454 (606)
                      .|+|+||  ..||..                  +|||+.++|++|++|+|.||+.++.|+|++.+|.+.+ ||++++|.+
T Consensus       384 rP~Vi~k--eidG~~------------------~EP~E~v~iDv~ee~~G~Vie~lg~RKgem~~M~~~g~G~~Rlef~i  443 (603)
T COG1217         384 RPEVIIK--EIDGVK------------------CEPFEEVTIDVPEEHQGAVIEKLGERKGEMKDMAPDGKGRVRLEFVI  443 (603)
T ss_pred             CCEEEEE--ECCCCC------------------CCCCEEEEECCCHHHHHHHHHHHHHHHHHHHHCCCCCCCEEEEEEEC
T ss_conf             8659999--238846------------------68501378637423201899987653576751535899859999972


Q ss_pred             CHHHHHHHHHHHHHHHCCCEEEEEEEECCCEEC--CE--EEEEEEECCCCCCEEEEEEEHHHHHHHHHHHHHHHHHCCCH
Q ss_conf             043332204687676357418889854354643--66--79748862882435687421577999999999998740870
Q gi|254780321|r  455 PLNEVIFDFYDRLKSVSKGYASFDYNVIDYRDS--DL--VKLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQ  530 (606)
Q Consensus       455 Pl~Eli~~f~~~LkS~T~G~as~~ye~~~Y~~~--dl--vk~~ilin~~~vdals~i~h~~~a~~~gr~~~~~L~~~ipr  530 (606)
                      |.++|| ||+++|.|+|+|+|.+++.|++|+|-  ++  +++++||+.+.+.|.+                |+|.++++|
T Consensus       444 PaRGLI-GfrteFlt~TrG~Gi~n~~F~~Y~p~~g~i~~R~nGvLiS~~~G~a~~----------------yal~~lqdR  506 (603)
T COG1217         444 PARGLI-GFRTEFLTMTRGTGIMNHSFDHYRPVKGEIGGRHNGVLISNETGKAVA----------------YALFNLQDR  506 (603)
T ss_pred             CCCCEE-CCCHHEEECCCCCEEEEECCCCCCCCCCCCCCCCCCEEEECCCCCCHH----------------HHHHHHHHC
T ss_conf             476501-021110221456434321101345555654555451599768984347----------------655358753


Q ss_pred             H-HCCCCCEEEECCEEEEEECCCCCCCCEEEEECCCCCCHHHHHHHHHHHHHHHH
Q ss_conf             1-02002204564788974125642032032301777347877568988421787
Q gi|254780321|r  531 Q-MFQIAIQAAIGGRIIARETVKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRM  584 (606)
Q Consensus       531 q-~F~v~iqa~~~~~iiare~i~~~rkdvt~kcygGd~trk~KLl~~qk~GKkrm  584 (606)
                      . +|.-|.+.+|+||||+   +|++.+|+++||.     +.|||+|++++||.--
T Consensus       507 G~~Fi~pG~~vYeGmiiG---~hsR~nDL~VN~~-----k~K~LTN~Rasg~Dea  553 (603)
T COG1217         507 GKLFIEPGTKVYEGMIIG---EHSRDNDLTVNVL-----KGKKLTNMRASGKDEA  553 (603)
T ss_pred             CCEEECCCCCEEEEEEEE---EECCCCCCEECCC-----CCCCCCCCCCCCCCCC
T ss_conf             756645997265016985---3067567134242-----3442312104687622


No 8  
>PRK00007 elongation factor G; Reviewed
Probab=100.00  E-value=0  Score=904.87  Aligned_cols=467  Identities=31%  Similarity=0.483  Sum_probs=414.3

Q ss_pred             CCCCHHHCEEEEEECCCCCCHHHHHHHHHHHCCCCCCCC---CCCEEECCCHHHHHHCCEEEEEEEEEEEECCCCCEEEE
Q ss_conf             899852531799980138987788999999829805444---43113058677987195052327999974378843899
Q gi|254780321|r    4 KPTPLSRIRNFSIVAHIDHGKSTLADRFIQHCRGLTERE---MSSQVLDNMDIERERGITIKAQTVRLNYTSTDAKDYQL   80 (606)
Q Consensus         4 ~~~p~~~IRN~~IiaHvDhGKTTL~d~lL~~tg~i~~~~---~~~~vlD~~~~EreRGITIka~~~~~~~~~~~~~~y~i   80 (606)
                      +++|++|||||||+||+|||||||+|+||+.+|.+.+.+   .++++||++++||||||||+|+++++.|.    .+|+|
T Consensus         3 ~~~~ie~IRNi~IiaHvd~GKTTL~e~lL~~sg~i~~~G~v~~g~t~~D~~~~E~eRgITI~s~~~s~~~~----~~~~i   78 (693)
T PRK00007          3 RTTPLERYRNIGIMAHIDAGKTTTTERILFYTGVSHKIGEVHDGAATMDWMEQEQERGITITSAATTCFWK----DGHRI   78 (693)
T ss_pred             CCCCHHHCCEEEEECCCCCCHHHHHHHHHHHCCCCCCCCEECCCCCCCCCCHHHHHCCCCEEECEEEEEEC----CCEEE
T ss_conf             88966787099999169999899999999966984658424389855678288997698873222548826----97389


Q ss_pred             EEEECCCCCHHHHHHHHHHHHCCEEEEEEECCCCCCHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCCHHHHHHHHHHH
Q ss_conf             99617873002799999997302689999868788655899999999709967998326788753211338887755532
Q gi|254780321|r   81 NLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQAIDNNHEIITVLNKADLPSADPDRVKKQIEETIGI  160 (606)
Q Consensus        81 NlIDTPGH~DF~~EV~r~l~a~dgaiLvVdA~~Gvq~QT~~~~~~A~~~~l~~I~viNKiD~~~A~~e~v~~ei~~~~g~  160 (606)
                      ||||||||+||++||+|||++|||||+||||.+|||+||+.+|+.|.+.++|+|+||||||++.||++.+.++|.+.++.
T Consensus        79 NlIDTPGHvDF~~Ev~~aLrv~DgAvlVvDav~GV~~qT~~v~r~a~~~~lp~i~fINK~Dr~~ad~~~~l~~i~~~l~~  158 (693)
T PRK00007         79 NIIDTPGHVDFTIEVERSLRVLDGAVAVFCAVGGVEPQSETVWRQADKYKVPRIVFVNKMDRTGADFLRVVEQIKDRLGA  158 (693)
T ss_pred             EEEECCCCCCHHHHHHHHHHHHCEEEEEEECCCCCCHHHHHHHHHHHHCCCCEEEEEECCCCCCCCHHHHHHHHHHHHCC
T ss_conf             99919797524899999999858689999889887777999999998759896999979778999989999999998599


Q ss_pred             H-------------------------------------------------------------------------------
Q ss_conf             2-------------------------------------------------------------------------------
Q gi|254780321|r  161 S-------------------------------------------------------------------------------  161 (606)
Q Consensus       161 ~-------------------------------------------------------------------------------  161 (606)
                      .                                                                               
T Consensus       159 ~~~~~~~pi~~~~~f~g~vdl~~~~~~~~~~~~~g~~~~~~~~p~~~~~~~~~~r~~l~e~vae~dd~lle~yl~~~~~~  238 (693)
T PRK00007        159 NPVPIQLPIGAEDDFKGVVDLVKMKAIIWDDDDLGTTFEYEEIPADLKDKAEEYREKLVEAAAEADEELMEKYLEGEELT  238 (693)
T ss_pred             CEEEEEEEECCCCCCCCEEEEEEEEEEECCCCCCCCEEEEECCCHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHCCCCCC
T ss_conf             76899840024776433033000013321333468713770185899999999999999999854999999985578899


Q ss_pred             HH-------------H---HHHHHHHCCCCCCHHHHHHHHHHHCCCC------------------HHHHHCCCCCCCCCE
Q ss_conf             32-------------1---0001110022320067877632100011------------------112201233101210
Q gi|254780321|r  162 TE-------------D---ALLVSAKTGEGIPLLLERIVQQLPSPTS------------------PEGANAPLKALLIDS  207 (606)
Q Consensus       162 ~~-------------~---ii~vSAktG~GV~~LLd~Iv~~iP~P~~------------------~~~~~~Pl~alVfds  207 (606)
                      .+             +   ++++||.+|.||++|||+|++++|+|..                  ..++++||.|+|||+
T Consensus       239 ~~el~~~lr~~~~~~~~~Pv~~gsa~~~~Gv~~LLd~i~~~lPsP~e~~~~~~~~~~~~~~~~~~~~~~~~pl~a~vfK~  318 (693)
T PRK00007        239 EEEIKAALRKGTLANEIVPVLCGSAFKNKGVQPMLDAVVDYLPSPLDVPAIKGILPDGEEEEVERKASDDEPFSALAFKI  318 (693)
T ss_pred             HHHHHHHHHHHHHHCCEEEHHCCCCCCCCCHHHHHHHHHHHCCCCCCCCCEECCCCCCCCCEEEECCCCCCCCEEEEEEE
T ss_conf             99999999998872765661026543487899999999986799212565002068987403564269877714687556


Q ss_pred             EECCCCCEEEEEEECCCCCCCCCEEEEECCCCCCCCCCCCCCCC-CEEEEHHCCCCCHHHHHHCCCCCCCCCCCCEECCC
Q ss_conf             11475725999981698735584588733556421012223355-41240101247123322011002444454200046
Q gi|254780321|r  208 WYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVERIGILTP-KMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDD  286 (606)
Q Consensus       208 ~~D~~~G~I~~~RV~sG~lk~Gd~I~~~~~g~~~~v~~ig~~~~-~~~~v~~l~aGdVG~ii~gik~l~~~~vGDTl~~~  286 (606)
                      ..|||.|+++|+|||||+|+.||.|++...++++++.+++.+.+ ++.+++++.||||+.+    .+++++.+|||||++
T Consensus       319 ~~dp~~G~ls~~RV~SGtl~~g~~v~n~~~~~~e~i~~l~~~~g~~~~~v~~~~AGdIvai----~gL~~~~tgdTl~~~  394 (693)
T PRK00007        319 MTDPFVGKLTFFRVYSGVLNSGSYVLNSTKGKKERIGRILQMHANKREEIKEVRAGDIAAA----VGLKDTTTGDTLCDP  394 (693)
T ss_pred             EECCCCCCEEEEEECCCCCCCCCEEECCCCCCCCCCCCEEEEECCCCCEEEEECCCCEEEE----ECCCCEEECCCCCCC
T ss_conf             7748998268898225723689863146543211356338985588516007727964898----533430525531476


Q ss_pred             CCCCCCCCCCCCCCCCEEEEEECCCCHHHHHHHHHHHHHHHHHCCCCCCC--CCCCCCCCCEEEEEECCHHHHHHHHHHH
Q ss_conf             67853236455222212664212677024578899998886411221112--5676000420289963767898889888
Q gi|254780321|r  287 SSPTTSALPGFKPIQPVVFCGLFPVDATQFENLRTAINKLRLNDASFSFE--LENSTALGFGFRCGFLGLLHLEIIQERL  364 (606)
Q Consensus       287 ~~p~~~~Lp~~~~~~P~v~~~i~p~~~~d~~~L~~aL~kL~~~D~sl~~e--~Ets~aLg~Gfr~gglG~LHLeVi~eRL  364 (606)
                      +++.  .++.+.+|+|+++++++|.+++|.++|.++|.||..+||+|+++  +||++.+     ++|+|||||||+++||
T Consensus       395 ~~~~--~l~~~~~p~Pv~~~aieP~~~~d~~kL~~aL~~L~~eDPsl~v~~~eetge~v-----l~g~GElHLei~~~rL  467 (693)
T PRK00007        395 DNPI--ILERMEFPEPVISVAVEPKTKADQEKMGIALGKLAEEDPSFRVSTDEESGQTI-----IAGMGELHLDIIVDRM  467 (693)
T ss_pred             CCCC--CCCCCCCCCCCCEEEEECCCHHHHHHHHHHHHHHHHHCCEEEEEEECCCCCEE-----EECCCHHHHHHHHHHH
T ss_conf             7765--34544589864316885497677999999999878449738999907887189-----9857899999999999


Q ss_pred             HHHCCCEEEEECCCCCEE--------------------------------------------------------------
Q ss_conf             664495069737823303--------------------------------------------------------------
Q gi|254780321|r  365 EREFSLNLIGTSPSVVYE--------------------------------------------------------------  382 (606)
Q Consensus       365 ~rEfg~ev~~t~P~V~Yk--------------------------------------------------------------  382 (606)
                      +|+||+|+.++.|.|+||                                                              
T Consensus       468 ~~~f~vev~~~~P~V~yrETI~~~~~~~~~~~kqsgg~gq~~~v~i~~eP~~~g~g~~f~~~i~gg~ip~~~~~av~~G~  547 (693)
T PRK00007        468 KREFKVEANVGKPQVAYRETIRKSVEVEGKFKKQSGGRGQYGHVVIELEPLEPGKGYEFENKIVGGVVPKEYIPAVDKGI  547 (693)
T ss_pred             HHHHCCCEEECCCCEEEEEEECCCCEEEEEEEEECCCCCCEEEEEEEEECCCCCCCCEEEECCCCCCCCHHHHHHHHHHH
T ss_conf             87709834604882368987426410257998852887726799999953888978557302456767788878899999


Q ss_pred             ------------------EEEECCCEEECCC-HHHCCCHHHHH----------HHHCCEEEEEEEECCCCCHHHHHHHHH
Q ss_conf             ------------------3531564541269-66625867788----------862326999998083100038999886
Q gi|254780321|r  383 ------------------LYMHDGSMQKLSN-PIDMPEVTKIA----------ELREPWIQVTIITPNEYLGSILKLCQE  433 (606)
Q Consensus       383 ------------------v~~~dG~~~~Vd~-p~~~p~~~~i~----------~i~EPi~~~~I~~P~ey~G~Vm~~l~~  433 (606)
                                        +++.||++|.||| +..|.-++..+          .++|||+.++|.||++|+|+||++|++
T Consensus       548 ~~a~~~GpL~g~pv~~vkv~l~dg~~h~vds~~~af~~A~~~a~~~a~~~a~p~LlEPi~~veI~~p~~~~G~V~~dL~~  627 (693)
T PRK00007        548 QEAMKSGVLAGYPVVDVKVTLFDGSYHDVDSSEMAFKIAGSMAFKEAAKKANPVLLEPIMKVEVVTPEDYMGDVIGDLNS  627 (693)
T ss_pred             HHHHHHCCCCCCCEEEEEEEEECCCCCCCCCCHHHHHHHHHHHHHHHHHHCCCEEECCCEEEEEEECHHHHHHHHHHHHH
T ss_conf             99997098257854315999980675578874689999999999999986698897683799999488998999999987


Q ss_pred             HHHEEECCCCCCCEEEEEEEECHHHHHHHHHHHHHHHCCCEEEEEEEECCCEE
Q ss_conf             30014244336836999999604333220468767635741888985435464
Q gi|254780321|r  434 RRGIQIDMSHLDNRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDYRD  486 (606)
Q Consensus       434 RRG~~~~m~~~~~~~~i~~~vPl~Eli~~f~~~LkS~T~G~as~~ye~~~Y~~  486 (606)
                      |||++.+|+..++...+.+.+|++|+ +||.++|+|+|+|+|+|+++|+||++
T Consensus       628 RRG~i~~~~~~~~~~~I~a~vP~~E~-~gy~~~LRs~T~G~g~~~~~F~~y~~  679 (693)
T PRK00007        628 RRGQIQGMEDRGGAKVIRAEVPLSEM-FGYATDLRSMTQGRATYSMEFDHYEE  679 (693)
T ss_pred             CCCEEECEEECCCCEEEEEEECHHHH-HCHHHHHHHHCCCCEEEEEEECCCCC
T ss_conf             69887462633990999999887886-28579978538893589999486643


No 9  
>PRK13351 elongation factor G; Reviewed
Probab=100.00  E-value=0  Score=860.96  Aligned_cols=466  Identities=32%  Similarity=0.468  Sum_probs=409.4

Q ss_pred             CCCHHHCEEEEEECCCCCCHHHHHHHHHHHCCCCCCCC---CCCEEECCCHHHHHHCCEEEEEEEEEEEECCCCCEEEEE
Q ss_conf             99852531799980138987788999999829805444---431130586779871950523279999743788438999
Q gi|254780321|r    5 PTPLSRIRNFSIVAHIDHGKSTLADRFIQHCRGLTERE---MSSQVLDNMDIERERGITIKAQTVRLNYTSTDAKDYQLN   81 (606)
Q Consensus         5 ~~p~~~IRN~~IiaHvDhGKTTL~d~lL~~tg~i~~~~---~~~~vlD~~~~EreRGITIka~~~~~~~~~~~~~~y~iN   81 (606)
                      .+|+++|||||||||+|||||||+|+||+.+|.+++++   .++++||++++||||||||||+.+++.|     ++|+||
T Consensus         2 ~~~~e~IRNi~IiaHvd~GKTTL~d~Ll~~~g~i~~~g~v~~g~t~~D~~~~E~eRgITikss~~sl~~-----~~~~iN   76 (687)
T PRK13351          2 EMPLMQIRNIGIMAHIDAGKTTLTERILFYTGKIHKMGSVEDGNTVSDWMPQEQERGISIESAAATCDW-----KNHRIN   76 (687)
T ss_pred             CCCHHHCCEEEEECCCCCCHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCHHHHHCCCCEEEEEEEEEE-----CCEEEE
T ss_conf             998689308999917998989999999997499875871547874478829999749877621599988-----998999


Q ss_pred             EEECCCCCHHHHHHHHHHHHCCEEEEEEECCCCCCHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCCHHHHHHHHHHHH
Q ss_conf             96178730027999999973026899998687886558999999997099679983267887532113388877555322
Q gi|254780321|r   82 LIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQAIDNNHEIITVLNKADLPSADPDRVKKQIEETIGIS  161 (606)
Q Consensus        82 lIDTPGH~DF~~EV~r~l~a~dgaiLvVdA~~Gvq~QT~~~~~~A~~~~l~~I~viNKiD~~~A~~e~v~~ei~~~~g~~  161 (606)
                      |||||||+||++||++||++|||||+||||.+|||+||+.+|+.|.+.++|+|+|||||||..++++.+.+++++.++..
T Consensus        77 lIDTPGHvDF~~Ev~~aLr~~DgallVVDaveGv~~qT~~v~r~a~~~~lp~il~iNK~DR~~~d~~~~l~~i~~~l~~~  156 (687)
T PRK13351         77 LIDTPGHIDFTGEVERSLRVLDGAVVVIDAVTGVQPQTETVWEQADKYKIPRLIFINKMDRVGADLFDVLEDIEEKFGKR  156 (687)
T ss_pred             EEECCCCCCHHHHHHHHHHHHCEEEEEEECCCCCCHHHHHHHHHHHHCCCCEEEEEECCCCCCCCHHHHHHHHHHHHCCC
T ss_conf             98097974309999999998786899997899986889999999998799859999797789987667788999984896


Q ss_pred             H-------------------------------------------------------------------------------
Q ss_conf             3-------------------------------------------------------------------------------
Q gi|254780321|r  162 T-------------------------------------------------------------------------------  162 (606)
Q Consensus       162 ~-------------------------------------------------------------------------------  162 (606)
                      +                                                                               
T Consensus       157 ~~~~~~p~~~~~~~~~~id~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~e~~~~~dd~lle~~l~~~~~~~  236 (687)
T PRK13351        157 PLPLQLPIGSGDSFEGVVDLITEKELHFKEGDGGDTVEERPIPEELLEEVASAREKLIDALLEFDDELLELYLEGEEITA  236 (687)
T ss_pred             EEEEEECCCCCCCCCCEEEECCCHHHCCCCCCCCCEEEECCCCHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHCCCCCCH
T ss_conf             47786001356555641663110122002455685057725628889999999999999998308999999874887889


Q ss_pred             -------------HH---HHHHHHHCCCCCCHHHHHHHHHHHCCCC----------------HHHHHCCCCCCCCCEEEC
Q ss_conf             -------------21---0001110022320067877632100011----------------112201233101210114
Q gi|254780321|r  163 -------------ED---ALLVSAKTGEGIPLLLERIVQQLPSPTS----------------PEGANAPLKALLIDSWYN  210 (606)
Q Consensus       163 -------------~~---ii~vSAktG~GV~~LLd~Iv~~iP~P~~----------------~~~~~~Pl~alVfds~~D  210 (606)
                                   .+   ++..||+++.||++|||+|++++|+|..                ..++++|+.|+|||+++|
T Consensus       237 ~~l~~~l~~~~~~~~~~Pv~~gsa~~~~Gv~~LLd~i~~~lPsP~e~~~~~~~~~~~~~~~~~~~~~~p~~a~V~K~~~~  316 (687)
T PRK13351        237 EQLRAPFRRGLRSGHLVPVLFGSALKNIGIRPLLDAVVEYLPSPLEGNPPAGSKGTEKKVLVNPDPEKPLLALVFKVQYD  316 (687)
T ss_pred             HHHHHHHHHHHHHCCCCHHHCCCCCCCCCHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCEEEEEEEEEEC
T ss_conf             99999999999848724123030335878588999998708992103454565666640014579998708999997874


Q ss_pred             CCCCEEEEEEECCCCCCCCCEEEEECCCCCCCCCCCCCCCC-CEEEEHHCCCCCHHHHHHCCCCCCCCCCCCEECCCCCC
Q ss_conf             75725999981698735584588733556421012223355-41240101247123322011002444454200046678
Q gi|254780321|r  211 SYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVERIGILTP-KMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSP  289 (606)
Q Consensus       211 ~~~G~I~~~RV~sG~lk~Gd~I~~~~~g~~~~v~~ig~~~~-~~~~v~~l~aGdVG~ii~gik~l~~~~vGDTl~~~~~p  289 (606)
                      |+.|+++|+||+||+|++||+|++.++++.+++.+++.+.+ +..+++++.||+|+    ++.+++++.+|||||+..++
T Consensus       317 ~~~g~~s~~RV~sGtL~~g~~v~~~~~~~~e~i~~l~~~~g~~~~~v~~~~aG~Iv----~i~gl~~~~~g~tl~~~~~~  392 (687)
T PRK13351        317 PYAGKLTYLRVYQGTLRSGSQLYNGSGRKREKVGRIFRLQGNKREEVDEAKAGDIV----AVAGLKELETGDTLHDEEGN  392 (687)
T ss_pred             CCCCEEEEEEEECCEECCCCEEEECCCCCEEEECCEEEECCCCCCCCCEECCCCEE----EEECCCCCCCCCEECCCCCC
T ss_conf             88975899998534545798776348983599676146426775414886779889----99587647568870589987


Q ss_pred             CCCCCCCCCCCCCEEEEEECCCCHHHHHHHHHHHHHHHHHCCCCCCC--CCCCCCCCCEEEEEECCHHHHHHHHHHHHHH
Q ss_conf             53236455222212664212677024578899998886411221112--5676000420289963767898889888664
Q gi|254780321|r  290 TTSALPGFKPIQPVVFCGLFPVDATQFENLRTAINKLRLNDASFSFE--LENSTALGFGFRCGFLGLLHLEIIQERLERE  367 (606)
Q Consensus       290 ~~~~Lp~~~~~~P~v~~~i~p~~~~d~~~L~~aL~kL~~~D~sl~~e--~Ets~aLg~Gfr~gglG~LHLeVi~eRL~rE  367 (606)
                      .  +++.+..|+|+++++++|.+++|.++|.+||.+|..+||+|+++  +||++.+     ++|+||||||++++||+++
T Consensus       393 ~--~~~~~~~~~Pv~~vaieP~~~~d~~kL~~aL~~L~~eDPsl~v~~~eetge~v-----i~g~GElHLe~~l~~L~~~  465 (687)
T PRK13351        393 V--HLEPLTFPEPVFSLAVEPERRGDEQKLAEALEKLVWEDPTLRVEEDEETGQTI-----LSGMGELHLEIALERLRRE  465 (687)
T ss_pred             C--CCCCCCCCCCCEEEEEEECCHHHHHHHHHHHHHHHHHCCCEEEEECCCCEEEE-----EECCCHHHHHHHHHHHHHH
T ss_conf             5--68999999985167688678136889999999998539837999837541887-----6588899999999988887


Q ss_pred             CCCEEEEECCCCCEEEEEE-------------------------------------------------------------
Q ss_conf             4950697378233033531-------------------------------------------------------------
Q gi|254780321|r  368 FSLNLIGTSPSVVYELYMH-------------------------------------------------------------  386 (606)
Q Consensus       368 fg~ev~~t~P~V~Ykv~~~-------------------------------------------------------------  386 (606)
                      |++++.++.|.|+||.|+.                                                             
T Consensus       466 f~vev~vs~p~V~yrETi~~~~~~~~~~~k~~~~~~~~~~v~l~~eP~~~g~g~~~~~~~~~g~~~~~~~~aI~~G~~~a  545 (687)
T PRK13351        466 FKLEVNTGKPQVAYRETIRKMAEGVYRHKKQFGGKGQFGEVHLRVEPLERGAGFEFVSKVVGGAVPEELIPAVEKGIREA  545 (687)
T ss_pred             HCCCEEEECCCCEEEEEECCCCCCCEEEEEECCCCCCCEEEEEEECCCCCCCCCEEECCCCCCCCCHHHHHHHHHHHHHH
T ss_conf             19845852883027864025642222576504887632279999724667875088146568868566778999999999


Q ss_pred             -------------------CCCEEECCC-HHHCCCHHHHH----------HHHCCEEEEEEEECCCCCHHHHHHHHHHHH
Q ss_conf             -------------------564541269-66625867788----------862326999998083100038999886300
Q gi|254780321|r  387 -------------------DGSMQKLSN-PIDMPEVTKIA----------ELREPWIQVTIITPNEYLGSILKLCQERRG  436 (606)
Q Consensus       387 -------------------dG~~~~Vd~-p~~~p~~~~i~----------~i~EPi~~~~I~~P~ey~G~Vm~~l~~RRG  436 (606)
                                         ||++|.+++ +..|-.+...+          .++|||++++|.||++|+|+||++|++|||
T Consensus       546 ~~~GpL~g~pv~~v~v~l~d~~~~~~~~~~~~~~~a~~~a~~~a~~~a~p~LlEPi~~~eI~~p~~~~g~V~~~L~~RRG  625 (687)
T PRK13351        546 LASGPLAGYPVTDLRVTVLDGKYHSVDSSESAFVKAARKAFLEAVRKANPVLLEPIMELEITVPTEHVGDVLGDLSQRRG  625 (687)
T ss_pred             HHCCCCCCCCEEEEEEEEEECCCCCCCCCHHHHHHHHHHHHHHHHHHCCCEEECCEEEEEEEECHHHHHHHHHHHHHCCC
T ss_conf             96396689952506999982687888887678999999999999985698897782899999688999999999986698


Q ss_pred             EEECCCCCC-CEEEEEEEECHHHHHHHHHHHHHHHCCCEEEEEEEECCCEEC
Q ss_conf             142443368-369999996043332204687676357418889854354643
Q gi|254780321|r  437 IQIDMSHLD-NRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDYRDS  487 (606)
Q Consensus       437 ~~~~m~~~~-~~~~i~~~vPl~Eli~~f~~~LkS~T~G~as~~ye~~~Y~~~  487 (606)
                      ++.+++..+ +...+.+.+|++|+ +||.++|+|+|+|+|+|.++|+||++.
T Consensus       626 ~i~~~~~~~~~~~~I~a~vPv~e~-~g~~~~LRs~T~G~a~~~~~F~~~e~v  676 (687)
T PRK13351        626 KIHGTEPIGDGKVLVKAEAPLAEL-FGYATRLRSMTKGRGSFTMEFSHFDPV  676 (687)
T ss_pred             EEECCEECCCCEEEEEEEECHHHH-HCHHHHHHHCCCCCEEEEEEECCCCCC
T ss_conf             886727459976999999886786-086687463088836999995755239


No 10 
>PRK12740 elongation factor G; Reviewed
Probab=100.00  E-value=0  Score=854.40  Aligned_cols=454  Identities=31%  Similarity=0.485  Sum_probs=403.0

Q ss_pred             ECCCCCCHHHHHHHHHHHCCCCCCC---CCCCEEECCCHHHHHHCCEEEEEEEEEEEECCCCCEEEEEEEECCCCCHHHH
Q ss_conf             8013898778899999982980544---4431130586779871950523279999743788438999961787300279
Q gi|254780321|r   17 VAHIDHGKSTLADRFIQHCRGLTER---EMSSQVLDNMDIERERGITIKAQTVRLNYTSTDAKDYQLNLIDTPGHVDFTY   93 (606)
Q Consensus        17 iaHvDhGKTTL~d~lL~~tg~i~~~---~~~~~vlD~~~~EreRGITIka~~~~~~~~~~~~~~y~iNlIDTPGH~DF~~   93 (606)
                      |||+|||||||+|+||+.+|.+++.   +.++++||++++||||||||+|+.+++.|     ++|+|||||||||+||++
T Consensus         1 iaHvd~GKTTL~e~lL~~sg~i~~~G~v~~g~t~~D~~~~E~eRgITI~ss~~s~~~-----~~~~iNlIDTPGHvDF~~   75 (670)
T PRK12740          1 VGHSGAGKTTLTEAILFYTGAIHRIGEVEDGTTTMDFMPEERERGISIQSAATTCEW-----KGHKINIIDTPGHVDFTG   75 (670)
T ss_pred             CCCCCCCHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCHHHHHCCCCEEEEEEEEEE-----CCEEEEEEECCCCCCHHH
T ss_conf             989988888999999996599875761438971467809999739973221388988-----998999992979751489


Q ss_pred             HHHHHHHHCCEEEEEEECCCCCCHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCCHHHHHHHHHHHH------------
Q ss_conf             99999973026899998687886558999999997099679983267887532113388877555322------------
Q gi|254780321|r   94 EVSRSLSACEGSLLVVDATQGVEAQTLANVYQAIDNNHEIITVLNKADLPSADPDRVKKQIEETIGIS------------  161 (606)
Q Consensus        94 EV~r~l~a~dgaiLvVdA~~Gvq~QT~~~~~~A~~~~l~~I~viNKiD~~~A~~e~v~~ei~~~~g~~------------  161 (606)
                      ||+|||++|||||+||||++|||+||+.+|+.|.+.++|+|+|||||||+.|+++++.+++++.++..            
T Consensus        76 EV~~aLrv~DgAvlvVDaveGV~~qT~~v~r~a~~~~lp~ilvINKiDr~~a~~~~~l~~i~~~l~~~~~~~~~Pi~~~~  155 (670)
T PRK12740         76 EVERALRVLDGAVVVVCAVGGVEVQTETVWRYAEEYGVPRIAFVNKLDRAGADFRRVLAQLQEALGAPVVPLQLPIGEGD  155 (670)
T ss_pred             HHHHHHHHHCEEEEEEECCCCCCHHHHHHHHHHHHCCCCEEEEEECCCCCCCCHHHHHHHHHHHHCCCCEEEEEEECCCC
T ss_conf             99999998686899997899973789999999998799969999797899999899999999984898357985504788


Q ss_pred             -----------------------------------------------------------------HHH------------
Q ss_conf             -----------------------------------------------------------------321------------
Q gi|254780321|r  162 -----------------------------------------------------------------TED------------  164 (606)
Q Consensus       162 -----------------------------------------------------------------~~~------------  164 (606)
                                                                                       .++            
T Consensus       156 ~f~g~iDl~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~r~~lle~i~e~dd~lle~yl~~~~~~~~~l~~~l~~~~~~~  235 (670)
T PRK12740        156 DFKGVVDLLSMKAYRYDDEGGPSEEIEIPAELLDRAEEAREELLEALAEFDDELMEKYLEGEEPSEEEIKAGLRKGTRAG  235 (670)
T ss_pred             CEEEEEECCCCEEEEECCCCCCEEECCCCHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHCCCCCCHHHHHHHHHHHHHHC
T ss_conf             44578522035689982789943772387889999999999999998742599999987679999999999999999709


Q ss_pred             ----HHHHHHHCCCCCCHHHHHHHHHHHCCCC----------------HHHHHCCCCCCCCCEEECCCCCEEEEEEECCC
Q ss_conf             ----0001110022320067877632100011----------------11220123310121011475725999981698
Q gi|254780321|r  165 ----ALLVSAKTGEGIPLLLERIVQQLPSPTS----------------PEGANAPLKALLIDSWYNSYLGVMVLVRIING  224 (606)
Q Consensus       165 ----ii~vSAktG~GV~~LLd~Iv~~iP~P~~----------------~~~~~~Pl~alVfds~~D~~~G~I~~~RV~sG  224 (606)
                          ++++||++|.||++|||+|++++|+|..                ..++++||.|+|||+++|||.|+++|+||+||
T Consensus       236 ~~~Pv~~gSa~~~~Gv~~LLd~I~~~lPsP~e~~~~~~~~~~~~~~~~~~d~~~p~~a~VfK~~~d~~~G~i~~~RV~sG  315 (670)
T PRK12740        236 SIVPVFCGSALKNKGVQRLLDAVVDYLPSPTEVPPRLGTDGEDEEPVLAPDPDGPLSALVFKTMDDPFVGKLSLVRVYSG  315 (670)
T ss_pred             CEEEEEECCCCCCCCHHHHHHHHHHHCCCHHHCCCCCCCCCCCCCCCCCCCCCCCEEEEEEEEEECCCCCEEEEEEEECC
T ss_conf             75789862543577889999999987899254254114477776321457999982899998478588974899998366


Q ss_pred             CCCCCCEEEEECCCCCCCCCCCCCCCC-CEEEEHHCCCCCHHHHHHCCCCCCCCCCCCEECCCCCCCCCCCCCCCCCCCE
Q ss_conf             735584588733556421012223355-4124010124712332201100244445420004667853236455222212
Q gi|254780321|r  225 QLTKGQSIRLMGTNAKYQVERIGILTP-KMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPV  303 (606)
Q Consensus       225 ~lk~Gd~I~~~~~g~~~~v~~ig~~~~-~~~~v~~l~aGdVG~ii~gik~l~~~~vGDTl~~~~~p~~~~Lp~~~~~~P~  303 (606)
                      +|++||+|++.+++++.++.+++.+.+ +..+++++.||||+.    +.+++++++|||||+.+.+.  +++.+.+|+|+
T Consensus       316 ~L~~g~~v~~~~~~~~eki~~l~~~~g~~~~~v~~~~aG~Iv~----i~gl~~~~tgdTL~~~~~~~--~~~~~~~~~Pv  389 (670)
T PRK12740        316 TLKKGDTLLNSTTGKKERVGRLYRMHGKQQEEIDEAVAGDIVA----VVKLKEAATGDTLCDKGDPI--LLEPMEFPEPV  389 (670)
T ss_pred             EECCCCEEEECCCCCEEEEEEEEEECCCCCEEEEEEECCCEEE----EECCCCCCCCCEECCCCCCC--CCCCCCCCCCC
T ss_conf             7558998983587515871235787157624889980597899----84566663588610788776--56777789986


Q ss_pred             EEEEECCCCHHHHHHHHHHHHHHHHHCCCCCCC--CCCCCCCCCEEEEEECCHHHHHHHHHHHHHHCCCEEEEECCCCCE
Q ss_conf             664212677024578899998886411221112--567600042028996376789888988866449506973782330
Q gi|254780321|r  304 VFCGLFPVDATQFENLRTAINKLRLNDASFSFE--LENSTALGFGFRCGFLGLLHLEIIQERLEREFSLNLIGTSPSVVY  381 (606)
Q Consensus       304 v~~~i~p~~~~d~~~L~~aL~kL~~~D~sl~~e--~Ets~aLg~Gfr~gglG~LHLeVi~eRL~rEfg~ev~~t~P~V~Y  381 (606)
                      ++++++|.|.+|.++|.++|.||..+||||+++  +||++.+     ++|+|||||||+++||+|+||+++.++.|.|+|
T Consensus       390 ~~vaieP~~~~d~~kL~~~L~~L~~eDPsl~v~~~~etge~v-----l~g~GElHLei~l~~Lr~~f~iev~~s~P~V~y  464 (670)
T PRK12740        390 ISLAIEPKDKGDEEKLSEALGRLAEEDPTLRVEQDEETGETI-----LSGMGELHLEVALERLKRKYGVEVETGPPQVPY  464 (670)
T ss_pred             CEEEEEECCHHHHHHHHHHHHHHHHHCCCEEEEECCCCCEEE-----EECCCHHHHHHHHHHHHHHHCCEEEEECCCEEE
T ss_conf             306888578217999999999777418955999817771279-----983798999999999989869669983683468


Q ss_pred             EEEE----------------------------------------------------------------------------
Q ss_conf             3353----------------------------------------------------------------------------
Q gi|254780321|r  382 ELYM----------------------------------------------------------------------------  385 (606)
Q Consensus       382 kv~~----------------------------------------------------------------------------  385 (606)
                      |.|.                                                                            
T Consensus       465 rETi~~~~~~~~~~kkqsgg~gq~~~v~~~~eP~~~g~g~~f~~~i~gg~ip~~~~~ai~~G~~~a~~~GpL~g~pv~~v  544 (670)
T PRK12740        465 RETIRKAAEGHGRHKKQSGGHGQFGDVWLEIEPLPRGSGFEFVDKVVGGAVPRQYIPAVEKGVREALEKGVLAGFPVVDV  544 (670)
T ss_pred             EEEECCCCCCCCEEEEECCCCCCEEEEEEEEEECCCCCCCEEEEEECCCCCCHHHHHHHHHHHHHHHHHCCCCCCCEEEE
T ss_conf             99841441244057774178640458999973578887747987403885678889999989999997297578965335


Q ss_pred             ----ECCCEEECCC-HHHCCCHHHHH----------HHHCCEEEEEEEECCCCCHHHHHHHHHHHHEEECCCCCCCEEEE
Q ss_conf             ----1564541269-66625867788----------86232699999808310003899988630014244336836999
Q gi|254780321|r  386 ----HDGSMQKLSN-PIDMPEVTKIA----------ELREPWIQVTIITPNEYLGSILKLCQERRGIQIDMSHLDNRAMI  450 (606)
Q Consensus       386 ----~dG~~~~Vd~-p~~~p~~~~i~----------~i~EPi~~~~I~~P~ey~G~Vm~~l~~RRG~~~~m~~~~~~~~i  450 (606)
                          .||++|.||| +..|..+...+          .++|||++++|.||++|+|+||++|++|||++.+|++.++++.|
T Consensus       545 ~v~l~dg~~h~vdSs~~af~~A~~~a~~~a~~~a~p~LlEPi~~~eI~~p~~~~g~V~~~L~~RRG~i~~~~~~~g~~~I  624 (670)
T PRK12740        545 KVTLTDGSYHSVDSSEMAFKIAARLAFREAMPKAKPVLLEPIMRVEVSVPEEFVGDVIGDLSGRRGQILGMEAEGGWDVV  624 (670)
T ss_pred             EEEEEECCCCCCCCCHHHHHHHHHHHHHHHHHHCCCEEECCCEEEEEEECHHHHHHHHHHHHHCCCEEECEEECCCEEEE
T ss_conf             99998467157787378999999999999998669889768189999978899999999998769887573742995999


Q ss_pred             EEEECHHHHHHHHHHHHHHHCCCEEEEEEEECCCEEC
Q ss_conf             9996043332204687676357418889854354643
Q gi|254780321|r  451 VYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDYRDS  487 (606)
Q Consensus       451 ~~~vPl~Eli~~f~~~LkS~T~G~as~~ye~~~Y~~~  487 (606)
                      .+.+|++|+ +||.++|||+|+|+|+|+++|+||++-
T Consensus       625 ~a~vP~~e~-~g~~~~LRs~T~G~a~~~~~f~~y~~v  660 (670)
T PRK12740        625 RAEVPLAEM-FGYATDLRSLTQGRGSFTMEFSHYEEV  660 (670)
T ss_pred             EEEECHHHH-HCHHHHHHHHCCCCEEEEEEECCCEEC
T ss_conf             999887886-167898674288846899994873268


No 11 
>PRK12739 elongation factor G; Reviewed
Probab=100.00  E-value=0  Score=849.27  Aligned_cols=466  Identities=31%  Similarity=0.505  Sum_probs=409.5

Q ss_pred             CCCCHHHCEEEEEECCCCCCHHHHHHHHHHHCCCCCCC---CCCCEEECCCHHHHHHCCEEEEEEEEEEEECCCCCEEEE
Q ss_conf             89985253179998013898778899999982980544---443113058677987195052327999974378843899
Q gi|254780321|r    4 KPTPLSRIRNFSIVAHIDHGKSTLADRFIQHCRGLTER---EMSSQVLDNMDIERERGITIKAQTVRLNYTSTDAKDYQL   80 (606)
Q Consensus         4 ~~~p~~~IRN~~IiaHvDhGKTTL~d~lL~~tg~i~~~---~~~~~vlD~~~~EreRGITIka~~~~~~~~~~~~~~y~i   80 (606)
                      |.+|++|||||||+||+|||||||+|+||+.+|.+++.   +.++++||++++||||||||+|.++++.|     ++|+|
T Consensus         3 ~~~~~e~IRNi~IvaHvd~GKTTL~d~LL~~~g~i~~~g~v~~g~~~~D~~~~E~eRgITi~ss~~s~~~-----~~~~i   77 (693)
T PRK12739          3 REFPLEKTRNIGIMAHIDAGKTTTTERILFYTGKIHKIGEVHDGAATMDWMEQEQERGITITSAATTAFW-----KDHRI   77 (693)
T ss_pred             CCCCHHHCEEEEEEECCCCCHHHHHHHHHHHCCCCCCCCEECCCCCCCCCCHHHHHCCCCEEECEEEEEE-----CCEEE
T ss_conf             8785788139999907998989999999997698565733438975687809998759867455277845-----99899


Q ss_pred             EEEECCCCCHHHHHHHHHHHHCCEEEEEEECCCCCCHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCCHHHHHHHHHHH
Q ss_conf             99617873002799999997302689999868788655899999999709967998326788753211338887755532
Q gi|254780321|r   81 NLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQAIDNNHEIITVLNKADLPSADPDRVKKQIEETIGI  160 (606)
Q Consensus        81 NlIDTPGH~DF~~EV~r~l~a~dgaiLvVdA~~Gvq~QT~~~~~~A~~~~l~~I~viNKiD~~~A~~e~v~~ei~~~~g~  160 (606)
                      ||||||||+||++||++||++|||||+||||.+|||+||+.+|+.|.+.++|+|+|||||||..|+++.+.+++.+.++.
T Consensus        78 NLIDTPGHvDF~~EV~~alrv~DgalvvVDaveGV~~qT~~v~rqa~~~~lp~il~iNKiDR~~ad~~~~~~~i~~~l~~  157 (693)
T PRK12739         78 NIIDTPGHVDFTIEVERSLRVLDGAVAVFDAVSGVEPQSETVWRQADKYGVPRIVFVNKMDRIGADFFRVVEQIKDRLGA  157 (693)
T ss_pred             EEEECCCCCHHHHHHHHHHHHHCEEEEEEECCCCCCHHHHHHHHHHHHCCCCEEEEEECCCCCCCCHHHHHHHHHHHHCC
T ss_conf             99949697405899999999848799999789887677999999999869896999979788999989999999998589


Q ss_pred             H-------------------------------------------------------------------------------
Q ss_conf             2-------------------------------------------------------------------------------
Q gi|254780321|r  161 S-------------------------------------------------------------------------------  161 (606)
Q Consensus       161 ~-------------------------------------------------------------------------------  161 (606)
                      .                                                                               
T Consensus       158 ~~~~~~~pi~~~~~f~g~vd~~~~~~~~~~~~~~g~~~~~~~~~~~~~~~~~~~r~~l~e~v~e~dd~l~e~~l~~~~~~  237 (693)
T PRK12739        158 NAVPIQLPIGAEDDFKGVIDLIKMKAIIWDDETLGAKYEEEDIPADLKEKAEEYREKLIEAVAETDEELMEKYLEGEEIT  237 (693)
T ss_pred             CEEEEECCCCCCCCCCCEEEEECCEEEEEECCCCCCCEEEEECCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCC
T ss_conf             77999742203655331143100578885045579833781076889999999999999999865289999985587788


Q ss_pred             HH-------------H---HHHHHHHCCCCCCHHHHHHHHHHHCCCC-----------------HHHHHCCCCCCCCCEE
Q ss_conf             32-------------1---0001110022320067877632100011-----------------1122012331012101
Q gi|254780321|r  162 TE-------------D---ALLVSAKTGEGIPLLLERIVQQLPSPTS-----------------PEGANAPLKALLIDSW  208 (606)
Q Consensus       162 ~~-------------~---ii~vSAktG~GV~~LLd~Iv~~iP~P~~-----------------~~~~~~Pl~alVfds~  208 (606)
                      .+             +   +++.||.++.|+++|||+|++++|+|..                 ..++++||.|+||++.
T Consensus       238 ~~~l~~~l~~~~~~~~~~Pv~~gs~~~~~gv~~Lld~I~~~lPsP~e~~~~~~~~~~~~~~~~~~~~~~~p~~a~v~K~~  317 (693)
T PRK12739        238 EEEIKAAIRKATINMEFFPVLCGSAFKNKGVQPLLDAVVDYLPSPLDIPAIKGINPDTGEEVERPASDDEPFAALAFKIM  317 (693)
T ss_pred             HHHHHHHHHHHHHHCCCCCCEECCCCCCCCHHHHHHHHHHHCCCHHHCCCCCCCCCCCCCEEEECCCCCCCCEEEEEEEE
T ss_conf             99999999999983760020323200387899999999976899122344334478876423503699988389999988


Q ss_pred             ECCCCCEEEEEEECCCCCCCCCEEEEECCCCCCCCCCCCCCCC-CEEEEHHCCCCCHHHHHHCCCCCCCCCCCCEECCCC
Q ss_conf             1475725999981698735584588733556421012223355-412401012471233220110024444542000466
Q gi|254780321|r  209 YNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVERIGILTP-KMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDS  287 (606)
Q Consensus       209 ~D~~~G~I~~~RV~sG~lk~Gd~I~~~~~g~~~~v~~ig~~~~-~~~~v~~l~aGdVG~ii~gik~l~~~~vGDTl~~~~  287 (606)
                      .|||.|+++|+||+||+|++|++|++...++.+++.+++.+.+ +..+++++.||+|+.    +.+++++.+|||||+.+
T Consensus       318 ~d~~~G~ia~~RV~sGtl~~g~~v~n~~~~~~~ki~~l~~~~g~~~~~v~~~~aG~Iv~----i~Gl~~~~tgdtl~~~~  393 (693)
T PRK12739        318 TDPFVGRLTFFRVYSGTLESGSYVLNTTKGKKERIGRLLQMHANKREEIKEVYAGDIGA----AVGLKDTTTGDTLCDEK  393 (693)
T ss_pred             ECCCCCCEEEEECCCCEECCCCEEECCCCCCEEECCEEEEEECCCCEEEEEECCCCEEE----EECCCCCCCCCEECCCC
T ss_conf             84899817899934771469998964676422430404786268741521764897699----96444541378723898


Q ss_pred             CCCCCCCCCCCCCCCEEEEEECCCCHHHHHHHHHHHHHHHHHCCCCCCC--CCCCCCCCCEEEEEECCHHHHHHHHHHHH
Q ss_conf             7853236455222212664212677024578899998886411221112--56760004202899637678988898886
Q gi|254780321|r  288 SPTTSALPGFKPIQPVVFCGLFPVDATQFENLRTAINKLRLNDASFSFE--LENSTALGFGFRCGFLGLLHLEIIQERLE  365 (606)
Q Consensus       288 ~p~~~~Lp~~~~~~P~v~~~i~p~~~~d~~~L~~aL~kL~~~D~sl~~e--~Ets~aLg~Gfr~gglG~LHLeVi~eRL~  365 (606)
                      .|.  .++.+.+|+|+++++++|.|.+|.++|.++|.+|..+||+|+++  +||++.+     ++|+||||||++++||+
T Consensus       394 ~~~--~~~~~~~p~Pv~~vaIeP~~~~d~~kL~~~L~~L~~~DPsl~v~~~eetGE~v-----l~g~GElHLe~~l~~L~  466 (693)
T PRK12739        394 API--ILESMEFPEPVISLAVEPKSKADQDKMGIALQKLAEEDPTFRVETDEETGQTI-----ISGMGELHLDIIVDRMK  466 (693)
T ss_pred             CCC--CCCCCCCCCCCEEEEEEECCHHHHHHHHHHHHHHCCCCCCEEEEEECCCCCEE-----EEECCHHHHHHHHHHHH
T ss_conf             764--46644578873358998487768999999998742459836999807788189-----99259999999999999


Q ss_pred             HHCCCEEEEECCCCCEEEEE------------------------------------------------------------
Q ss_conf             64495069737823303353------------------------------------------------------------
Q gi|254780321|r  366 REFSLNLIGTSPSVVYELYM------------------------------------------------------------  385 (606)
Q Consensus       366 rEfg~ev~~t~P~V~Ykv~~------------------------------------------------------------  385 (606)
                      ++||+|+.++.|.|+||.|.                                                            
T Consensus       467 ~~f~vev~~s~P~V~yrETi~~~~~~~~~~~k~s~g~~~~~~v~l~~eP~~~~~~~~f~~~i~gg~ip~~~~~sv~~Gf~  546 (693)
T PRK12739        467 REFKVEANVGAPQVAYRETITKSVEAEGKYKKQSGGRGQYGDVWIEFEPNEEGKGFEFVNKIVGGVIPKEYIPAVEKGLE  546 (693)
T ss_pred             HHHCCCEEEECCCCEEEEEECCCCCEEEEEEECCCCCCCEEEEEEEECCCCCCCCCEEEECCCCCCCCHHHHHHHHHHHH
T ss_conf             98698547516753389885045430579974269986126999997567778886675415578577888766789999


Q ss_pred             --------------------ECCCEEECCCH-HHCCCHHHHH----------HHHCCEEEEEEEECCCCCHHHHHHHHHH
Q ss_conf             --------------------15645412696-6625867788----------8623269999980831000389998863
Q gi|254780321|r  386 --------------------HDGSMQKLSNP-IDMPEVTKIA----------ELREPWIQVTIITPNEYLGSILKLCQER  434 (606)
Q Consensus       386 --------------------~dG~~~~Vd~p-~~~p~~~~i~----------~i~EPi~~~~I~~P~ey~G~Vm~~l~~R  434 (606)
                                          .||++|.+|+. ..|--++..+          .++|||++++|.||++|+|.||++|++|
T Consensus       547 ~a~~~GpL~~~pv~~v~~~l~d~~~h~vds~~~~f~~a~~~a~~~a~~~A~p~LlEPi~~~eI~~p~~~~g~V~~~L~~R  626 (693)
T PRK12739        547 EAMKNGVLAGYPMVDVKATLYDGSYHDVDSSEMAFKIAASMALKEAAKKAGPVILEPIMKVEVVTPEEYMGDVIGDLNRR  626 (693)
T ss_pred             HHHHHCCCCCCCEEEEEEEEECCCCCCCCCCHHHHHHHHHHHHHHHHHHCCCEEECCEEEEEEEECHHHHHHHHHHHHHC
T ss_conf             99972883578555059999626504788845789999999999999855988975628999997889999999999876


Q ss_pred             HHEEECCCCCCCEEEEEEEECHHHHHHHHHHHHHHHCCCEEEEEEEECCCEE
Q ss_conf             0014244336836999999604333220468767635741888985435464
Q gi|254780321|r  435 RGIQIDMSHLDNRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDYRD  486 (606)
Q Consensus       435 RG~~~~m~~~~~~~~i~~~vPl~Eli~~f~~~LkS~T~G~as~~ye~~~Y~~  486 (606)
                      ||++.+++..++..+|++.+|++|+ +||.++||++|+|+|+|.++|+||++
T Consensus       627 RG~i~~~~~~~g~~~I~a~iPv~e~-fgf~~~LR~~T~G~a~~~~~F~~y~~  677 (693)
T PRK12739        627 RGQIEGMEARGGAQIVKAFVPLAEM-FGYATDLRSATQGRATFSMEFDHYEE  677 (693)
T ss_pred             CCEEECEEECCCCEEEEEEECHHHH-HCHHHHHHHHCCCCEEEEEEECCCCC
T ss_conf             8987562744990999999887886-27789988438895489999688623


No 12 
>PRK07560 elongation factor EF-2; Reviewed
Probab=100.00  E-value=0  Score=849.80  Aligned_cols=468  Identities=28%  Similarity=0.477  Sum_probs=397.9

Q ss_pred             HHHCEEEEEECCCCCCHHHHHHHHHHHCCCCCCC-CCCCEEECCCHHHHHHCCEEEEEEEEEEEECCCCCEEEEEEEECC
Q ss_conf             5253179998013898778899999982980544-443113058677987195052327999974378843899996178
Q gi|254780321|r    8 LSRIRNFSIVAHIDHGKSTLADRFIQHCRGLTER-EMSSQVLDNMDIERERGITIKAQTVRLNYTSTDAKDYQLNLIDTP   86 (606)
Q Consensus         8 ~~~IRN~~IiaHvDhGKTTL~d~lL~~tg~i~~~-~~~~~vlD~~~~EreRGITIka~~~~~~~~~~~~~~y~iNlIDTP   86 (606)
                      ++|||||||+||+|||||||+|+||+.+|.++++ +.++++||++++||||||||+|+++++.|. ++|++|+|||||||
T Consensus        17 pe~IRNI~IiaHvdaGKTTLtE~lL~~sg~i~~~~~~~~t~~D~~~~E~eRgITI~sa~~sl~~~-~~~~~~~INlIDTP   95 (730)
T PRK07560         17 PEQIRNIGIVAHIDHGKTTLSDNLLAGAGMISEELAGKQLALDYDEEEQARGITIKAANVSMVHE-YEGKEYLINLIDTP   95 (730)
T ss_pred             HHHCCEEEEECCCCCCHHHHHHHHHHHCCCCCCCCCCCCEECCCHHHHHHCCCCEEECCEEEEEE-ECCCCEEEEEECCC
T ss_conf             76352899993799898999999999649986534798641788599997298575211028987-56983789998196


Q ss_pred             CCCHHHHHHHHHHHHCCEEEEEEECCCCCCHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCCHHHHHHHHHH-------
Q ss_conf             7300279999999730268999986878865589999999970996799832678875321133888775553-------
Q gi|254780321|r   87 GHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQAIDNNHEIITVLNKADLPSADPDRVKKQIEETIG-------  159 (606)
Q Consensus        87 GH~DF~~EV~r~l~a~dgaiLvVdA~~Gvq~QT~~~~~~A~~~~l~~I~viNKiD~~~A~~e~v~~ei~~~~g-------  159 (606)
                      ||+||++||+|||++|||||+||||++|||+||+.+|+.|.+.++|+|+||||||+..+++....+++.+.++       
T Consensus        96 Gh~DF~~Ev~~aLrv~DgAvvVvdav~GV~~qTe~v~rqa~~~~~p~ilfINKmDR~~~~l~~~~~~~~~~l~~~i~~~~  175 (730)
T PRK07560         96 GHVDFGGDVTRAMRAVDGAIVVVDAVEGVMPQTETVLRQALEERVRPVLFINKVDRLIKELKLTPQEMQQRLLKIIKDVN  175 (730)
T ss_pred             CCCHHHHHHHHHHHHHCEEEEEEECCCCCCCHHHHHHHHHHHCCCCEEEEEECCCCCHHHHCCCHHHHHHHHHHHHHHHH
T ss_conf             97305999999998858789999789887731899999998779997999868662355537798999888988999999


Q ss_pred             ------------------HHHHHHHHHHHHCCC----------------------------------CCCHHHHHHHHHH
Q ss_conf             ------------------223210001110022----------------------------------3200678776321
Q gi|254780321|r  160 ------------------ISTEDALLVSAKTGE----------------------------------GIPLLLERIVQQL  187 (606)
Q Consensus       160 ------------------~~~~~ii~vSAktG~----------------------------------GV~~LLd~Iv~~i  187 (606)
                                        ....++.++||..+.                                  ..+.|||+|++++
T Consensus       176 ~~i~~~~~~~~~~~~~~~~~~~~v~~~sa~~~~~~~~~~~~~~~~~~~ei~~~~~~~~~~~l~~~~pl~~~lld~i~~~l  255 (730)
T PRK07560        176 KLIEGYAPEEFKEKWKVDVADGTVAFGSALYNWAISVPMMQKTGIKFKDIIDYYEKGKVKELAEKAPLHEVVLDMVIKHL  255 (730)
T ss_pred             HHHHHCCCHHHCCCEEECCCCCCHHHHHHHHCCCCCHHHHHHHCCCHHHHHHHHHCCHHHHHHHHCCHHHHHHHHHHHHC
T ss_conf             99986371553755052443342054423427523469998718777899999853128887653847999999999868


Q ss_pred             HCCCCH-----------------------HHHHCCCCCCCCCEEECCCCCEEEEEEECCCCCCCCCEEEEECCCCCCCCC
Q ss_conf             000111-----------------------122012331012101147572599998169873558458873355642101
Q gi|254780321|r  188 PSPTSP-----------------------EGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVE  244 (606)
Q Consensus       188 P~P~~~-----------------------~~~~~Pl~alVfds~~D~~~G~I~~~RV~sG~lk~Gd~I~~~~~g~~~~v~  244 (606)
                      |+|...                       .++++||.|+||++.+|||.|.++|+|||||+|+.||+|++.+++.++++.
T Consensus       256 PsP~ea~~~ri~~~~~g~~~~~~~~~~~~~d~~~pl~~~vfK~~~dp~~g~is~~RV~sG~L~~g~~v~n~~~~~~eki~  335 (730)
T PRK07560        256 PNPLEAQKYRIPKIWKGDLNSEIGKAMLNCDPNGPLVMMVTKIIVDPHAGEVATGRVFSGTIRRGQEVYLVGAKKKARVQ  335 (730)
T ss_pred             CCHHHHCCCCCCCCCCCCCCCHHHEEEEECCCCCCCEEEEEEEEECCCCCEEEEEEEECCEECCCCEEEECCCCCCEEEE
T ss_conf             99577221035644578876510101220489987145775455669886489999843466479875404777412521


Q ss_pred             CCCCCCC-CEEEEHHCCCCCHHHHHHCCCCCCCCCCCCEECCCCCCCCCCCCCCC-CCCCEEEEEECCCCHHHHHHHHHH
Q ss_conf             2223355-41240101247123322011002444454200046678532364552-222126642126770245788999
Q gi|254780321|r  245 RIGILTP-KMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFK-PIQPVVFCGLFPVDATQFENLRTA  322 (606)
Q Consensus       245 ~ig~~~~-~~~~v~~l~aGdVG~ii~gik~l~~~~vGDTl~~~~~p~~~~Lp~~~-~~~P~v~~~i~p~~~~d~~~L~~a  322 (606)
                      +++.+.+ +..+++++.|||||.    +.+++++.+|||||+.+.+. .|+..+. .++|+++++++|.+.+|.++|.+|
T Consensus       336 ~l~~~~g~~~~~v~~~~aGdI~a----i~gL~~~~tGdTl~~~~~~~-~~~~~~~~~~~Pv~~~aIeP~~~~D~~kL~~a  410 (730)
T PRK07560        336 QVGIYMGPEREEVDEIPAGNIAA----VTGLKDARAGETVVSPEYKM-TPFESLKHISEPVVTVAIEAKNPKDLPKLIEV  410 (730)
T ss_pred             EEEEEECCCEEEEEEECCCCEEE----EECCCCCCCCCEEECCCCCC-CCCCCCCCCCCCEEEEEEECCCHHHHHHHHHH
T ss_conf             57872069657810516787899----95665541166542587677-65222455899659999602886679999999


Q ss_pred             HHHHHHHCCCCCCC--CCCCCCCCCEEEEEECCHHHHHHHHHHHHHHCCCEEEEECCCCCEEEEEECCCE---------E
Q ss_conf             98886411221112--567600042028996376789888988866449506973782330335315645---------4
Q gi|254780321|r  323 INKLRLNDASFSFE--LENSTALGFGFRCGFLGLLHLEIIQERLEREFSLNLIGTSPSVVYELYMHDGSM---------Q  391 (606)
Q Consensus       323 L~kL~~~D~sl~~e--~Ets~aLg~Gfr~gglG~LHLeVi~eRL~rEfg~ev~~t~P~V~Ykv~~~dG~~---------~  391 (606)
                      |.+|..+||||+++  +||++.+     ++|+|||||||+++||+|+||+++.++.|+|+||.|......         |
T Consensus       411 L~~L~~eDPsl~v~~d~etge~v-----l~gmGElHLei~~~rL~~~f~vev~~~~p~V~YrETI~~~~~~~~~ks~~~h  485 (730)
T PRK07560        411 LRQLAKEDPTLQVKINEETGEHL-----LSGMGELHLEVITYRIKRDYGVEVVTSEPIVVYRETVRGKSQVVEGKSPNKH  485 (730)
T ss_pred             HHHHHHHCCEEEEEECCCCCEEE-----EEECCHHHHHHHHHHHHHHHCCCEEECCCEEEEEEEECCCCCCEECCCCCCC
T ss_conf             99988419748999837788099-----9962899999999999998485236549767788641566551001168876


Q ss_pred             ---------------------ECC---CHHH--------------------------C----------------------
Q ss_conf             ---------------------126---9666--------------------------2----------------------
Q gi|254780321|r  392 ---------------------KLS---NPID--------------------------M----------------------  399 (606)
Q Consensus       392 ---------------------~Vd---~p~~--------------------------~----------------------  399 (606)
                                           .|.   +|..                          |                      
T Consensus       486 ~~~~i~~epl~~~~~~~~~~g~v~~~~~p~~~~~~l~~~g~~~~~~~~v~~~~~~ni~~d~~~g~~~~~~~~~~v~~G~~  565 (730)
T PRK07560        486 NRFYITVEPLDEEVIEAIKEGEISEDMDPKERAKILREAGMDKDEAKGVWAIYNGNVFIDMTKGIQYLRETMELIIEGFR  565 (730)
T ss_pred             CEEEEEEEECCHHHHCCCCCCEEECCCCHHHHHHHHHHCCCCHHHHCCEEEECCCCEEEECCCCCCCHHHHHHHHHHHHH
T ss_conf             46999997476443103305555113482666556665177644420502312674555647675557989999999999


Q ss_pred             -----------C--------------------------CHHHHH----------HHHCCEEEEEEEECCCCCHHHHHHHH
Q ss_conf             -----------5--------------------------867788----------86232699999808310003899988
Q gi|254780321|r  400 -----------P--------------------------EVTKIA----------ELREPWIQVTIITPNEYLGSILKLCQ  432 (606)
Q Consensus       400 -----------p--------------------------~~~~i~----------~i~EPi~~~~I~~P~ey~G~Vm~~l~  432 (606)
                                 |                          .+...+          .++||||+++|.+|++|+|+||++++
T Consensus       566 ~a~~~GpL~g~Pv~~v~v~l~dg~~h~d~v~~~~~~~~~A~~~a~~~a~~~a~p~LLEPi~~~eI~~P~~~~G~V~~dL~  645 (730)
T PRK07560        566 EAMKEGPLAKEPVRGVKVRLHDAKLHEDAIHRGPAQVIPAVRNAIFAAMLSAKPTLLEPIQKVDINVPQDYMGAVTSEIQ  645 (730)
T ss_pred             HHHHCCCCCCCCCCCEEEEEEEEEECCCCCCCCHHHHHHHHHHHHHHHHHHCCCEEECCCEEEEEEECHHHHHHHHHHHH
T ss_conf             99955986676556679999974211563445637899999999999998779889856689999988899879999998


Q ss_pred             HHHHEEECCCCCCCEEEEEEEECHHHHHHHHHHHHHHHCCCEEEEEEEECCCEEC
Q ss_conf             6300142443368369999996043332204687676357418889854354643
Q gi|254780321|r  433 ERRGIQIDMSHLDNRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDYRDS  487 (606)
Q Consensus       433 ~RRG~~~~m~~~~~~~~i~~~vPl~Eli~~f~~~LkS~T~G~as~~ye~~~Y~~~  487 (606)
                      +|||++.+|+..++...|.+.+|++|+ +||.++|+|+|+|+|+|+++|+||++-
T Consensus       646 ~RRG~I~~~~~~~~~~~I~A~vPlae~-~gy~~~LRs~T~G~g~~~~~F~~y~~v  699 (730)
T PRK07560        646 GRRGKILDMTQEGDMAIIEAEAPVAEM-FGFAGEIRSATEGRAFWSTEFAGFEPV  699 (730)
T ss_pred             HCCCEEECEECCCCCEEEEEEECHHHH-CCHHHHHHHHCCCCCEEEEEECCCCCC
T ss_conf             679588352236991999999778986-282899996688971699995886269


No 13 
>TIGR00484 EF-G translation elongation factor G; InterPro: IPR004540   Translation elongation factors are responsible for two main processes during protein synthesis on the ribosome , , . EF1A (or EF-Tu) is responsible for the selection and binding of the cognate aminoacyl-tRNA to the A-site (acceptor site) of the ribosome. EF2 (or EF-G) is responsible for the translocation of the peptidyl-tRNA from the A-site to the P-site (peptidyl-tRNA site) of the ribosome, thereby freeing the A-site for the next aminoacyl-tRNA to bind. Elongation factors are responsible for achieving accuracy of translation and both EF1A and EF2 are remarkably conserved throughout evolution.   EF-G is a large, five-domain GTPase that promotes the directional movement of mRNA and tRNAs on the ribosome in a GTP-dependent manner. Unlike other GTPases, but by analogy to the myosin motor, EF-G performs its function of powering translocation in the GDP-bound form; that is, in a kinetically stable ribosome-EF-G(GDP) complex formed by GTP hydrolysis on the ribosome. The complex undergoes an extensive structural rearrangement, in particular affecting the small ribosomal subunit, which leads to mRNA-tRNA movement. Domain 4, which extends from the 'body' of the EF-G molecule much like a lever arm, appears to be essential for the structural transition to take place. In a hypothetical model, GTP hydrolysis induces a conformational change in the G domain of EF-G, which affects the interactions with neighbouring domains within EF-G. The resulting rearrangement of the domains relative to each other generates conformational strain in the ribosome to which EF-G is fixed. Because of structural features of the tRNA-ribosome complex, this conformational strain results in directional tRNA-mRNA movement. The functional parallels between EF-G and motor proteins suggest that EF-G differs from classical G-proteins in that it functions as a force-generating mechanochemical device rather than a conformational switch .   Every completed bacterial genome has at least one copy, but some species have additional EF-G-like proteins. The closest homolog to canonical (e.g. Escherichia coli) EF-G in the spirochetes clusters as if it is derived from mitochondrial forms, while a more distant second copy is also present. Synechocystis sp. (strain PCC 6803) has a few proteins more closely related to EF-G than to any other characterised protein. Two of these resemble E. coli EF-G more closely than does the best match from the spirochetes; it may be that both function as authentic EF-G.   More information about these proteins can be found at Protein of the Month: Elongation Factors . ; GO: 0003746 translation elongation factor activity, 0005525 GTP binding, 0006414 translational elongation, 0005622 intracellular.
Probab=100.00  E-value=0  Score=868.63  Aligned_cols=469  Identities=30%  Similarity=0.488  Sum_probs=423.5

Q ss_pred             CCCHHHCEEEEEECCCCCCHHHHHHHHHHHCCCCCCC---C--CCCEEECCCHHHHHHCCEEEEEEEEEEEEC--CCCCE
Q ss_conf             9985253179998013898778899999982980544---4--431130586779871950523279999743--78843
Q gi|254780321|r    5 PTPLSRIRNFSIVAHIDHGKSTLADRFIQHCRGLTER---E--MSSQVLDNMDIERERGITIKAQTVRLNYTS--TDAKD   77 (606)
Q Consensus         5 ~~p~~~IRN~~IiaHvDhGKTTL~d~lL~~tg~i~~~---~--~~~~vlD~~~~EreRGITIka~~~~~~~~~--~~~~~   77 (606)
                      .+|++++|||+|.||+|+||||++||+|+.||.+.+-   .  .+...||||+.||||||||.|.+++..|+.  ..+ +
T Consensus         4 ~~~~~~~RNiGI~AHIDaGKTT~~ERILFy~g~~HkIgE~~g~dG~a~MDwME~E~ERGITItSAAT~~~Wk~~~~~~-~   82 (705)
T TIGR00484         4 TTDLEKLRNIGISAHIDAGKTTTTERILFYTGRIHKIGEVHGKDGAATMDWMEQEKERGITITSAATTVEWKGMAKQY-D   82 (705)
T ss_pred             CCCHHHCCCCCEEEEECCCCCCCHHEEEECCCCCCCEEECCCCCCCEECCHHHHCCCCCEEEECHHCCHHHHHHHHCC-C
T ss_conf             565233055432786338873201010001375010000016788511231230035871421001101021010001-4


Q ss_pred             EEEEEEECCCCCHHHHHHHHHHHHCCEEEEEEECCCCCCHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCCHHHHHHHH
Q ss_conf             89999617873002799999997302689999868788655899999999709967998326788753211338887755
Q gi|254780321|r   78 YQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQAIDNNHEIITVLNKADLPSADPDRVKKQIEET  157 (606)
Q Consensus        78 y~iNlIDTPGH~DF~~EV~r~l~a~dgaiLvVdA~~Gvq~QT~~~~~~A~~~~l~~I~viNKiD~~~A~~e~v~~ei~~~  157 (606)
                      |.|||||||||+||+-||+||||+.||||+|.||..||||||..+|++|..+.+|+|+|+||||+-+|++.++..+|...
T Consensus        83 ~~~N~IDTPGHVDFT~EVERSlRVLDGAv~V~~a~~GV~pQ~~TVwRQa~~Y~VPRi~FVNK~Dk~GAnf~~~~~~~~~r  162 (705)
T TIGR00484        83 HRINIIDTPGHVDFTVEVERSLRVLDGAVAVLDAVGGVQPQSETVWRQANKYEVPRIVFVNKMDKTGANFLRVVNQLKSR  162 (705)
T ss_pred             CEEEEEECCCCEEEEEEEEEHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHCCCCEEEEEECCCCCCCCHHHHHHHHHHH
T ss_conf             03788737894125788520122564566533302686641156776543268862899715564578788999999987


Q ss_pred             HHHHH---------------------------------------------------------------H-----------
Q ss_conf             53223---------------------------------------------------------------2-----------
Q gi|254780321|r  158 IGIST---------------------------------------------------------------E-----------  163 (606)
Q Consensus       158 ~g~~~---------------------------------------------------------------~-----------  163 (606)
                      +++.+                                                               +           
T Consensus       163 L~~~~~~~qlpiGaE~~f~GviDLv~~ka~~~~~~~~g~~~~~~~iP~~~~~~~~~~~~~l~e~~a~~~~~LM~~yl~G~  242 (705)
T TIGR00484       163 LGANAVPIQLPIGAEDKFIGVIDLVEMKAYFFEEGDKGTKIDEKEIPSDLLEQAKELRENLVEAVAELDEELMEKYLEGE  242 (705)
T ss_pred             HCCCCEEEEECCCCCCCCCEEEEEEEEEEEEECCCCCCCEEHHHCCCHHHHHHHHHHHHHHHHHHHCCCHHHHHHHCCCC
T ss_conf             46773466411256656310455430156775067766400122264789999999999999988420078899850896


Q ss_pred             ---------------------HHHHHHHHCCCCCCHHHHHHHHHHHCCCCH------------------HHHHCCCCCCC
Q ss_conf             ---------------------100011100223200678776321000111------------------12201233101
Q gi|254780321|r  164 ---------------------DALLVSAKTGEGIPLLLERIVQQLPSPTSP------------------EGANAPLKALL  204 (606)
Q Consensus       164 ---------------------~ii~vSAktG~GV~~LLd~Iv~~iP~P~~~------------------~~~~~Pl~alV  204 (606)
                                           -+++.||-.+.||+.||||+++|+|+|..-                  .+.+.||.+|.
T Consensus       243 e~~~~~ik~~~r~g~l~~~~~pv~~GSafKNKGv~~lLDAV~~yLP~P~dv~~~~~~~~~~~~~e~~~~~sd~~~f~~LA  322 (705)
T TIGR00484       243 ELTIEEIKNAIRKGVLNLELIPVLCGSAFKNKGVQLLLDAVVDYLPSPTDVPAIKGIDPDTNEEEIELKASDEEPFVALA  322 (705)
T ss_pred             CCCHHHHHHHHHCCEEEEEEEEEEECCCCHHHHHHHHHHHHHHHCCCCCCHHHHHCCCCCCCCCCEEEEECCCCCCEEEE
T ss_conf             53689998887513112468888750330002588899999974789743154302355667761367515676512234


Q ss_pred             CCEEECCCCCEEEEEEECCCCCCCCCEEEEECCCCCCCCCCCCCCCCC-EEEEHHCCCCCHHHHHHCCCCCCCCCCCCEE
Q ss_conf             210114757259999816987355845887335564210122233554-1240101247123322011002444454200
Q gi|254780321|r  205 IDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVERIGILTPK-MIDIEALYPGEIGVMIASIKEVSHTRVGDTI  283 (606)
Q Consensus       205 fds~~D~~~G~I~~~RV~sG~lk~Gd~I~~~~~g~~~~v~~ig~~~~~-~~~v~~l~aGdVG~ii~gik~l~~~~vGDTl  283 (606)
                      |+..-|||.|.+.|+|||+|.|+.|+.|.|....+++++.++-.||.+ +.++++..||||.+++    +++++.+||||
T Consensus       323 FK~~tdpfvG~LTf~RvY~G~l~~G~~v~Ns~~~k~ervgRl~~MHa~~re~I~~~~aGdI~A~~----Glkd~~TGdTl  398 (705)
T TIGR00484       323 FKVATDPFVGQLTFVRVYSGVLKSGSYVKNSRKSKKERVGRLVKMHANKREEIKEVRAGDIAAAI----GLKDTTTGDTL  398 (705)
T ss_pred             EEECCCCCCCEEEEEEEEEEEECCCCEEEECHHHHHHHHHHHHHCCCCCCCCCCCCCCCCEEEEE----CCEECCCCCCC
T ss_conf             56405873112789999761512797776020000144323331003772100121356368873----13002567632


Q ss_pred             CCCCCCCCCCCCCCCCCCCEEEEEECCCCHHHHHHHHHHHHHHHHHCCCCCC--CCCCCCCCCCEEEEEECCHHHHHHHH
Q ss_conf             0466785323645522221266421267702457889999888641122111--25676000420289963767898889
Q gi|254780321|r  284 TDDSSPTTSALPGFKPIQPVVFCGLFPVDATQFENLRTAINKLRLNDASFSF--ELENSTALGFGFRCGFLGLLHLEIIQ  361 (606)
Q Consensus       284 ~~~~~p~~~~Lp~~~~~~P~v~~~i~p~~~~d~~~L~~aL~kL~~~D~sl~~--e~Ets~aLg~Gfr~gglG~LHLeVi~  361 (606)
                      |+.+....  |...++|+|++..++.|+++.|.+++.-||.||+.|||||++  ++||++++     ++|||||||||++
T Consensus       399 ~d~~~~~~--le~M~fp~PVI~~avePK~Kad~~kM~~AL~~la~EDP~F~~~~~~E~g~Ti-----I~GMGELHL~i~v  471 (705)
T TIGR00484       399 CDEKADVI--LESMEFPEPVISLAVEPKTKADQEKMGIALGKLAEEDPTFRTFTDEETGQTI-----IAGMGELHLDIIV  471 (705)
T ss_pred             CCCCCCCE--EEECCCCCCEEEEEECCCCCCCHHHHHHHHHHHHCCCCCEEEEECCCCCCHH-----HHCCCHHHHHHHH
T ss_conf             25642000--1002588871688755887435567999987532248860477527444413-----2031045677886


Q ss_pred             HHHHHHCCCEEEEECCCCCEE-----------------------------------------------------------
Q ss_conf             888664495069737823303-----------------------------------------------------------
Q gi|254780321|r  362 ERLEREFSLNLIGTSPSVVYE-----------------------------------------------------------  382 (606)
Q Consensus       362 eRL~rEfg~ev~~t~P~V~Yk-----------------------------------------------------------  382 (606)
                      +||+|||.+|+.++.|+|.||                                                           
T Consensus       472 dRmkREFkvE~~~G~PQVayRET~~~~~~~~e~k~~kQSGGrGQyG~V~i~~~P~~~~~~~~gyEF~n~I~GGviP~EYI  551 (705)
T TIGR00484       472 DRMKREFKVEANVGAPQVAYRETIRSKAEDVEGKYAKQSGGRGQYGHVVIELEPLEPEEGGKGYEFVNEIKGGVIPREYI  551 (705)
T ss_pred             HHHCCEEEEEEECCCCCCHHHHHHHHHHHHHCCEEEECCCCCCCCEEEEEEEECCCCCCCCCCCEEEECCCCCCCCCCCH
T ss_conf             65210033433058683034554311123213503230689873016899861277788876422533034860773210


Q ss_pred             -------------------------EEEECCCEEECCCHHHCCCH--HHHH----------HHHCCEEEEEEEECCCCCH
Q ss_conf             -------------------------35315645412696662586--7788----------8623269999980831000
Q gi|254780321|r  383 -------------------------LYMHDGSMQKLSNPIDMPEV--TKIA----------ELREPWIQVTIITPNEYLG  425 (606)
Q Consensus       383 -------------------------v~~~dG~~~~Vd~p~~~p~~--~~i~----------~i~EPi~~~~I~~P~ey~G  425 (606)
                                               +++.||+||.||| +++++.  .-++          .+|||||+++|.+|++|+|
T Consensus       552 p~v~~G~~~a~~~G~LaGyP~vD~k~~l~dG~yH~VDS-se~AFk~Aas~A~k~a~~~a~PvlLEPiMkvev~~P~ey~G  630 (705)
T TIGR00484       552 PAVDKGLQEALESGPLAGYPVVDIKVTLFDGSYHDVDS-SELAFKLAASLAFKEAVKKANPVLLEPIMKVEVEVPEEYMG  630 (705)
T ss_pred             HHHHHHHHHHHHCCCEECCCEEEEEEEEECCCCCCCCH-HHHHHHHHHHHHHHHHHHHCCCEEECCCEEEEEECCCCCCC
T ss_conf             36777799998469732143476478885175231162-78999999999999867635974544602788755852015


Q ss_pred             HHHHHHHHHHHEEECCCCCCCEEEEEEEECHHHHHHHHHHHHHHHCCCEEEEEEEECCCEEC
Q ss_conf             38999886300142443368369999996043332204687676357418889854354643
Q gi|254780321|r  426 SILKLCQERRGIQIDMSHLDNRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDYRDS  487 (606)
Q Consensus       426 ~Vm~~l~~RRG~~~~m~~~~~~~~i~~~vPl~Eli~~f~~~LkS~T~G~as~~ye~~~Y~~~  487 (606)
                      ++|+++++|||.+.+++..++...+.+.|||+|| |||.+.|||.|+|+|+|.|+|.+|.+.
T Consensus       631 d~~Gdl~~RRg~~~g~~~~~~~~~v~A~VPL~EM-FGyaT~LRS~tqGr~~y~M~~~~Y~e~  691 (705)
T TIGR00484       631 DVIGDLSRRRGIIEGSEERGNVQVVKAEVPLSEM-FGYATDLRSSTQGRGEYSMEFLHYGEV  691 (705)
T ss_pred             CHHCCCCCCCCEEEEEECCCCEEEEEEEECCHHH-CCHHHHHHCCCCCCEEEEEEHHHHCCC
T ss_conf             1000100035114200023735689985060322-230323320567722688632332123


No 14 
>COG0480 FusA Translation elongation factors (GTPases) [Translation, ribosomal structure and biogenesis]
Probab=100.00  E-value=0  Score=838.56  Aligned_cols=467  Identities=34%  Similarity=0.527  Sum_probs=415.2

Q ss_pred             CCHHHCEEEEEECCCCCCHHHHHHHHHHHCCCCCCCC---CCCEEECCCHHHHHHCCEEEEEEEEEEEECCCCCEEEEEE
Q ss_conf             9852531799980138987788999999829805444---4311305867798719505232799997437884389999
Q gi|254780321|r    6 TPLSRIRNFSIVAHIDHGKSTLADRFIQHCRGLTERE---MSSQVLDNMDIERERGITIKAQTVRLNYTSTDAKDYQLNL   82 (606)
Q Consensus         6 ~p~~~IRN~~IiaHvDhGKTTL~d~lL~~tg~i~~~~---~~~~vlD~~~~EreRGITIka~~~~~~~~~~~~~~y~iNl   82 (606)
                      ++++++|||+|+||+|||||||+||||+.||.+++.+   .++++||+|+.||||||||+|+++++.|.+    +|+|||
T Consensus         5 ~~~~~~RNigI~aHidaGKTTltE~lL~~tG~i~k~G~v~~g~~~~D~~e~EqeRGITI~saa~s~~~~~----~~~iNl   80 (697)
T COG0480           5 MPLERIRNIGIVAHIDAGKTTLTERILFYTGIISKIGEVHDGAATMDWMEQEQERGITITSAATTLFWKG----DYRINL   80 (697)
T ss_pred             CCCCCCEEEEEEECCCCCCHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCHHHHHCCCEEEEEEEEEEECC----CEEEEE
T ss_conf             5544540799996047880778899998759757785566786547887889866977864056899708----658999


Q ss_pred             EECCCCCHHHHHHHHHHHHCCEEEEEEECCCCCCHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCCHHHHHHHHHHH--
Q ss_conf             617873002799999997302689999868788655899999999709967998326788753211338887755532--
Q gi|254780321|r   83 IDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQAIDNNHEIITVLNKADLPSADPDRVKKQIEETIGI--  160 (606)
Q Consensus        83 IDTPGH~DF~~EV~r~l~a~dgaiLvVdA~~Gvq~QT~~~~~~A~~~~l~~I~viNKiD~~~A~~e~v~~ei~~~~g~--  160 (606)
                      ||||||+||+.||+|||++||||++||||.+|||+||..+|++|.+.++|+|+|||||||..|++..+.+++.+.++.  
T Consensus        81 IDTPGHVDFt~EV~rslrvlDgavvVvdaveGV~~QTEtv~rqa~~~~vp~i~fiNKmDR~~a~~~~~~~~l~~~l~~~~  160 (697)
T COG0480          81 IDTPGHVDFTIEVERSLRVLDGAVVVVDAVEGVEPQTETVWRQADKYGVPRILFVNKMDRLGADFYLVVEQLKERLGANP  160 (697)
T ss_pred             ECCCCCCCCHHHHHHHHHHHCCEEEEEECCCCEEECHHHHHHHHHHCCCCEEEEEECCCCCCCCHHHHHHHHHHHHCCCC
T ss_conf             57997353477879988861650999988788300379999998655997599997843355673350999999867983


Q ss_pred             ---------------------------H-----------H--------------------H-------------------
Q ss_conf             ---------------------------2-----------3--------------------2-------------------
Q gi|254780321|r  161 ---------------------------S-----------T--------------------E-------------------  163 (606)
Q Consensus       161 ---------------------------~-----------~--------------------~-------------------  163 (606)
                                                 .           .                    +                   
T Consensus       161 ~~v~~pIg~~~~f~g~idl~~~~~~~~~~~~~~~~~~ip~~~~~~~~e~r~~~~e~i~e~de~l~e~yl~g~e~~~~~i~  240 (697)
T COG0480         161 VPVQLPIGAEEEFEGVIDLVEMKAVAFGDGAKYEWIEIPADLKEIAEEAREKLLEALAEFDEELMEKYLEGEEPTEEEIK  240 (697)
T ss_pred             EEEECCCCCCCCCCCEEEHHHCCEEEECCCCCCCEEECCHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHCCCCCCHHHHH
T ss_conf             22321115730047636711067179757752431558778876789999999998861579999998668876479999


Q ss_pred             -------------HHHHHHHHCCCCCCHHHHHHHHHHHCCCCH------------------HHHHCCCCCCCCCEEECCC
Q ss_conf             -------------100011100223200678776321000111------------------1220123310121011475
Q gi|254780321|r  164 -------------DALLVSAKTGEGIPLLLERIVQQLPSPTSP------------------EGANAPLKALLIDSWYNSY  212 (606)
Q Consensus       164 -------------~ii~vSAktG~GV~~LLd~Iv~~iP~P~~~------------------~~~~~Pl~alVfds~~D~~  212 (606)
                                   .+++.||.++.|++.|||+|++++|+|...                  .+.++||.|++||+.+|||
T Consensus       241 ~~i~~~~~~~~~~pvl~gsa~kn~gv~~lLdav~~~lPsP~e~~~~~g~~~~~~~~~~~~~~~~e~p~~a~vfKi~~d~~  320 (697)
T COG0480         241 KALRKGTIAGKIVPVLCGSAFKNKGVQPLLDAVVDYLPSPLDVPPIKGDLDDEIEKAVLRKASDEGPLSALVFKIMTDPF  320 (697)
T ss_pred             HHHHHHHHCCCEEEEEEEEECCCCCHHHHHHHHHHHCCCHHHCCCCCCCCCCCCCCHHCCCCCCCCCEEEEEEEEEECCC
T ss_conf             99987653266256775010257757999999998789956645444767753230000468888865999999686487


Q ss_pred             CCEEEEEEECCCCCCCCCEEEEECCCCCCCCCCCCCCCC-CEEEEHHCCCCCHHHHHHCCCCCCCCCCCCEECCCCCCCC
Q ss_conf             725999981698735584588733556421012223355-4124010124712332201100244445420004667853
Q gi|254780321|r  213 LGVMVLVRIINGQLTKGQSIRLMGTNAKYQVERIGILTP-KMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTT  291 (606)
Q Consensus       213 ~G~I~~~RV~sG~lk~Gd~I~~~~~g~~~~v~~ig~~~~-~~~~v~~l~aGdVG~ii~gik~l~~~~vGDTl~~~~~p~~  291 (606)
                      .|.++|+|||||+|++|+.+++.+.+++.++.+++.|++ ++.+++++.||||+.    +.+++++.+|||+|+.+.+  
T Consensus       321 ~g~l~~~RvysGtl~~G~~v~n~~~~~~erv~~l~~~~~~~~~~v~~~~AG~I~a----~~Gl~~~~tGdTl~~~~~~--  394 (697)
T COG0480         321 VGKLTFVRVYSGTLKSGSEVLNSTKGKKERVGRLLLMHGNEREEVDEVPAGDIVA----LVGLKDATTGDTLCDENKP--  394 (697)
T ss_pred             CCEEEEEEEECCEECCCCEEEECCCCCCEEEEEEEECCCCCEEECCCCCCCCEEE----EECCCCCCCCCEEECCCCC--
T ss_conf             8759999986437737988995799853787789871689502605405764899----9752355407856537876--


Q ss_pred             CCCCCCCCCCCEEEEEECCCCHHHHHHHHHHHHHHHHHCCCCCCC--CCCCCCCCCEEEEEECCHHHHHHHHHHHHHHCC
Q ss_conf             236455222212664212677024578899998886411221112--567600042028996376789888988866449
Q gi|254780321|r  292 SALPGFKPIQPVVFCGLFPVDATQFENLRTAINKLRLNDASFSFE--LENSTALGFGFRCGFLGLLHLEIIQERLEREFS  369 (606)
Q Consensus       292 ~~Lp~~~~~~P~v~~~i~p~~~~d~~~L~~aL~kL~~~D~sl~~e--~Ets~aLg~Gfr~gglG~LHLeVi~eRL~rEfg  369 (606)
                      .+++.+.+|+|++..+++|++++|.+||.+||.+|+.+||+|+++  .||.+.+     ++|+|||||||+.+||+|+||
T Consensus       395 v~~~~~~~pePVi~vavepk~~~d~~Kl~~aL~~l~~eDPt~~v~~d~Etge~i-----IsGmGELHLei~~drl~~~~~  469 (697)
T COG0480         395 VILESMEFPEPVISVAVEPKTKADQEKLSEALNKLAEEDPTFRVETDEETGETI-----ISGMGELHLEIIVDRLKREFG  469 (697)
T ss_pred             CCCCCCCCCCCEEEEEEEECCHHHHHHHHHHHHHHHHHCCCEEEEECCCCCCEE-----EEECCHHHHHHHHHHHHHHCC
T ss_conf             465665479964899976788435899999999877538845899817766189-----982655549999998776419


Q ss_pred             CEEEEECCCCCEE-------------------------------------------------------------------
Q ss_conf             5069737823303-------------------------------------------------------------------
Q gi|254780321|r  370 LNLIGTSPSVVYE-------------------------------------------------------------------  382 (606)
Q Consensus       370 ~ev~~t~P~V~Yk-------------------------------------------------------------------  382 (606)
                      +|+.+++|+|+||                                                                   
T Consensus       470 vev~~~~PqV~YrETi~~~~~~~~~~~kqsgg~~q~~~v~i~~EP~~~~~~~~f~~~i~~g~~P~~yi~~ve~G~~~a~~  549 (697)
T COG0480         470 VEVEVGKPQVAYRETIRKKSEVEGKHKKQSGGPGQYGHVYIEIEPLEDGSGFEFVDKIVGGVVPKEYIPAVEKGFREALK  549 (697)
T ss_pred             CEEEECCCEEEEEEEECCCCCCEEEEEECCCCCCCCCEEEEEEEECCCCCCEEEEEHHCCCCCCHHHHHHHHHHHHHHHH
T ss_conf             25893498168886614665430345303688985537999997589876417750005576726654778999999985


Q ss_pred             -------------EEEECCCEEECCC-HHHCCCHHHHH----------HHHCCEEEEEEEECCCCCHHHHHHHHHHHHEE
Q ss_conf             -------------3531564541269-66625867788----------86232699999808310003899988630014
Q gi|254780321|r  383 -------------LYMHDGSMQKLSN-PIDMPEVTKIA----------ELREPWIQVTIITPNEYLGSILKLCQERRGIQ  438 (606)
Q Consensus       383 -------------v~~~dG~~~~Vd~-p~~~p~~~~i~----------~i~EPi~~~~I~~P~ey~G~Vm~~l~~RRG~~  438 (606)
                                   +++.||++|.+|| +..|--+...+          .++|||++++|.+|++|+|+||+++++|||++
T Consensus       550 ~GpLag~pv~dvkv~L~dgs~h~vdss~~af~~a~~~a~~~a~~~a~P~lLEPi~~veI~~P~d~~G~V~~~l~~rRG~I  629 (697)
T COG0480         550 SGPLAGYPVVDVKVTLLDGSYHEVDSSEMAFKIAASLAFKEAMLKAKPVLLEPIMKVEITTPEEYMGDVIGDLNSRRGQI  629 (697)
T ss_pred             CCCCCCCCEEEEEEEEECCCCCCCCCCHHHHHHHHHHHHHHHHHHCCCEEECCEEEEEEECCHHHHCHHHHHHHHCCEEE
T ss_conf             59878971572699997475046888888999999999999986078668555279999743465231687663151598


Q ss_pred             ECCCCC-C-CEEEEEEEECHHHHHHHHHHHHHHHCCCEEEEEEEECCCEECC
Q ss_conf             244336-8-3699999960433322046876763574188898543546436
Q gi|254780321|r  439 IDMSHL-D-NRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDYRDSD  488 (606)
Q Consensus       439 ~~m~~~-~-~~~~i~~~vPl~Eli~~f~~~LkS~T~G~as~~ye~~~Y~~~d  488 (606)
                      .+|+.. + ....+++.+|++|+ +||.+.|+|+|+|+|+|+++|+||++..
T Consensus       630 ~~~~~~~~~~~~~i~A~vPl~Em-fgya~dLRs~T~Gra~~~m~f~~y~~vp  680 (697)
T COG0480         630 LGMEQRPGGGLDVIKAEVPLAEM-FGYATDLRSATQGRASFSMEFDHYEEVP  680 (697)
T ss_pred             ECCEECCCCCEEEEEEEECHHHH-CCCHHHHHHHCCCCEEEEEEECCCEECC
T ss_conf             43042268845999998366885-4533666754568616999735127378


No 15 
>KOG0465 consensus
Probab=100.00  E-value=0  Score=786.13  Aligned_cols=465  Identities=31%  Similarity=0.518  Sum_probs=407.5

Q ss_pred             CCCHHHCEEEEEECCCCCCHHHHHHHHHHHCCCCCCC---CCCCEEECCCHHHHHHCCEEEEEEEEEEEECCCCCEEEEE
Q ss_conf             9985253179998013898778899999982980544---4431130586779871950523279999743788438999
Q gi|254780321|r    5 PTPLSRIRNFSIVAHIDHGKSTLADRFIQHCRGLTER---EMSSQVLDNMDIERERGITIKAQTVRLNYTSTDAKDYQLN   81 (606)
Q Consensus         5 ~~p~~~IRN~~IiaHvDhGKTTL~d~lL~~tg~i~~~---~~~~~vlD~~~~EreRGITIka~~~~~~~~~~~~~~y~iN   81 (606)
                      ..|+++|||++|+||+|+|||||+||+||.+|.+..-   ..+..+||+|++||+|||||+|.++...|     ++|.||
T Consensus        33 ~~~~~k~RNIgi~AhidsgKTT~tEr~Lyy~G~~~~i~ev~~~~a~md~m~~er~rgITiqSAAt~~~w-----~~~~iN  107 (721)
T KOG0465          33 RIPLNKIRNIGISAHIDAGKTTLTERMLYYTGRIKHIGEVRGGGATMDSMELERQRGITIQSAATYFTW-----RDYRIN  107 (721)
T ss_pred             CCCHHHHCCCCEEEEEECCCCEEEHEEEEECCEEEECCCCCCCCEEEEHHHHHHHCCCEEEECEEEEEE-----CCCEEE
T ss_conf             574545100316999826985110200130220100232026760464277786538446412156640-----452067


Q ss_pred             EEECCCCCHHHHHHHHHHHHCCEEEEEEECCCCCCHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCCHHHHHHHHHHH-
Q ss_conf             9617873002799999997302689999868788655899999999709967998326788753211338887755532-
Q gi|254780321|r   82 LIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQAIDNNHEIITVLNKADLPSADPDRVKKQIEETIGI-  160 (606)
Q Consensus        82 lIDTPGH~DF~~EV~r~l~a~dgaiLvVdA~~Gvq~QT~~~~~~A~~~~l~~I~viNKiD~~~A~~e~v~~ei~~~~g~-  160 (606)
                      |||||||+||.-||+|+|++.|||++|+||+.|||+||..+|+.+...+.|.|.|||||||-+|+|-++.++|...++. 
T Consensus       108 iIDTPGHvDFT~EVeRALrVlDGaVlvl~aV~GVqsQt~tV~rQ~~ry~vP~i~FiNKmDRmGa~~~~~l~~i~~kl~~~  187 (721)
T KOG0465         108 IIDTPGHVDFTFEVERALRVLDGAVLVLDAVAGVESQTETVWRQMKRYNVPRICFINKMDRMGASPFRTLNQIRTKLNHK  187 (721)
T ss_pred             EECCCCCEEEEEEEHHHHHHCCCEEEEEECCCCEEHHHHHHHHHHHHCCCCEEEEEEHHHHCCCCHHHHHHHHHHHCCCC
T ss_conf             85489721579772002520567289997036511135689888876189759998616644797488999998622786


Q ss_pred             ---------------------------------------------------------------HH--------------H
Q ss_conf             ---------------------------------------------------------------23--------------2
Q gi|254780321|r  161 ---------------------------------------------------------------ST--------------E  163 (606)
Q Consensus       161 ---------------------------------------------------------------~~--------------~  163 (606)
                                                                                     |.              +
T Consensus       188 ~a~vqiPig~e~~f~GvvDlv~~kai~~~g~~g~~i~~~eIP~~l~~~~~e~R~~LIE~lad~DE~l~e~fLee~~ps~~  267 (721)
T KOG0465         188 PAVVQIPIGSESNFKGVVDLVNGKAIYWDGENGEIVRKDEIPEDLEELAEEKRQALIETLADVDETLAEMFLEEEEPSAQ  267 (721)
T ss_pred             HHEEECCCCCCCCCHHHHHHHHCEEEEECCCCCCEEEECCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCHH
T ss_conf             02267641445443147746322589971898754685569878999999999999999861168999998525899989


Q ss_pred             ----------------HHHHHHHHCCCCCCHHHHHHHHHHHCCCCHH------------------HHHC-CCCCCCCCEE
Q ss_conf             ----------------1000111002232006787763210001111------------------2201-2331012101
Q gi|254780321|r  164 ----------------DALLVSAKTGEGIPLLLERIVQQLPSPTSPE------------------GANA-PLKALLIDSW  208 (606)
Q Consensus       164 ----------------~ii~vSAktG~GV~~LLd~Iv~~iP~P~~~~------------------~~~~-Pl~alVfds~  208 (606)
                                      .+++.||..+.||++|||+|++|+|+|..-.                  ..|. ||-||.|+..
T Consensus       268 ~l~~aIRr~Ti~r~fvPVl~GSAlKNkGVQPlLDAVvdYLPsP~Ev~n~a~~ke~~~~ekv~l~~~~d~~Pfv~LAFKle  347 (721)
T KOG0465         268 QLKAAIRRATIKRSFVPVLCGSALKNKGVQPLLDAVVDYLPSPSEVENYALNKETNSKEKVTLSPSRDKDPFVALAFKLE  347 (721)
T ss_pred             HHHHHHHHHHHHCCEEEEEECHHHCCCCCCHHHHHHHHHCCCHHHHCCCCCCCCCCCCCCEEECCCCCCCCEEEEEEEEE
T ss_conf             99999998875155246775322235674158999987679936624510256788866467522788996033577764


Q ss_pred             ECCCCCEEEEEEECCCCCCCCCEEEEECCCCCCCCCCCCCCCCC-EEEEHHCCCCCHHHHHHCCCCCCCCCCCCEECCCC
Q ss_conf             14757259999816987355845887335564210122233554-12401012471233220110024444542000466
Q gi|254780321|r  209 YNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVERIGILTPK-MIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDS  287 (606)
Q Consensus       209 ~D~~~G~I~~~RV~sG~lk~Gd~I~~~~~g~~~~v~~ig~~~~~-~~~v~~l~aGdVG~ii~gik~l~~~~vGDTl~~~~  287 (606)
                      .++| |.+.|+|||+|+|++|+.|++.+++++.++.++..++.. +.++++++|||||++ .   ++ ++..|||+++..
T Consensus       348 ~g~f-GqLTyvRvYqG~L~kG~~iyN~rtgKKvrv~RL~rmHa~~medV~~v~AG~I~al-f---Gi-dcasGDTftd~~  421 (721)
T KOG0465         348 EGRF-GQLTYVRVYQGTLSKGDTIYNVRTGKKVRVGRLVRMHANDMEDVNEVLAGDICAL-F---GI-DCASGDTFTDKQ  421 (721)
T ss_pred             ECCC-CCEEEEEEEEEEECCCCEEEECCCCCEEEHHHHHHHCCCCCCCCCEEECCCEEEE-E---CC-CCCCCCEECCCC
T ss_conf             1674-5269999862166478678734778544667787750254452000102766888-5---23-335687122676


Q ss_pred             CCCCCCCCCCCCCCCEEEEEECCCCHHHHHHHHHHHHHHHHHCCCCCCC--CCCCCCCCCEEEEEECCHHHHHHHHHHHH
Q ss_conf             7853236455222212664212677024578899998886411221112--56760004202899637678988898886
Q gi|254780321|r  288 SPTTSALPGFKPIQPVVFCGLFPVDATQFENLRTAINKLRLNDASFSFE--LENSTALGFGFRCGFLGLLHLEIIQERLE  365 (606)
Q Consensus       288 ~p~~~~Lp~~~~~~P~v~~~i~p~~~~d~~~L~~aL~kL~~~D~sl~~e--~Ets~aLg~Gfr~gglG~LHLeVi~eRL~  365 (606)
                      +- .-.+..+.+|+|++++++.|.+.+|.+++.+||.|+..|||||++.  +|+.+++     ++|||||||||..|||+
T Consensus       422 ~~-~~~m~si~vPePVis~aikP~sk~d~~~fskaL~rf~~EDPtFrv~~D~E~kqTv-----IsGMGELHLEIy~eRl~  495 (721)
T KOG0465         422 NL-ALSMESIHIPEPVISVAIKPVNKKDADNFSKALNRFTKEDPTFRVSLDPEMKQTV-----ISGMGELHLEIYVERLV  495 (721)
T ss_pred             CC-CCEEEEEECCCCEEEEEECCCCCCCHHHHHHHHHHHCCCCCCEEEEECCCCCCEE-----HHCCCHHHHHHHHHHHH
T ss_conf             56-6125676669872788732367441789999997642249955888656556420-----10430356899999999


Q ss_pred             HHCCCEEEEECCCCCEE---------------------------------------------------------------
Q ss_conf             64495069737823303---------------------------------------------------------------
Q gi|254780321|r  366 REFSLNLIGTSPSVVYE---------------------------------------------------------------  382 (606)
Q Consensus       366 rEfg~ev~~t~P~V~Yk---------------------------------------------------------------  382 (606)
                      |||++++++++|+|.||                                                               
T Consensus       496 rEy~~~~~~Gkp~VayRETi~~~~~f~~~hKkqSgG~gqy~kv~g~~epl~~~~~~~~eF~~~~~g~~~P~~f~pa~ekg  575 (721)
T KOG0465         496 REYKVDAELGKPQVAYRETITSPVEFDYTHKKQSGGAGQYGKVEGVIEPLPPGSNEKFEFSDEIVGGNVPKQFIPAVEKG  575 (721)
T ss_pred             HHHCCCCCCCCCEEEEHHHCCCCCCCEEEECCCCCCCCCCCCEEEEEEECCCCCCCEEEEEECCCCCCCCHHHHHHHHHH
T ss_conf             98589640288336520121775543144024668876545114687624898872389971366898855577889889


Q ss_pred             -------------------EEEECCCEEECCC-HHHCCCHH--HHH--------HHHCCEEEEEEEECCCCCHHHHHHHH
Q ss_conf             -------------------3531564541269-66625867--788--------86232699999808310003899988
Q gi|254780321|r  383 -------------------LYMHDGSMQKLSN-PIDMPEVT--KIA--------ELREPWIQVTIITPNEYLGSILKLCQ  432 (606)
Q Consensus       383 -------------------v~~~dG~~~~Vd~-p~~~p~~~--~i~--------~i~EPi~~~~I~~P~ey~G~Vm~~l~  432 (606)
                                         ..+.||.+|+||| +..|-.++  .+.        .++||||+++|.+|+||+|.|+++++
T Consensus       576 ~~e~~~~G~L~ghpl~~~r~~l~Dga~h~vds~elaf~~at~~a~r~a~~~a~p~iLEPIM~Vevt~P~EfqG~Vi~~L~  655 (721)
T KOG0465         576 FEEIVAKGPLIGHPLSNLRIVLQDGAHHPVDSSELAFMKATRNAFREAFKRAPPRILEPIMNVEVTTPEEFQGTVIGDLN  655 (721)
T ss_pred             HHHHHHCCCCCCCCCCCEEEEEECCCCCCCCCCHHHHHHHHHHHHHHHHHHCCCCEEECCEEEEEECCHHHHHHHHHHHH
T ss_conf             99998569756870245189983488676650079999999999999987489402101013578465455235654455


Q ss_pred             HHHHEEECCCCCCCEEEEEEEECHHHHHHHHHHHHHHHCCCEEEEEEEECCCEEC
Q ss_conf             6300142443368369999996043332204687676357418889854354643
Q gi|254780321|r  433 ERRGIQIDMSHLDNRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDYRDS  487 (606)
Q Consensus       433 ~RRG~~~~m~~~~~~~~i~~~vPl~Eli~~f~~~LkS~T~G~as~~ye~~~Y~~~  487 (606)
                      +|+|.+.+.+.-++...|.+++||++| |+|.+.|+|+|+|.|.|+||+++|.|.
T Consensus       656 kR~a~I~~~d~~~~~~ti~A~VPL~~m-fgYss~LRslTqGkgeftMeys~y~p~  709 (721)
T KOG0465         656 KRKAQITGIDSSEDYKTIKAEVPLNEM-FGYSSELRSLTQGKGEFTMEYSRYSPV  709 (721)
T ss_pred             HCCCEEECCCCCCCEEEEEECCCHHHH-HHHHHHHHHHHCCCCEEEEEECCCCCC
T ss_conf             446379512477843999952667887-433466455526864378741124789


No 16 
>PRK00741 prfC peptide chain release factor 3; Provisional
Probab=100.00  E-value=0  Score=670.48  Aligned_cols=358  Identities=25%  Similarity=0.446  Sum_probs=312.2

Q ss_pred             CHHHCEEEEEECCCCCCHHHHHHHHHHHCCCCCCCC-------CCCEEECCCHHHHHHCCEEEEEEEEEEEECCCCCEEE
Q ss_conf             852531799980138987788999999829805444-------4311305867798719505232799997437884389
Q gi|254780321|r    7 PLSRIRNFSIVAHIDHGKSTLADRFIQHCRGLTERE-------MSSQVLDNMDIERERGITIKAQTVRLNYTSTDAKDYQ   79 (606)
Q Consensus         7 p~~~IRN~~IiaHvDhGKTTL~d~lL~~tg~i~~~~-------~~~~vlD~~~~EreRGITIka~~~~~~~~~~~~~~y~   79 (606)
                      .+++|||||||||+|||||||+|+||+.+|+|.+.+       .++.++|||++||||||||.|+.+++.|     ++|+
T Consensus         6 ei~~~RniaIi~H~dAGKTTLtE~lL~~~GaI~~~G~V~~~~~~~~~~sD~~~~E~~RgiSI~ssv~~~e~-----~~~~   80 (526)
T PRK00741          6 EVAKRRTFAIISHPDAGKTTLTEKLLLFGGAIQEAGTVKGRKSGRHATSDWMEMEKQRGISVTSSVMQFPY-----RDCL   80 (526)
T ss_pred             HHHCCCEEEEECCCCCCHHHHHHHHHHHCCCCCCCCEEECCCCCCCCCCCCCHHHHHCCCEEECCEEEEEE-----CCEE
T ss_conf             87611779999378989899999999746752448466314678864678858899759648615177867-----8989


Q ss_pred             EEEEECCCCCHHHHHHHHHHHHCCEEEEEEECCCCCCHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCCHHHHHHHHHH
Q ss_conf             99961787300279999999730268999986878865589999999970996799832678875321133888775553
Q gi|254780321|r   80 LNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQAIDNNHEIITVLNKADLPSADPDRVKKQIEETIG  159 (606)
Q Consensus        80 iNlIDTPGH~DF~~EV~r~l~a~dgaiLvVdA~~Gvq~QT~~~~~~A~~~~l~~I~viNKiD~~~A~~e~v~~ei~~~~g  159 (606)
                      |||||||||+||++||+|+|+|+||||+||||++|||+||+..|..|.++++|+|+||||||+++||+.++.++|++.+|
T Consensus        81 iNliDTPGh~DF~~e~~raL~a~D~Av~Vida~~GVe~qTe~~w~~~~~~~iP~i~FINKmDR~~ad~~~~l~ei~~~lg  160 (526)
T PRK00741         81 INLLDTPGHEDFSEDTYRTLTAVDSALMVIDAAKGVEPQTRKLMEVCRLRDTPIFTFINKLDRDGREPLELLDEIEEVLG  160 (526)
T ss_pred             EEEEECCCCHHHHHHHHHHHHHHCEEEEEEECCCCCCHHHHHHHHHHHHCCCCEEEEEECCCCCCCCHHHHHHHHHHHHC
T ss_conf             99990989467789999999873759999977755233368999998863998899996567678987898877888747


Q ss_pred             HHH-----------------------------------------------------------------------------
Q ss_conf             223-----------------------------------------------------------------------------
Q gi|254780321|r  160 IST-----------------------------------------------------------------------------  162 (606)
Q Consensus       160 ~~~-----------------------------------------------------------------------------  162 (606)
                      ..+                                                                             
T Consensus       161 ~~~~p~~~Pig~g~~F~GvvDl~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ee~el~~~~~~~~d~  240 (526)
T PRK00741        161 IACAPITWPIGMGKRFKGVYDLYNDEVELYQPGHGHTIQEFEIIKGLDNPELDEALGEDLAEQLREELELVQGASNEFDL  240 (526)
T ss_pred             CCCEEEEEECCCCCCEEEEEEECCCEEEECCCCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCH
T ss_conf             87368883036788603788801387998036778840466058778778999875389999755357777315551068


Q ss_pred             H--------HHHHHHHHCCCCCCHHHHHHHHHHHCCCCHH-------HHHCCCCCCCCCEE--ECC-CCCEEEEEEECCC
Q ss_conf             2--------1000111002232006787763210001111-------22012331012101--147-5725999981698
Q gi|254780321|r  163 E--------DALLVSAKTGEGIPLLLERIVQQLPSPTSPE-------GANAPLKALLIDSW--YNS-YLGVMVLVRIING  224 (606)
Q Consensus       163 ~--------~ii~vSAktG~GV~~LLd~Iv~~iP~P~~~~-------~~~~Pl~alVfds~--~D~-~~G~I~~~RV~sG  224 (606)
                      +        .++++||.++.||++|||+|++++|+|....       ..+.||.|+|||+.  .|| |+|+++|+||+||
T Consensus       241 ~~~~~G~l~PVf~GSA~~n~GV~~LLd~iv~~~PsP~~r~~~~~~v~p~~~~fsa~VFKiqanmDP~h~griaf~RV~SG  320 (526)
T PRK00741        241 EAFLAGELTPVFFGSALNNFGVQEFLDAFVEWAPAPQPRQTDERVVEPTEEKFSGFVFKIQANMDPKHRDRIAFMRVCSG  320 (526)
T ss_pred             HHHHCCCEEEEEEEECCCCCCHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCEEEEEEEECCCCCCCCEEEEEEEEEE
T ss_conf             99973980289962000365699999999997799877777765447877774359999984037542543799997511


Q ss_pred             CCCCCCEEEEECCCCCCCCCCCCCCC-CCEEEEHHCCCCCHHHHHHCCCCCCCCCCCCEECCCCCCCCCCCCCCCCCCCE
Q ss_conf             73558458873355642101222335-54124010124712332201100244445420004667853236455222212
Q gi|254780321|r  225 QLTKGQSIRLMGTNAKYQVERIGILT-PKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPV  303 (606)
Q Consensus       225 ~lk~Gd~I~~~~~g~~~~v~~ig~~~-~~~~~v~~l~aGdVG~ii~gik~l~~~~vGDTl~~~~~p~~~~Lp~~~~~~P~  303 (606)
                      +++.|+++++.++|++.++.++..|. .++.+++++.||||    .|+.++..+++|||||+.+...   ++++..+.|.
T Consensus       321 ~l~~g~~v~n~r~gk~eri~~l~~~~g~~r~~V~ea~AGDI----vgl~~~~~~~tGDTL~~~~~l~---~~~Ip~f~P~  393 (526)
T PRK00741        321 KFEKGMKVRHVRTGKDVRISNALTFMAQDREHVEEAYAGDI----IGLHNHGTIQIGDTFTEGEKLK---FTGIPNFAPE  393 (526)
T ss_pred             EECCCCEEEECCCCCEEEHHHHHHHHCCCCEEEEEECCCCE----EEECCCCCCCCCCEECCCCCCC---CCCCCCCCCC
T ss_conf             88579989852579536632677874435235138769989----9971666300375520688521---0688999975


Q ss_pred             EEEEECCCCHHHHHHHHHHHHHHHHHCCCCCCC-CCCCCCCCCEEEEEECCHHHHHHHHHHHHHHCCCEEEEECCCCCE
Q ss_conf             664212677024578899998886411221112-567600042028996376789888988866449506973782330
Q gi|254780321|r  304 VFCGLFPVDATQFENLRTAINKLRLNDASFSFE-LENSTALGFGFRCGFLGLLHLEIIQERLEREFSLNLIGTSPSVVY  381 (606)
Q Consensus       304 v~~~i~p~~~~d~~~L~~aL~kL~~~D~sl~~e-~Ets~aLg~Gfr~gglG~LHLeVi~eRL~rEfg~ev~~t~P~V~Y  381 (606)
                      +|+++.|.++.+.++|..+|.+|+++|++..+. .+|++.+     +||+|+|||||+++||+||||+|+.+.+.....
T Consensus       394 ~~~~v~~~~~~~~kkl~~gL~~L~EEd~~~v~~~~~t~e~i-----l~gmGeLHlEVv~~RLk~eygVev~~e~~~~~~  467 (526)
T PRK00741        394 LFRRVRLKNPLKQKQLQKGLVQLSEEGAVQVFRPLSNNDLI-----LGAVGQLQFEVVAHRLKNEYNVEAIYEPVGVAT  467 (526)
T ss_pred             EEEEEEECCHHHHHHHHHHHHHHCCCCCEEEEECCCCCCEE-----EEEECHHHHHHHHHHHHHHHCCEEEECCCCEEE
T ss_conf             57998879888899999999985547866988738899889-----997168899999999988739728971574379


No 17 
>TIGR00490 aEF-2 translation elongation factor aEF-2; InterPro: IPR004543   Translation elongation factors are responsible for two main processes during protein synthesis on the ribosome , , . EF1A (or EF-Tu) is responsible for the selection and binding of the cognate aminoacyl-tRNA to the A-site (acceptor site) of the ribosome. EF2 (or EF-G) is responsible for the translocation of the peptidyl-tRNA from the A-site to the P-site (peptidyl-tRNA site) of the ribosome, thereby freeing the A-site for the next aminoacyl-tRNA to bind. Elongation factors are responsible for achieving accuracy of translation and both EF1A and EF2 are remarkably conserved throughout evolution.   Elongation factor EF2 (EF-G) is a G-protein. It brings about the translocation of peptidyl-tRNA and mRNA through a ratchet-like mechanism: the binding of GTP-EF2 to the ribosome causes a counter-clockwise rotation in the small ribosomal subunit; the hydrolysis of GTP to GDP by EF2 and the subsequent release of EF2 causes a clockwise rotation of the small subunit back to the starting position , . This twisting action destabilises tRNA-ribosome interactions, freeing the tRNA to translocate along the ribosome upon GTP-hydrolysis by EF2. EF2 binding also affects the entry and exit channel openings for the mRNA, widening it when bound to enable the mRNA to translocate along the ribosome.   This entry represents archaeal EF2 proteins (also known as aEF2), which are more similar to eukaryotic EF2 than to bacterial EF2 (or EFG), both in sequence similarity and in sharing with eukaryotes the property of having a diphthamide (modified His) residue at a conserved position. The diphthamide can be ADP-ribosylated by diphtheria toxin in the presence of NAD.   More information about these proteins can be found at Protein of the Month: Elongation Factors .; GO: 0003746 translation elongation factor activity, 0005525 GTP binding, 0006414 translational elongation, 0005737 cytoplasm.
Probab=100.00  E-value=0  Score=592.98  Aligned_cols=466  Identities=27%  Similarity=0.464  Sum_probs=393.9

Q ss_pred             HHHCEEEEEECCCCCCHHHHHHHHHHHCCCCCCCCCCC-EEECCCHHHHHHCCEEEEEEEEEEEECCCCCEEEEEEEECC
Q ss_conf             52531799980138987788999999829805444431-13058677987195052327999974378843899996178
Q gi|254780321|r    8 LSRIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSS-QVLDNMDIERERGITIKAQTVRLNYTSTDAKDYQLNLIDTP   86 (606)
Q Consensus         8 ~~~IRN~~IiaHvDhGKTTL~d~lL~~tg~i~~~~~~~-~vlD~~~~EreRGITIka~~~~~~~~~~~~~~y~iNlIDTP   86 (606)
                      .+.|||++|+||+|||||||+|.||.-+|.++..-+++ .+||+.+.|++|||||.|.++++-+. ++|++|.|||||||
T Consensus        16 ~~~irniGi~ahidhGkttlsdnllaGaGmis~elaG~q~~ldfde~e~~rGiti~aanvsmvh~-yeG~~ylinlidtP   94 (724)
T TIGR00490        16 PEFIRNIGIVAHIDHGKTTLSDNLLAGAGMISEELAGEQLYLDFDEQEQERGITIDAANVSMVHE-YEGNEYLINLIDTP   94 (724)
T ss_pred             HHHHHHEEEEEEECCCCCHHHHHHHHCCCHHHHHHCCCCEEECCCHHHHHCCCEEEEEEEEEEEE-ECCCCEEEEEECCC
T ss_conf             12221000378631775112234442133234540564100024413523772676411567653-14750243331488


Q ss_pred             CCCHHHHHHHHHHHHCCEEEEEEECCCCCCHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCCHHHHHH-----------
Q ss_conf             730027999999973026899998687886558999999997099679983267887532113388877-----------
Q gi|254780321|r   87 GHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQAIDNNHEIITVLNKADLPSADPDRVKKQIE-----------  155 (606)
Q Consensus        87 GH~DF~~EV~r~l~a~dgaiLvVdA~~Gvq~QT~~~~~~A~~~~l~~I~viNKiD~~~A~~e~v~~ei~-----------  155 (606)
                      ||+||+|+|.|+++|+||+++||+|.+|++|||..+++.|+..+++++.||||+|+--.+.+-..+++.           
T Consensus        95 GhvdfGGdvtramra~dG~~vvv~aveG~mPqtetvlrqal~e~v~Pvlf~nkvdrli~el~l~~~~lq~r~~k~i~~~n  174 (724)
T TIGR00490        95 GHVDFGGDVTRAMRAVDGAIVVVCAVEGVMPQTETVLRQALKENVKPVLFINKVDRLINELKLTPEELQERLIKIIAEVN  174 (724)
T ss_pred             CCCCCCCHHHHHHHHHCCEEEEEEECCCCCCCHHHHHHHHHHHCCCEEEEEHHHHHHHHHHCCCHHHHHHHHHHHHHHHH
T ss_conf             62105624888877647638999502565761578999998731870677234788888624688899999999999999


Q ss_pred             HHH-HHHHH-------------HHHHHHH------------HCCCCC----------------------CHHHHHHHHHH
Q ss_conf             555-32232-------------1000111------------002232----------------------00678776321
Q gi|254780321|r  156 ETI-GISTE-------------DALLVSA------------KTGEGI----------------------PLLLERIVQQL  187 (606)
Q Consensus       156 ~~~-g~~~~-------------~ii~vSA------------ktG~GV----------------------~~LLd~Iv~~i  187 (606)
                      .++ .+.++             .+-+.||            ++|++.                      +-+|+.++.++
T Consensus       175 ~li~~m~P~~~~~~W~~~v~~Gs~afGsa~~nWa~~vP~~~~~Gi~f~~~~~~~~e~~~~ela~k~Pl~~v~l~mv~~hl  254 (724)
T TIGR00490       175 KLIKKMAPEEFKDKWKVRVEDGSVAFGSAYYNWAISVPIMKKTGITFKDIYKYIKEDKQKELAKKAPLHQVVLDMVIKHL  254 (724)
T ss_pred             HHHHHCCCCCHHCCCEEEECCCCCHHHHHHHHHEEECCCCCCCCCCHHHHHHHHHCCHHHHHHHHCCHHHHHHHHHHHHC
T ss_conf             99974176100000047651564101122210002044300137759999998630114557640658899999999744


Q ss_pred             HCCCCH-----------------------HHHHCCCCCCCCCEEECCCCCEEEEEEECCCCCCCCCEEEEECCCCCCCCC
Q ss_conf             000111-----------------------122012331012101147572599998169873558458873355642101
Q gi|254780321|r  188 PSPTSP-----------------------EGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVE  244 (606)
Q Consensus       188 P~P~~~-----------------------~~~~~Pl~alVfds~~D~~~G~I~~~RV~sG~lk~Gd~I~~~~~g~~~~v~  244 (606)
                      |+|...                       .||++|+..+|.+...|++.|.|+.+|+|+|.++.|+.++++....+.++.
T Consensus       255 PsP~e~q~~r~~~~W~Gd~~se~G~am~~~dP~GP~a~~~t~~~~~~~aG~~~~~r~y~G~i~~G~e~y~v~~~~k~~~q  334 (724)
T TIGR00490       255 PSPAEAQKYRIPVIWKGDLNSEAGKAMLNCDPEGPLAVMITKIVVDKHAGEVAVGRLYSGAIKKGSEVYLVDRKAKARIQ  334 (724)
T ss_pred             CCCHHHHHHHHHHHEECCCCCHHCCHHCCCCCCCCEEEEEEEEEEECCCCCEEEEEEECCEECCCCEEEEECCHHHCCEE
T ss_conf             89622444010010104654000542100489986144556556603668167755531500368668986430002112


Q ss_pred             CCCC-CCCCEEEEHHCCCCCHHHHHHCCCCCCCCCCCCEECCCCCCCCCCCCCCC-CCCCEEEEEECCCCHHHHHHHHHH
Q ss_conf             2223-35541240101247123322011002444454200046678532364552-222126642126770245788999
Q gi|254780321|r  245 RIGI-LTPKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFK-PIQPVVFCGLFPVDATQFENLRTA  322 (606)
Q Consensus       245 ~ig~-~~~~~~~v~~l~aGdVG~ii~gik~l~~~~vGDTl~~~~~p~~~~Lp~~~-~~~P~v~~~i~p~~~~d~~~L~~a  322 (606)
                      ++++ ++|+++++|++.||.|.+    +.+++++..|+|+|+.... ..|+.+++ ..+|+|.++++.+|+.|..+|-+.
T Consensus       335 ~v~~ymGP~r~~~d~~~aGni~a----~~G~k~a~aG~t~C~~~~~-~~~fe~~~h~sePv~t~a~eakn~~dlPkliev  409 (724)
T TIGR00490       335 QVGVYMGPERVEVDEIPAGNIVA----VVGLKEAVAGETICSTDKK-IKPFEAIKHISEPVVTVAIEAKNTKDLPKLIEV  409 (724)
T ss_pred             EEEEEECCEECCCCCCCCCCEEE----EEECCCCCCCCCCCCCHHH-HHHHHHHHHCCCCEEEEEEECCCCCCCHHHHHH
T ss_conf             46677667020124226775688----7403211145300252123-213343232047537999714675440589999


Q ss_pred             HHHHHHHCCCCCCC--CCCCCCCCCEEEEEECCHHHHHHHHHHHHHH-CCCEEEEECCCCCEEEEEECCCEEECC--CHH
Q ss_conf             98886411221112--5676000420289963767898889888664-495069737823303353156454126--966
Q gi|254780321|r  323 INKLRLNDASFSFE--LENSTALGFGFRCGFLGLLHLEIIQERLERE-FSLNLIGTSPSVVYELYMHDGSMQKLS--NPI  397 (606)
Q Consensus       323 L~kL~~~D~sl~~e--~Ets~aLg~Gfr~gglG~LHLeVi~eRL~rE-fg~ev~~t~P~V~Ykv~~~dG~~~~Vd--~p~  397 (606)
                      |.++..+||+++++  .||.+.|     +||+|+|||||..++..++ +++++.++.|-|.||.|...-+ -.|+  ||.
T Consensus       410 lr~~~~edPt~~~~~neetGehl-----~sGmGelh~e~~~~~~~~~~~~~~~~~~~Pivv~retv~G~~-~~ve~ksPn  483 (724)
T TIGR00490       410 LRQVAKEDPTVKVEINEETGEHL-----ISGMGELHLEIIVKKIREKDAGVEVETSEPIVVYRETVTGTS-PVVEGKSPN  483 (724)
T ss_pred             HHHHHCCCCEEEEEEECCCCCHH-----HHCCCHHHHHHHHHHHHHHHCCCEEEECCCEEEEECCCCCCC-CCCCCCCCC
T ss_conf             99741349727999704445123-----312222334556656644112303764485689710104766-632577872


Q ss_pred             --------------------------------------------------------------------------------
Q ss_conf             --------------------------------------------------------------------------------
Q gi|254780321|r  398 --------------------------------------------------------------------------------  397 (606)
Q Consensus       398 --------------------------------------------------------------------------------  397 (606)
                                                                                                      
T Consensus       484 khn~~y~~~eP~~~~v~q~~~eG~~~~~~~~~k~~~~~~~~l~~aG~~~eea~~~~~~ye~n~~~~~t~Gi~~l~e~~el  563 (724)
T TIGR00490       484 KHNRFYIVVEPLEESVLQAFKEGKIKDVKVKKKLDDEIAKELIEAGLDKEEAKRVEEVYEGNLFINVTRGIQYLDEVKEL  563 (724)
T ss_pred             CCCEEEEEEECCHHHHHHHHHCCCCEEHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHCCCEEEEHHHHHHHHHHHHHH
T ss_conf             21547899806337999886358500013444567899999987278867888999874053134224557889999999


Q ss_pred             -----------------------------------------HC-CCH-HHH--------HHHHCCEEEEEEEECCCCCHH
Q ss_conf             -----------------------------------------62-586-778--------886232699999808310003
Q gi|254780321|r  398 -----------------------------------------DM-PEV-TKI--------AELREPWIQVTIITPNEYLGS  426 (606)
Q Consensus       398 -----------------------------------------~~-p~~-~~i--------~~i~EPi~~~~I~~P~ey~G~  426 (606)
                                                               .+ |.. ..|        ..++||+-.+.|.+|.+|+|.
T Consensus       564 ~~~Gf~~am~~GP~a~e~~~G~k~kl~d~~~heda~hrGPaq~~Pa~r~~i~~a~~~a~P~lleP~q~~~i~~Pqd~mG~  643 (724)
T TIGR00490       564 ILEGFKEAMRNGPVAKEKVMGVKVKLVDAKLHEDAVHRGPAQVIPAVRKGIFAAMLQAEPVLLEPIQKVFINVPQDFMGA  643 (724)
T ss_pred             HHHHHHHHHHCCCCCCCCCCEEEEEEEEEEECHHHHCCCCHHHHHHHHHHHHHHHHHCCCCHHCCCEEEEEECCHHHHHH
T ss_conf             99989999742884210334058998631100223124702565888999999885058502132100134155145567


Q ss_pred             HHHHHHHHHHEEECCCCCCCEEEEEEEECHHHHHHHHHHHHHHHCCCEEEEEEEECCCEE
Q ss_conf             899988630014244336836999999604333220468767635741888985435464
Q gi|254780321|r  427 ILKLCQERRGIQIDMSHLDNRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDYRD  486 (606)
Q Consensus       427 Vm~~l~~RRG~~~~m~~~~~~~~i~~~vPl~Eli~~f~~~LkS~T~G~as~~ye~~~Y~~  486 (606)
                      ++..++.|||++.+|...|+.+.+.+.+|.+|| |||...+++.|+|++..+.|+.||+.
T Consensus       644 ~~rei~~rrGqi~~m~~eGdm~~~~~~~Pv~em-fGfaG~ir~at~G~~~Ws~e~aG~e~  702 (724)
T TIGR00490       644 ATREIQNRRGQILEMKQEGDMVTIKAKVPVAEM-FGFAGAIRGATEGRCLWSTEFAGFEK  702 (724)
T ss_pred             HHHHHHCCCCCEEEEECCCCEEEEEECCCHHHH-HCCCCCCCCCCCCCEEEEECCCCHHH
T ss_conf             887651257517764047857999724775774-02100101235772466411011453


No 18 
>KOG0464 consensus
Probab=100.00  E-value=0  Score=598.45  Aligned_cols=470  Identities=29%  Similarity=0.434  Sum_probs=388.6

Q ss_pred             CCCCHHHCEEEEEECCCCCCHHHHHHHHHHHCCCCCCC---CCCCEEECCCHHHHHHCCEEEEEEEEEEEECCCCCEEEE
Q ss_conf             89985253179998013898778899999982980544---443113058677987195052327999974378843899
Q gi|254780321|r    4 KPTPLSRIRNFSIVAHIDHGKSTLADRFIQHCRGLTER---EMSSQVLDNMDIERERGITIKAQTVRLNYTSTDAKDYQL   80 (606)
Q Consensus         4 ~~~p~~~IRN~~IiaHvDhGKTTL~d~lL~~tg~i~~~---~~~~~vlD~~~~EreRGITIka~~~~~~~~~~~~~~y~i   80 (606)
                      .+-|+.+||||+||||+|+||||.+||+||.+|.+..-   +.+++|.|+|++||||||||.|.++.+     +|+.|++
T Consensus        30 ~~p~~akirnigiiahidagktttterily~ag~~~s~g~vddgdtvtdfla~erergitiqsaav~f-----dwkg~ri  104 (753)
T KOG0464          30 INPAIAKIRNIGIIAHIDAGKTTTTERILYLAGAIHSAGDVDDGDTVTDFLAIERERGITIQSAAVNF-----DWKGHRI  104 (753)
T ss_pred             CCCCHHHHHCCEEEEEECCCCCHHHHHHHHHHHHHHCCCCCCCCCHHHHHHHHHHHCCCEEEEEEEEC-----CCCCCEE
T ss_conf             99836664113069985178740678899774022104656788537788888886483665404421-----2356167


Q ss_pred             EEEECCCCCHHHHHHHHHHHHCCEEEEEEECCCCCCHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCCHHHHHHHHHHH
Q ss_conf             99617873002799999997302689999868788655899999999709967998326788753211338887755532
Q gi|254780321|r   81 NLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQAIDNNHEIITVLNKADLPSADPDRVKKQIEETIGI  160 (606)
Q Consensus        81 NlIDTPGH~DF~~EV~r~l~a~dgaiLvVdA~~Gvq~QT~~~~~~A~~~~l~~I~viNKiD~~~A~~e~v~~ei~~~~g~  160 (606)
                      ||||||||+||.-||+|.+++.|||+.|+||..||||||..+|+.|-+.++|.+.||||||+-+|+++...+.|++.++.
T Consensus       105 nlidtpghvdf~leverclrvldgavav~dasagve~qtltvwrqadk~~ip~~~finkmdk~~anfe~avdsi~ekl~a  184 (753)
T KOG0464         105 NLIDTPGHVDFRLEVERCLRVLDGAVAVFDASAGVEAQTLTVWRQADKFKIPAHCFINKMDKLAANFENAVDSIEEKLGA  184 (753)
T ss_pred             EEECCCCCCEEEEEHHHHHHHHCCEEEEEECCCCCCCCEEEEEHHCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHCC
T ss_conf             65248884037987898887750738998456776641221000301357845330234666555466688999987387


Q ss_pred             --------------------------------------------------------------------------------
Q ss_conf             --------------------------------------------------------------------------------
Q gi|254780321|r  161 --------------------------------------------------------------------------------  160 (606)
Q Consensus       161 --------------------------------------------------------------------------------  160 (606)
                                                                                                      
T Consensus       185 k~l~l~lpi~eak~fnkg~ldil~ke~l~~ncnsndgkd~e~~plle~ndpel~e~~ae~knal~~qlad~~~dfad~~l  264 (753)
T KOG0464         185 KALKLQLPIGEAKGFNKGFLDILHKEKLLGNCNSNDGKDFENKPLLEKNDPELAEELAEAKNALCEQLADLDADFADKFL  264 (753)
T ss_pred             CEEEEEECCCCCCCCCCHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHCCHHHHHHHH
T ss_conf             41789701553245440279998874345777887544445786423489789999999999999988611277899999


Q ss_pred             ----------HHH----------------HHHHHHHHCCCCCCHHHHHHHHHHHCCCCHH-----HHHCCCCCCCCCEEE
Q ss_conf             ----------232----------------1000111002232006787763210001111-----220123310121011
Q gi|254780321|r  161 ----------STE----------------DALLVSAKTGEGIPLLLERIVQQLPSPTSPE-----GANAPLKALLIDSWY  209 (606)
Q Consensus       161 ----------~~~----------------~ii~vSAktG~GV~~LLd~Iv~~iP~P~~~~-----~~~~Pl~alVfds~~  209 (606)
                                +.+                .+++.||.++.||++|||++.-|+|+|....     .-...|+|+.|+...
T Consensus       265 def~~n~d~i~a~elksai~~lt~aq~a~~i~cgsaiknkgiqplldavtmylpspeernyeflqwykddlcalafkvlh  344 (753)
T KOG0464         265 DEFDENFDKIDAEELKSAIHELTCAQKAAPILCGSAIKNKGIQPLLDAVTMYLPSPEERNYEFLQWYKDDLCALAFKVLH  344 (753)
T ss_pred             HHHHCCCCCCCHHHHHHHHHHHHHHHHHCCEEHHHHHCCCCCCCHHHHHHHCCCCHHHCCHHHHHHHHHHHHHHHHHHHC
T ss_conf             87505533467899999999986663201222003440367651233443226883540227776520137777666530


Q ss_pred             CCCCCEEEEEEECCCCCCCCCEEEEECCCCCCCCCCCCC-CCCCEEEEHHCCCCCHHHHHHCCCCCCCCCCCCEECCCCC
Q ss_conf             475725999981698735584588733556421012223-3554124010124712332201100244445420004667
Q gi|254780321|r  210 NSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVERIGI-LTPKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSS  288 (606)
Q Consensus       210 D~~~G~I~~~RV~sG~lk~Gd~I~~~~~g~~~~v~~ig~-~~~~~~~v~~l~aGdVG~ii~gik~l~~~~vGDTl~~~~~  288 (606)
                      |..||.++|.|||+|+++.+..|.+.+...++.+.++.. |.-+..+++.+.||.|. +++   +++.+.+|||+...+.
T Consensus       345 dkqrg~l~fmriysgsi~~~~ai~nin~~~se~~~kl~~pfade~~~i~qlsagnia-lt~---glk~tatgdtivaska  420 (753)
T KOG0464         345 DKQRGPLSFMRIYSGSIHNNLAIFNINGMCSEGILKLFLPFADEHREIEQLSAGNIA-LTA---GLKHTATGDTIVASKA  420 (753)
T ss_pred             CCCCCCEEEEEEECCCCCCCEEEEECCCCCCCCHHHHHCCCHHHHHHHHHCCCCCEE-EEE---CCEEECCCCEEEECCH
T ss_conf             013486268998615446761366226653311176535541543102120346479-995---0143125776883305


Q ss_pred             C----------------------CCCCCCCCCCCCCEEEEEECCCCHHHHHHHHHHHHHHHHHCCCCCC--CCCCCCCCC
Q ss_conf             8----------------------5323645522221266421267702457889999888641122111--256760004
Q gi|254780321|r  289 P----------------------TTSALPGFKPIQPVVFCGLFPVDATQFENLRTAINKLRLNDASFSF--ELENSTALG  344 (606)
Q Consensus       289 p----------------------~~~~Lp~~~~~~P~v~~~i~p~~~~d~~~L~~aL~kL~~~D~sl~~--e~Ets~aLg  344 (606)
                      .                      ...-+.|++.|.|+.|+.|+|-+-+....+..||+.|+.+|||+.+  .+++.++. 
T Consensus       421 sa~aa~qk~~~egekk~~q~~daerll~agie~pd~vffc~iepps~~k~~d~ehale~lqredpslkir~d~dsgqti-  499 (753)
T KOG0464         421 SAEAAAQKAAGEGEKKHLQNKDAERLLFAGIEIPDAVFFCCIEPPSLRKLNDFEHALECLQREDPSLKIRFDPDSGQTI-  499 (753)
T ss_pred             HHHHHHHHHHCCCHHHCCCCCCCCCEEEECCCCCCCEEEEECCCCCCCCCHHHHHHHHHHHCCCCCEEEEECCCCCCEE-
T ss_conf             4899999861452343058764000256135578736899525853232134899999873238761687668888668-


Q ss_pred             CEEEEEECCHHHHHHHHHHHHHHCCCEEEEECCCCCEEEEEEC----------C---CEEE----C-----CCHHHCCC-
Q ss_conf             2028996376789888988866449506973782330335315----------6---4541----2-----69666258-
Q gi|254780321|r  345 FGFRCGFLGLLHLEIIQERLEREFSLNLIGTSPSVVYELYMHD----------G---SMQK----L-----SNPIDMPE-  401 (606)
Q Consensus       345 ~Gfr~gglG~LHLeVi~eRL~rEfg~ev~~t~P~V~Ykv~~~d----------G---~~~~----V-----d~p~~~p~-  401 (606)
                          +-|+||||+|++..|++||||+++-+++-+|.||.++.+          |   +.|.    +     ...+.+|. 
T Consensus       500 ----l~~~gelhie~ihdrikrey~ldtfig~lqvayre~i~~~lr~t~~ld~~lgdkk~~~~velear~~~tqa~ip~k  575 (753)
T KOG0464         500 ----LCGMGELHIEAIHDRIKREYGLDTFIGKLQVAYREMILEELRATAKLDDGLGDKKHLEFVELEARLEETQAHIPFK  575 (753)
T ss_pred             ----EECCCHHHHHHHHHHHHHHCCCHHEEHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCEEEEEEEEECCCCCCCCCE
T ss_conf             ----8506223299999998764073211106889999999998666664402434445633899986404543436513


Q ss_pred             --------------------------------------------------------------------------HHHHHH
Q ss_conf             --------------------------------------------------------------------------677888
Q gi|254780321|r  402 --------------------------------------------------------------------------VTKIAE  407 (606)
Q Consensus       402 --------------------------------------------------------------------------~~~i~~  407 (606)
                                                                                                ...-..
T Consensus       576 kiefe~~es~n~~~l~~sqeaie~g~~na~~~gpl~g~pi~~v~itl~~~~i~~gk~n~alisac~qkcvqealkkad~~  655 (753)
T KOG0464         576 KIEFELAESANEGLLDVSQEAIEEGCHNACLNGPLAGSPIHAVAITLHECIIHGGKINPALISACAQKCVQEALKKADKQ  655 (753)
T ss_pred             EEEEECCCCCCCHHHHHHHHHHHHHHHHHHHCCCCCCCCHHHEEEEEEEEEECCCCCCHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             67763101146134464799998667788856986688502025765777863885788999999999999998666677


Q ss_pred             HHCCEEEEEEEECC-CCCHHHHHHHHHHHHEEECCCCCC-CEE-EEEEEECHHHHHHHHHHHHHHHCCCEEEEEEEECCC
Q ss_conf             62326999998083-100038999886300142443368-369-999996043332204687676357418889854354
Q gi|254780321|r  408 LREPWIQVTIITPN-EYLGSILKLCQERRGIQIDMSHLD-NRA-MIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDY  484 (606)
Q Consensus       408 i~EPi~~~~I~~P~-ey~G~Vm~~l~~RRG~~~~m~~~~-~~~-~i~~~vPl~Eli~~f~~~LkS~T~G~as~~ye~~~Y  484 (606)
                      ++||.|+++|.+.. +|+.+|..++..|||.+.+++... +.+ ++.+-+||+|+ .+|...|+++|+|+|.|..+|.+|
T Consensus       656 l~eplm~lei~i~~dd~~qpiladl~qrr~~~e~~~aredneirri~~~lplaei-~~~s~~lrtltsg~a~~ale~~~y  734 (753)
T KOG0464         656 LLEPLMELEIEIANDDPLQPILADLAQRRAHFEEIDAREDNEIRRICAFLPLAEI-EGLSKTLRTLTSGFADFALEFRGY  734 (753)
T ss_pred             HHHHHHHEEEEEECCCCCCHHHHHHHHHHCCCHHCCCCCCCCHHEEEEEEEHHHH-HCHHHHHHHHHCCCCEEEEEECCH
T ss_conf             7554343289970489753789999986225011134343301314676457895-157888998744661179986001


Q ss_pred             EECC
Q ss_conf             6436
Q gi|254780321|r  485 RDSD  488 (606)
Q Consensus       485 ~~~d  488 (606)
                      +..+
T Consensus       735 qamn  738 (753)
T KOG0464         735 QAMN  738 (753)
T ss_pred             HHCC
T ss_conf             3158


No 19 
>COG4108 PrfC Peptide chain release factor RF-3 [Translation, ribosomal structure and biogenesis]
Probab=100.00  E-value=0  Score=496.14  Aligned_cols=359  Identities=25%  Similarity=0.446  Sum_probs=310.2

Q ss_pred             CHHHCEEEEEECCCCCCHHHHHHHHHHHCCCCCCC-------CCCCEEECCCHHHHHHCCEEEEEEEEEEEECCCCCEEE
Q ss_conf             85253179998013898778899999982980544-------44311305867798719505232799997437884389
Q gi|254780321|r    7 PLSRIRNFSIVAHIDHGKSTLADRFIQHCRGLTER-------EMSSQVLDNMDIERERGITIKAQTVRLNYTSTDAKDYQ   79 (606)
Q Consensus         7 p~~~IRN~~IiaHvDhGKTTL~d~lL~~tg~i~~~-------~~~~~vlD~~~~EreRGITIka~~~~~~~~~~~~~~y~   79 (606)
                      .+.+-|+||||+|-|+|||||+|.||...|+|...       .......|||++||||||+|.|+..++.|     +++.
T Consensus         8 Ev~rRRTFAIISHPDAGKTTlTEkLLlfGgaIq~AGtVk~rk~~~~a~SDWM~iEkqRGISVtsSVMqF~Y-----~~~~   82 (528)
T COG4108           8 EVARRRTFAIISHPDAGKTTLTEKLLLFGGAIQEAGTVKGRKSGKHAKSDWMEIEKQRGISVTSSVMQFDY-----ADCL   82 (528)
T ss_pred             HHHHHCCEEEEECCCCCCCCHHHHHHHHCCHHHHCCEEEECCCCCCCCCHHHHHHHHCCCEEEEEEEEEEC-----CCEE
T ss_conf             98643403688568888511889999723034305501222577634227788887568558765787603-----8848


Q ss_pred             EEEEECCCCCHHHHHHHHHHHHCCEEEEEEECCCCCCHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCCHHHHHHHHHH
Q ss_conf             99961787300279999999730268999986878865589999999970996799832678875321133888775553
Q gi|254780321|r   80 LNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQAIDNNHEIITVLNKADLPSADPDRVKKQIEETIG  159 (606)
Q Consensus        80 iNlIDTPGH~DF~~EV~r~l~a~dgaiLvVdA~~Gvq~QT~~~~~~A~~~~l~~I~viNKiD~~~A~~e~v~~ei~~~~g  159 (606)
                      +||+|||||.||+...+|.|.|+|+||+||||..|+++||+..+..+...++||+.|||||||++-+|-+..+||++.++
T Consensus        83 iNLLDTPGHeDFSEDTYRtLtAvDsAvMVIDaAKGiE~qT~KLfeVcrlR~iPI~TFiNKlDR~~rdP~ELLdEiE~~L~  162 (528)
T COG4108          83 VNLLDTPGHEDFSEDTYRTLTAVDSAVMVIDAAKGIEPQTLKLFEVCRLRDIPIFTFINKLDREGRDPLELLDEIEEELG  162 (528)
T ss_pred             EECCCCCCCCCCCHHHHHHHHHHHEEEEEEECCCCCCHHHHHHHHHHHHCCCCEEEEEECCCCCCCCHHHHHHHHHHHHC
T ss_conf             86147998654323678999864104689860358668899999998505984699750236566886899999999857


Q ss_pred             HHHH----------------------------------------------------------------------------
Q ss_conf             2232----------------------------------------------------------------------------
Q gi|254780321|r  160 ISTE----------------------------------------------------------------------------  163 (606)
Q Consensus       160 ~~~~----------------------------------------------------------------------------  163 (606)
                      +++.                                                                            
T Consensus       163 i~~~PitWPIG~gk~F~Gvy~l~~~~v~~y~~~~~~~~~~~~~~~~~~~p~~~~~l~~~~~~~~~ee~EL~~~a~~~Fd~  242 (528)
T COG4108         163 IQCAPITWPIGMGKDFKGVYHLYNDEVELYESGHTDQERRADIVKGLDNPELDALLGEDLAEQLREELELVQGAGNEFDL  242 (528)
T ss_pred             CCEECCCCCCCCCCCCCEEEEECCCEEEEECCCCCCCCCCCCCCCCCCCHHHHHHHCHHHHHHHHHHHHHHHHHCCCCCH
T ss_conf             75035524456885643223503587998426777654434444578886777762447999999999999741332088


Q ss_pred             ---------HHHHHHHHCCCCCCHHHHHHHHHHHCCCCHHH-------HHCCCCCCCCCEE--ECC-CCCEEEEEEECCC
Q ss_conf             ---------10001110022320067877632100011112-------2012331012101--147-5725999981698
Q gi|254780321|r  164 ---------DALLVSAKTGEGIPLLLERIVQQLPSPTSPEG-------ANAPLKALLIDSW--YNS-YLGVMVLVRIING  224 (606)
Q Consensus       164 ---------~ii~vSAktG~GV~~LLd~Iv~~iP~P~~~~~-------~~~Pl~alVfds~--~D~-~~G~I~~~RV~sG  224 (606)
                               .+++.||.++.||+.+||+++++.|+|.....       .+..|.++||+..  +|| ||.+|+++||+||
T Consensus       243 ~~fl~G~~TPVFFGSAl~NFGV~~~L~~~~~~AP~P~~r~~~~~~v~p~e~kfsGFVFKIQANMDp~HRDRIAFmRV~SG  322 (528)
T COG4108         243 EAFLAGELTPVFFGSALGNFGVDHFLDALVDWAPSPRARQADTREVEPTEDKFSGFVFKIQANMDPKHRDRIAFMRVCSG  322 (528)
T ss_pred             HHHHCCCCCCEEEHHHHHCCCHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCEEEEEEECCCCCCCCCCEEEEEECCC
T ss_conf             98856960115703323115889999999963899865446667316887754348999974899433420367863056


Q ss_pred             CCCCCCEEEEECCCCCCCCCCC-CCCCCCEEEEHHCCCCCHHHHHHCCCCCCCCCCCCEECCCCCCCCCCCCCCCCCCCE
Q ss_conf             7355845887335564210122-233554124010124712332201100244445420004667853236455222212
Q gi|254780321|r  225 QLTKGQSIRLMGTNAKYQVERI-GILTPKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPV  303 (606)
Q Consensus       225 ~lk~Gd~I~~~~~g~~~~v~~i-g~~~~~~~~v~~l~aGdVG~ii~gik~l~~~~vGDTl~~~~~p~~~~Lp~~~~~~P~  303 (606)
                      +..+||++...++|+..++... ..|...+..+++++|||    |.|+.+....++|||+|..+.-.-.++|.|.   |-
T Consensus       323 kferGMk~~~~rtgK~~~ls~~~~f~A~dRe~ve~A~aGD----IIGl~nhGt~~IGDT~t~Ge~~~f~giP~Fa---PE  395 (528)
T COG4108         323 KFERGMKVTHVRTGKDVKLSDALTFMAQDRETVEEAYAGD----IIGLHNHGTIQIGDTFTEGEKLKFTGIPNFA---PE  395 (528)
T ss_pred             CCCCCCEEEEEECCCCEEECCCHHHHHHHHHHHHHCCCCC----EEECCCCCCEEECCEECCCCEEEECCCCCCC---HH
T ss_conf             4358865330244872561610767642166575426877----6714678721326663158556536899879---99


Q ss_pred             EEEEECCCCHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCEEEEEECCHHHHHHHHHHHHHHCCCEEEEECCCCCE
Q ss_conf             664212677024578899998886411221112567600042028996376789888988866449506973782330
Q gi|254780321|r  304 VFCGLFPVDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERLEREFSLNLIGTSPSVVY  381 (606)
Q Consensus       304 v~~~i~p~~~~d~~~L~~aL~kL~~~D~sl~~e~Ets~aLg~Gfr~gglG~LHLeVi~eRL~rEfg~ev~~t~P~V~Y  381 (606)
                      +|+.+.-+|...+.+|+.+|.+|++|-..-.|.+..+..    ..+|..|.||+||+++||+.|||+|++..+-.+.+
T Consensus       396 lfrrvrlkd~~K~Kql~Kgl~QL~eEGavQ~f~p~~~~d----~IlGAVG~LQFeV~~~RL~~EY~ve~~~e~~~~~~  469 (528)
T COG4108         396 LFRRVRLKDPLKQKQLKKGLEQLAEEGAVQVFKPLDGND----LILGAVGQLQFEVVQARLKNEYNVEAVFEPVNFST  469 (528)
T ss_pred             HHHHHHCCCHHHHHHHHHHHHHHHHCCEEEEECCCCCCC----CEEEEECCHHHHHHHHHHHHHHCCEEEEEECCCEE
T ss_conf             999886178688899999999986557569960377888----65874100137999999876518707874055148


No 20 
>KOG0469 consensus
Probab=100.00  E-value=0  Score=487.72  Aligned_cols=479  Identities=29%  Similarity=0.423  Sum_probs=363.0

Q ss_pred             HHCEEEEEECCCCCCHHHHHHHHHHHCCCCCC-CCCCCEEECCCHHHHHHCCEEEEEEEEEEEE-----------CCCCC
Q ss_conf             25317999801389877889999998298054-4443113058677987195052327999974-----------37884
Q gi|254780321|r    9 SRIRNFSIVAHIDHGKSTLADRFIQHCRGLTE-REMSSQVLDNMDIERERGITIKAQTVRLNYT-----------STDAK   76 (606)
Q Consensus         9 ~~IRN~~IiaHvDhGKTTL~d~lL~~tg~i~~-~~~~~~vlD~~~~EreRGITIka~~~~~~~~-----------~~~~~   76 (606)
                      .||||+++|||||||||||+|.|...+|.|+. +....+++|+-.-|+||||||||.++++.|.           ..+++
T Consensus        17 ~NiRNmSVIAHVDHGKSTLTDsLV~kAgIis~akaGe~Rf~DtRkDEQeR~iTIKStAISl~~e~~~~dl~~~k~~~d~~   96 (842)
T KOG0469          17 KNIRNMSVIAHVDHGKSTLTDSLVQKAGIISAAKAGETRFTDTRKDEQERGITIKSTAISLFFEMSDDDLKFIKQEGDGN   96 (842)
T ss_pred             CCCCCCEEEEEECCCCCHHHHHHHHHHCEEEECCCCCCCCCCCCCCHHHCCEEEEEEEEEEHHHHHHHHHHHHCCCCCCC
T ss_conf             35442048998437855006778776151241226785124341015655657632013201213176799851778776


Q ss_pred             EEEEEEEECCCCCHHHHHHHHHHHHCCEEEEEEECCCCCCHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCCHHHHHHH
Q ss_conf             38999961787300279999999730268999986878865589999999970996799832678875321133888775
Q gi|254780321|r   77 DYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQAIDNNHEIITVLNKADLPSADPDRVKKQIEE  156 (606)
Q Consensus        77 ~y~iNlIDTPGH~DF~~EV~r~l~a~dgaiLvVdA~~Gvq~QT~~~~~~A~~~~l~~I~viNKiD~~~A~~e~v~~ei~~  156 (606)
                      .+.|||||.|||+||+.||..+|++.||||.|||+.+||-.||..++.+|+...+++++|+|||||.--+.+--.+++.+
T Consensus        97 ~FLiNLIDSPGHVDFSSEVTAALRVTDGALVVVDcv~GvCVQTETVLrQA~~ERIkPvlv~NK~DRAlLELq~~~EeLyq  176 (842)
T KOG0469          97 GFLINLIDSPGHVDFSSEVTAALRVTDGALVVVDCVSGVCVQTETVLRQAIAERIKPVLVMNKMDRALLELQLSQEELYQ  176 (842)
T ss_pred             CEEEEECCCCCCCCCHHHHHHEEEECCCCEEEEECCCCEEECHHHHHHHHHHHHCCCEEEEEHHHHHHHHHCCCHHHHHH
T ss_conf             33689516898545234423104732670899972474485259999999874335247741466788861378999999


Q ss_pred             H-------------------------------------------------------HHHHHH------------------
Q ss_conf             5-------------------------------------------------------532232------------------
Q gi|254780321|r  157 T-------------------------------------------------------IGISTE------------------  163 (606)
Q Consensus       157 ~-------------------------------------------------------~g~~~~------------------  163 (606)
                      .                                                       |+++..                  
T Consensus       177 tf~R~VE~vNviisTy~d~~~g~~~v~P~kg~v~F~SGLhGWaFTlrQFa~~Y~~KF~~~~~kmm~~LWg~~~f~~ktkk  256 (842)
T KOG0469         177 TFQRIVENVNVIISTYGDGPMGDVQVDPEKGTVGFGSGLHGWAFTLRQFAEMYAKKFGIDVRKMMNRLWGDNFFNPKTKK  256 (842)
T ss_pred             HHHHHHHCCCEEEEECCCCCCCCEEECCCCCCEEECCCCCHHHHHHHHHHHHHHHHHCCCHHHHHHHHHCCCCCCCCCCC
T ss_conf             99999732317998414677673475377771100355411454599999999998287699999976401356866776


Q ss_pred             --------------------------------------HH----------HHHHHHCCCC--------------CCHHHH
Q ss_conf             --------------------------------------10----------0011100223--------------200678
Q gi|254780321|r  164 --------------------------------------DA----------LLVSAKTGEG--------------IPLLLE  181 (606)
Q Consensus       164 --------------------------------------~i----------i~vSAktG~G--------------V~~LLd  181 (606)
                                                            ++          +..--|++.|              -+.||+
T Consensus       257 ~~~s~t~~~gn~~~r~F~~~iLdPIykvfdaimN~kkeei~~llekl~v~lk~~~kd~eGK~LlK~vMr~wLPAadalle  336 (842)
T KOG0469         257 WSKSATDAEGNPLRRAFCMFILDPIYKVFDAIMNFKKEEIATLLEKLEVTLKGDEKDLEGKALLKVVMRKWLPAADALLE  336 (842)
T ss_pred             CCCCCCCCCCCCCCCCEEEEEECHHHHHHHHHHHCCHHHHHHHHHHHCCEECCCCCCCCCHHHHHHHHHHHCCHHHHHHH
T ss_conf             43323454468555641577603689999998601288899999974133125203665438999999974562888999


Q ss_pred             HHHHHHHCCCCH-----------------------HHHHCCCCCCCCCEEECCCCCE-EEEEEECCCCCCCCCEEEEECC
Q ss_conf             776321000111-----------------------1220123310121011475725-9999816987355845887335
Q gi|254780321|r  182 RIVQQLPSPTSP-----------------------EGANAPLKALLIDSWYNSYLGV-MVLVRIINGQLTKGQSIRLMGT  237 (606)
Q Consensus       182 ~Iv~~iP~P~~~-----------------------~~~~~Pl~alVfds~~D~~~G~-I~~~RV~sG~lk~Gd~I~~~~~  237 (606)
                      .|.-++|+|...                       -++++|+.++|.+..-.+-+|+ ++++|||||++..|+++++...
T Consensus       337 mIalhLPSPvtaQkyR~e~LYEGP~DDe~a~aik~CD~~aplmmYvSKMvPtsDkgRFyAFGRVFsG~v~~G~KvRiqgP  416 (842)
T KOG0469         337 MIALHLPSPVTAQKYRAEYLYEGPADDEAAVAIKNCDPKAPLMMYVSKMVPTSDKGRFYAFGRVFSGKVFTGLKVRIQGP  416 (842)
T ss_pred             HHHHHCCCCHHHHHHHHHHHHCCCCCHHHHHHHHCCCCCCCEEEEEEECCCCCCCCEEEEEEEEECCEECCCCEEEEECC
T ss_conf             99852899057888889876118873577667652699987277564016557874279973344230136857887589


Q ss_pred             C----CCCC-----CCCCCCCCCC-EEEEHHCCCCCHHHHHHCCCCCCCCCC-CCEECCCCCCCCCCCCCCCCCCCEEEE
Q ss_conf             5----6421-----0122233554-124010124712332201100244445-420004667853236455222212664
Q gi|254780321|r  238 N----AKYQ-----VERIGILTPK-MIDIEALYPGEIGVMIASIKEVSHTRV-GDTITDDSSPTTSALPGFKPIQPVVFC  306 (606)
Q Consensus       238 g----~~~~-----v~~ig~~~~~-~~~v~~l~aGdVG~ii~gik~l~~~~v-GDTl~~~~~p~~~~Lp~~~~~~P~v~~  306 (606)
                      +    ++..     +.+.-.|.+. -.+++..-||.    |+|+-++++.-+ +-|||..+.......-.|. ..|+|-.
T Consensus       417 nY~PGkkedl~~K~iqRtvlMMGr~vepied~PaGN----IiGlvGvDqfLvKtGTiTt~e~AHNmrvMKFS-VSPVV~V  491 (842)
T KOG0469         417 NYVPGKKEDLYIKAIQRTVLMMGRFVEPIEDCPAGN----IIGLVGVDQFLVKTGTITTSEAAHNMRVMKFS-VSPVVRV  491 (842)
T ss_pred             CCCCCCHHHHHHHHHHHHHHHHCCCCCCCCCCCCCC----EEEEEEHHHHHHCCCCEEEHHHHCCCEEEEEE-CCCEEEE
T ss_conf             989970888889899999998626555456698875----77785166764304723205541231478862-2641899


Q ss_pred             EECCCCHHHHHHHHHHHHHHHHHCCCCCCCC-CCCCCCCCEEEEEECCHHHHHHHHHHHHHHC-CCEEEEECCCCCEEEE
Q ss_conf             2126770245788999988864112211125-6760004202899637678988898886644-9506973782330335
Q gi|254780321|r  307 GLFPVDATQFENLRTAINKLRLNDASFSFEL-ENSTALGFGFRCGFLGLLHLEIIQERLEREF-SLNLIGTSPSVVYELY  384 (606)
Q Consensus       307 ~i~p~~~~d~~~L~~aL~kL~~~D~sl~~e~-Ets~aLg~Gfr~gglG~LHLeVi~eRL~rEf-g~ev~~t~P~V~Ykv~  384 (606)
                      +++++|..|..||.++|.||+..||....+. |+.+..     +.|-|+|||||.+.-|+..| ++.+..+.|-|.||.+
T Consensus       492 AVe~Knp~DLpKLvEGLkrLakSDP~v~~~~~esGehi-----iAgaGeLHLEICLkDLeedhA~iPlk~sdPvVsYrEt  566 (842)
T KOG0469         492 AVEAKNPADLPKLVEGLKRLAKSDPMVQCIIEESGEHI-----IAGAGELHLEICLKDLEEDHACIPLKKSDPVVSYRET  566 (842)
T ss_pred             EEECCCHHHHHHHHHHHHHHHCCCCEEEEEECCCCCEE-----EECCCHHHHHHHHHHHHHCCCCCCEECCCCEEEEECC
T ss_conf             98327834648899999877426984999962688547-----8515502179887667650047740058980563200


Q ss_pred             EECCCEE--------------------------ECC----CHH-HC-------------------------CCH------
Q ss_conf             3156454--------------------------126----966-62-------------------------586------
Q gi|254780321|r  385 MHDGSMQ--------------------------KLS----NPI-DM-------------------------PEV------  402 (606)
Q Consensus       385 ~~dG~~~--------------------------~Vd----~p~-~~-------------------------p~~------  402 (606)
                      ...-+-.                          .++    ||- +|                         |+.      
T Consensus       567 vs~~ss~~~lsKSpNKHNRi~mtaeP~~~~l~~~i~~g~v~~rd~fK~rAr~~aeky~~dvt~aRKIWCfgPd~tg~Nll  646 (842)
T KOG0469         567 VSEESSQTCLSKSPNKHNRIYMTAEPMDDGLSDDIENGKVNARDEFKARARILAEKYGWDVTEARKIWCFGPDGTGPNLL  646 (842)
T ss_pred             CCCCCCHHHHCCCCCCCCEEEEECCCCCCHHHHHHHCCCCCHHHHHHHHHHHHHHHHCCCHHHHHEEEEECCCCCCCCEE
T ss_conf             25510024531598624636885035872144565348658167899999988987287515332346767899997378


Q ss_pred             ----------HHHH--------------------------------------------------------------HHHC
Q ss_conf             ----------7788--------------------------------------------------------------8623
Q gi|254780321|r  403 ----------TKIA--------------------------------------------------------------ELRE  410 (606)
Q Consensus       403 ----------~~i~--------------------------------------------------------------~i~E  410 (606)
                                +.|.                                                              .+.|
T Consensus       647 ~D~TK~vqylnEIKdsVvagFqwA~keG~l~~E~mRgvrfni~DvtLHADAIHRGggQiipt~rr~~ya~~l~A~P~l~E  726 (842)
T KOG0469         647 VDQTKGVQYLNEIKDSVVAGFQWATKEGPLFGENMRGVRFNILDVTLHADAIHRGGGQIIPTARRVLYASVLTAGPILQE  726 (842)
T ss_pred             EECCHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCEEEEEEEEEEEHHHHHCCCCEECHHHHHHHHHHHHHCCCEECC
T ss_conf             85212668999888989888777750687410010230577666566644565278703627899999988715862117


Q ss_pred             CEEEEEEEECCCCCHHHHHHHHHHHHEEECCCCCC--CEEEEEEEECHHHHHHHHHHHHHHHCCCEEEEEEEECCCEECC
Q ss_conf             26999998083100038999886300142443368--3699999960433322046876763574188898543546436
Q gi|254780321|r  411 PWIQVTIITPNEYLGSILKLCQERRGIQIDMSHLD--NRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDYRDSD  488 (606)
Q Consensus       411 Pi~~~~I~~P~ey~G~Vm~~l~~RRG~~~~m~~~~--~~~~i~~~vPl~Eli~~f~~~LkS~T~G~as~~ye~~~Y~~~d  488 (606)
                      |+..++|.||+.|+|.|-+-+++|||...+-++.-  ...++++-+|..|- |+|..+|||.|.|.|--.+.|+||..  
T Consensus       727 PvylvEIq~pe~avGgiy~vLn~kRG~v~~e~q~~Gtp~f~vkayLPVnES-FgFt~dLrs~t~GqAfpq~vFdHws~--  803 (842)
T KOG0469         727 PVYLVEIQCPEQAVGGIYGVLNRKRGHVFEEEQVPGTPMFVVKAYLPVNES-FGFTADLRSNTGGQAFPQMVFDHWSI--  803 (842)
T ss_pred             CEEEEEEECCHHHHCHHHHEEECCCCCEECCCCCCCCCCEEEEEEEECCCC-CCCCHHHHCCCCCCCCCCEEEECCCC--
T ss_conf             468999867145302112010015542001121689862689998522434-46646553166776554024310333--


Q ss_pred             EEEEEEEECCCCCCEEEEE
Q ss_conf             6797488628824356874
Q gi|254780321|r  489 LVKLTILVNNETIDALSIL  507 (606)
Q Consensus       489 lvk~~ilin~~~vdals~i  507 (606)
                             +.|+|-|+-|..
T Consensus       804 -------lpgdp~dp~sk~  815 (842)
T KOG0469         804 -------LPGDPLDPTSKP  815 (842)
T ss_pred             -------CCCCCCCCCCCC
T ss_conf             -------799988987661


No 21 
>TIGR00503 prfC peptide chain release factor 3; InterPro: IPR004548   Peptide chain release factor 3 increases the formation of ribosomal termination complexes and stimulates activity of RF-1 and RF-2. It binds to guanine nucleotides and has a strong preference for UGA stop codons. This translation releasing factor, RF-3 (prfC) was originally described as stop codon-independent, in contrast to peptide chain release factor 1 (RF-1, prfA) and RF-2 (prfB). RF-1 and RF-2 are closely related to each other, while RF-3 is similar to elongation factors EF-Tu and EF-G; RF-1 is active at UAA and UAG and RF-2 is active at UAA and UGA. All bacteria and organelles have RF-1. The Mycoplasmas and organelles, which translate UGA as Trp rather than as a stop codon, lack RF-2. RF-3, in contrast, seems to be rare among bacteria and is found so far only in Escherichia coli and some other gamma subdivision Proteobacteria, in Synechocystis sp. (strain PCC 6803), and in Staphylococcus aureus.; GO: 0005525 GTP binding, 0016149 translation release factor activity codon specific, 0006415 translational termination, 0005737 cytoplasm.
Probab=100.00  E-value=0  Score=462.25  Aligned_cols=361  Identities=24%  Similarity=0.421  Sum_probs=309.5

Q ss_pred             CCCHHHCEEEEEECCCCCCHHHHHHHHHHHC------CCCCCCCC-CCEEECCCHHHHHHCCEEEEEEEEEEEECCCCCE
Q ss_conf             9985253179998013898778899999982------98054444-3113058677987195052327999974378843
Q gi|254780321|r    5 PTPLSRIRNFSIVAHIDHGKSTLADRFIQHC------RGLTEREM-SSQVLDNMDIERERGITIKAQTVRLNYTSTDAKD   77 (606)
Q Consensus         5 ~~p~~~IRN~~IiaHvDhGKTTL~d~lL~~t------g~i~~~~~-~~~vlD~~~~EreRGITIka~~~~~~~~~~~~~~   77 (606)
                      =.++++-||||||.|-|+|||||+|.+|..-      |++..|.+ ...-.|||+.|++|||+|.+...++.|     ++
T Consensus         5 L~EV~~RR~FAIISHPDAGKTT~TEK~LLyG~AIQ~AG~VK~r~S~~~A~SDWM~ME~QRGISIT~~VlQF~Y-----~~   79 (530)
T TIGR00503         5 LKEVDKRRTFAIISHPDAGKTTLTEKVLLYGGAIQTAGAVKGRGSQRHAKSDWMEMEKQRGISITTSVLQFPY-----RD   79 (530)
T ss_pred             HHHHHHCCCEEEEECCCCCCHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCHHHHHHHHCCCCEEEEEEEEECC-----CC
T ss_conf             5788502554366168887424678888742566522441220012212213788750588144412774145-----77


Q ss_pred             EEEEEEECCCCCHHHHHHHHHHHHCCEEEEEEECCCCCCHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCCHHHHHHHH
Q ss_conf             89999617873002799999997302689999868788655899999999709967998326788753211338887755
Q gi|254780321|r   78 YQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQAIDNNHEIITVLNKADLPSADPDRVKKQIEET  157 (606)
Q Consensus        78 y~iNlIDTPGH~DF~~EV~r~l~a~dgaiLvVdA~~Gvq~QT~~~~~~A~~~~l~~I~viNKiD~~~A~~e~v~~ei~~~  157 (606)
                      ..+||+|||||.|||.+..|.|.|+|.||+||||..|++.||+.-+..+....+||+.||||+|||.-+|-+..+|||..
T Consensus        80 ~l~NLLDTPGH~DFSEDTYRTL~A~D~~~M~IDaAKG~E~~T~KL~EV~RLR~~PI~TF~NKLDR~~~~P~ELlDEvE~~  159 (530)
T TIGR00503        80 CLVNLLDTPGHEDFSEDTYRTLTAVDNCLMVIDAAKGVETRTRKLMEVTRLRDLPILTFINKLDRDIRDPLELLDEVENE  159 (530)
T ss_pred             CEEECCCCCCCCCCCCHHHHHHHHHHHHEEEHHCCCCHHHHHHHHHHHHHHCCCCHHHHHHHCCCCCCCHHHHHHHHHHH
T ss_conf             45620368588876404679999851230011112561234244542010004744335232065435537888888877


Q ss_pred             HHHHH---------------------------------------------------------------------------
Q ss_conf             53223---------------------------------------------------------------------------
Q gi|254780321|r  158 IGIST---------------------------------------------------------------------------  162 (606)
Q Consensus       158 ~g~~~---------------------------------------------------------------------------  162 (606)
                      +++.+                                                                           
T Consensus       160 L~~~~~~~~~PIG~G~~F~GVY~~~~~~~yLy~r~G~~~~~~~~~~~~~L~~P~L~~~~G~D~~~~l~dELELv~~A~~E  239 (530)
T TIGR00503       160 LKINCAPITYPIGCGKLFKGVYHLLKDEIYLYQRSGTGGTIKAVRVVKGLNNPALDSAVGSDLAQQLRDELELVEGASNE  239 (530)
T ss_pred             HCCCEEEEECCCCCCCCCHHHHHHHCCEEEEEECCCCCCHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             06411343056578843113554301406676305888416677776326880156776578999998899999863024


Q ss_pred             -----------HHHHHHHHHCCCCCCHHHHHHHHHHHCCCCHH-------HHHCCCCCCCCCEE--ECC-CCCEEEEEEE
Q ss_conf             -----------21000111002232006787763210001111-------22012331012101--147-5725999981
Q gi|254780321|r  163 -----------EDALLVSAKTGEGIPLLLERIVQQLPSPTSPE-------GANAPLKALLIDSW--YNS-YLGVMVLVRI  221 (606)
Q Consensus       163 -----------~~ii~vSAktG~GV~~LLd~Iv~~iP~P~~~~-------~~~~Pl~alVfds~--~D~-~~G~I~~~RV  221 (606)
                                 ..++++||..+.||+.+||+++++.|.|....       .....|.++||+..  +|| ||.||++.||
T Consensus       240 Fd~~~~~~GE~TPVFFG~Al~NFGV~~~L~~l~~~A~~P~~~~~~~~TvE~~~e~FsGFVFK~QANMDPKHRDRvAFlRV  319 (530)
T TIGR00503       240 FDLAAFLGGELTPVFFGTALGNFGVDHFLDGLLQYAPKPEARQSDTRTVEPTEEKFSGFVFKLQANMDPKHRDRVAFLRV  319 (530)
T ss_pred             HHHHHHHCCCCCCEECCCCHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCEEEEEECCCCCCCCCEEEEEEE
T ss_conf             56899853864631110001010089999999986078887656775402343354422888633798863350577776


Q ss_pred             CCCCCCCCCEEEEECCCCCCCCCCC-CCCCCCEEEEHHCCCCCHHHHHHCCCCCCCCCCCCEECCCCCCCCCCCCCCCCC
Q ss_conf             6987355845887335564210122-233554124010124712332201100244445420004667853236455222
Q gi|254780321|r  222 INGQLTKGQSIRLMGTNAKYQVERI-GILTPKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPI  300 (606)
Q Consensus       222 ~sG~lk~Gd~I~~~~~g~~~~v~~i-g~~~~~~~~v~~l~aGdVG~ii~gik~l~~~~vGDTl~~~~~p~~~~Lp~~~~~  300 (606)
                      +||+..+|++++-.+++|.-.+..- ..|..++..+++++|||    |.|+.+...+.||||++..+.-.-.|+|.|.  
T Consensus       320 ~SGKyEK~M~~k~~R~gK~V~~S~~~~~~A~~R~~v~~AYaGD----~iGL~N~G~~~IGDT~~~GE~~~f~gIP~F~--  393 (530)
T TIGR00503       320 VSGKYEKGMKLKHVRTGKDVVLSDALTLMAGDREHVEEAYAGD----IIGLHNHGTIQIGDTFTQGEKLKFTGIPNFA--  393 (530)
T ss_pred             ECCEEECCCEECCCCCCCEEEECCHHHHHHCCHHHHHHCCCCC----EEEECCCCCEEECCCCCCCCEEEECCCCCCC--
T ss_conf             4134634756614213553686323565440212231127776----5310688426747720248656638778866--


Q ss_pred             CCEEEEEECCCCHHHHHHHHHHHHHHHHHCCCCCCCC-CCC-CCCCCEEEEEECCHHHHHHHHHHHHHHCCCEEEEECCC
Q ss_conf             2126642126770245788999988864112211125-676-00042028996376789888988866449506973782
Q gi|254780321|r  301 QPVVFCGLFPVDATQFENLRTAINKLRLNDASFSFEL-ENS-TALGFGFRCGFLGLLHLEIIQERLEREFSLNLIGTSPS  378 (606)
Q Consensus       301 ~P~v~~~i~p~~~~d~~~L~~aL~kL~~~D~sl~~e~-Ets-~aLg~Gfr~gglG~LHLeVi~eRL~rEfg~ev~~t~P~  378 (606)
                       |-+|.-+-..|++.+.+|..+|..|++|-+--.+.+ ..| -.+    .++..|.||.||++.||+.|||+|.+.-+=.
T Consensus       394 -PELF~~~R~~DP~~~K~l~KG~~~L~EEGAVQv~~~l~~~krD~----I~~AVG~LQF~VV~~RL~~EY~VE~~~E~~~  468 (530)
T TIGR00503       394 -PELFRRLRLKDPLKQKQLLKGLVQLSEEGAVQVLRPLDNNKRDL----IVGAVGVLQFDVVVYRLKEEYNVEAVYEPVN  468 (530)
T ss_pred             -HHHHHHHHCCCCHHHHHHHCCCHHCCCCCHHHHHHHHHHCCCCE----EEEECCHHHHHHHHHHHHCCCCEEEEEECCC
T ss_conf             -78999862138345566550410002264323231132147760----5542011468899887300134035651346


Q ss_pred             CCE
Q ss_conf             330
Q gi|254780321|r  379 VVY  381 (606)
Q Consensus       379 V~Y  381 (606)
                      |..
T Consensus       469 ~~~  471 (530)
T TIGR00503       469 VAL  471 (530)
T ss_pred             CCH
T ss_conf             301


No 22 
>KOG0467 consensus
Probab=100.00  E-value=0  Score=416.58  Aligned_cols=469  Identities=26%  Similarity=0.380  Sum_probs=337.6

Q ss_pred             CCCHHHCEEEEEECCCCCCHHHHHHHHHHHCCCCCCCCC-CCEEECCCHHHHHHCCEEEEEEEEEEEECCCCCEEEEEEE
Q ss_conf             998525317999801389877889999998298054444-3113058677987195052327999974378843899996
Q gi|254780321|r    5 PTPLSRIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREM-SSQVLDNMDIERERGITIKAQTVRLNYTSTDAKDYQLNLI   83 (606)
Q Consensus         5 ~~p~~~IRN~~IiaHvDhGKTTL~d~lL~~tg~i~~~~~-~~~vlD~~~~EreRGITIka~~~~~~~~~~~~~~y~iNlI   83 (606)
                      +.+.++||||||+||||||||||+|.|+...|.|+.|-+ +-++||+.+.|+-||||.||+.++...     ++|.+|||
T Consensus         3 ~~~~~~irn~~~vahvdhgktsladsl~asngvis~rlagkirfld~redeq~rgitmkss~is~~~-----~~~~~nli   77 (887)
T KOG0467           3 QKGSEGIRNICLVAHVDHGKTSLADSLVASNGVISSRLAGKIRFLDTREDEQTRGITMKSSAISLLH-----KDYLINLI   77 (887)
T ss_pred             CCCCCCEEEEEEEEEECCCCCCHHHHHHHHCCEECHHHCCCEEECCCCCHHHHHCEEEECCCCCCCC-----CCEEEEEE
T ss_conf             7787750589999996488532577787506674153356066210462566616244313111013-----76589985


Q ss_pred             ECCCCCHHHHHHHHHHHHCCEEEEEEECCCCCCHHHHHHHHHHHHCCCCEEEEECCCCCCCC----CCC-------CHHH
Q ss_conf             17873002799999997302689999868788655899999999709967998326788753----211-------3388
Q gi|254780321|r   84 DTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQAIDNNHEIITVLNKADLPSA----DPD-------RVKK  152 (606)
Q Consensus        84 DTPGH~DF~~EV~r~l~a~dgaiLvVdA~~Gvq~QT~~~~~~A~~~~l~~I~viNKiD~~~A----~~e-------~v~~  152 (606)
                      |+|||+||++||+.|.+-||||+++||+.+||-+||.++++.|...++++|.|||||||--.    -|.       ++.+
T Consensus        78 dspghvdf~sevssas~l~d~alvlvdvvegv~~qt~~vlrq~~~~~~~~~lvinkidrl~~el~lsp~ea~~~l~r~i~  157 (887)
T KOG0467          78 DSPGHVDFSSEVSSASRLSDGALVLVDVVEGVCSQTYAVLRQAWIEGLKPILVINKIDRLITELKLSPQEAYEHLLRVIE  157 (887)
T ss_pred             CCCCCCCHHHHHHHHHHHCCCCEEEEEECCCCCHHHHHHHHHHHHCCCCEEEEEEHHHHHHHHHHCCHHHHHHHHHHHHH
T ss_conf             58986450655326665047718999600254553899999999716745999731666788871696999999999999


Q ss_pred             HHHHHHH----------------------HH--HHHHHHHH---------------------------------------
Q ss_conf             8775553----------------------22--32100011---------------------------------------
Q gi|254780321|r  153 QIEETIG----------------------IS--TEDALLVS---------------------------------------  169 (606)
Q Consensus       153 ei~~~~g----------------------~~--~~~ii~vS---------------------------------------  169 (606)
                      |+-..+|                      ++  ..+++++|                                       
T Consensus       158 ~vn~~i~~~~~~~v~l~~~~~~i~d~~~~F~p~kgNVif~~A~~~~~f~~~~fak~~~~kl~~k~~al~k~lwgd~y~~~  237 (887)
T KOG0467         158 QVNGVIGQFLGGIVELDDNWENIEDEEITFGPEDGNVIFASALDGWGFGIEQFAKFYAKKLGLKDAALLKFLWGDRYIDP  237 (887)
T ss_pred             HHHHHHHHHHCCHHHCCCHHHHHHHCCEEECCCCCCEEEEEECCCCCCCHHHHHHHHHHHCCHHHHHHHHHHCCCEEECC
T ss_conf             86668887641111102103221010004367788489987101562019999999987447346652132104524332


Q ss_pred             --------------------------------HHCCC------------CC-------CHHHHH---------------H
Q ss_conf             --------------------------------10022------------32-------006787---------------7
Q gi|254780321|r  170 --------------------------------AKTGE------------GI-------PLLLER---------------I  183 (606)
Q Consensus       170 --------------------------------AktG~------------GV-------~~LLd~---------------I  183 (606)
                                                      |..+.            |+       +.|+++               .
T Consensus       238 ktk~I~~~~~~~grkplf~~~vle~lw~iy~~~~~~~d~~~~~ki~k~l~i~~l~r~~~~ll~~im~~wLPls~avll~a  317 (887)
T KOG0467         238 KTKRICEGKKLKGRKPLFVQFVLENLWRIYELALKSRDKEKLEKIAKSLNIKLLPRDLRNLLDAIMSTWLPLSDAVLLTV  317 (887)
T ss_pred             HHHHHHCCCCCCCCCCCCCEEEHHHHHHHHHHHHCCCHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHCCCCCCHHHHH
T ss_conf             04666435676667776313330057899998743202888998764302121358999999999975263210229999


Q ss_pred             HHHHHCCCCH--------------------------HHHHCCCCCCCCC-----EEECCCCCEEEEEEECCCCCCCCCEE
Q ss_conf             6321000111--------------------------1220123310121-----01147572599998169873558458
Q gi|254780321|r  184 VQQLPSPTSP--------------------------EGANAPLKALLID-----SWYNSYLGVMVLVRIINGQLTKGQSI  232 (606)
Q Consensus       184 v~~iP~P~~~--------------------------~~~~~Pl~alVfd-----s~~D~~~G~I~~~RV~sG~lk~Gd~I  232 (606)
                      +.++|.|...                          .+.++|.-.+|.+     ..++|-.--+++.||+||+++.||.+
T Consensus       318 ~~~lp~pl~~~~~r~~rl~~s~~~~~~~~~~~~v~~~~~~~pviv~Vskm~~~~~k~lp~~~l~~~ari~sgTlr~g~~v  397 (887)
T KOG0467         318 VYKLPDPIRSQAERGLRLLSSSDHRSDPPLTKAVKSCSKESPVLVFVSKMLATPLKYLPQSRLLAFARIFSGTLRVGQVV  397 (887)
T ss_pred             HHHCCCHHHHHHHHHCEECCCCCCCCCHHHHHHHHCCCCCCCEEEEEEEEECCCHHHCCHHHHEEEEEECCCCEEECCEE
T ss_conf             88559779999875250126841113727665411379988479999722046232172302115635014844621176


Q ss_pred             EEECC-------CCCCCCCCCCCCCCC-EEEEHHCCCCCHHHHHHCCCCCCCCCCCCEECCCCCCCCCCCCCCCCCCCEE
Q ss_conf             87335-------564210122233554-1240101247123322011002444454200046678532364552222126
Q gi|254780321|r  233 RLMGT-------NAKYQVERIGILTPK-MIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVV  304 (606)
Q Consensus       233 ~~~~~-------g~~~~v~~ig~~~~~-~~~v~~l~aGdVG~ii~gik~l~~~~vGDTl~~~~~p~~~~Lp~~~~~~P~v  304 (606)
                      +....       -.+.++.+++.|.++ ..+.++..+|.+    ++|.+.....-.-|||+.. |..--++.-....|.+
T Consensus       398 ~v~~pd~~~~e~i~~~~ie~lyl~mgqelv~~d~v~~gnv----~~I~g~~~vlks~TL~s~~-~~~p~~~~~f~~tp~v  472 (887)
T KOG0467         398 YVLGPDPLSPEHITECTVESLYLFMGQELVPLDEVPSGNV----VAIGGAGIVLKSATLCSKV-PCGPNLVVNFQITPIV  472 (887)
T ss_pred             EECCCCCCCCCEEEEEEEHHHHHHHCCCCEEEECCCCCCE----EEECCCCEEECCCEECCCC-CCCCEEEEEEEEEEEE
T ss_conf             4237899985404565405567750455223102477867----9861664475154110368-8765045666402478


Q ss_pred             EEEECCCCHHHHHHHHHHHHHHHHHCCCCCCC-CCCCCCCCCEEEEEECCHHHHHHHHHHHHHHCCCEEEEECCCCCEEE
Q ss_conf             64212677024578899998886411221112-56760004202899637678988898886644950697378233033
Q gi|254780321|r  305 FCGLFPVDATQFENLRTAINKLRLNDASFSFE-LENSTALGFGFRCGFLGLLHLEIIQERLEREFSLNLIGTSPSVVYEL  383 (606)
Q Consensus       305 ~~~i~p~~~~d~~~L~~aL~kL~~~D~sl~~e-~Ets~aLg~Gfr~gglG~LHLeVi~eRL~rEfg~ev~~t~P~V~Ykv  383 (606)
                      -++++|.+..+-++|.+.|.-|..-||++++- .++.+..     +.--|+.||+=..--|+.=-++++.++.|.|+|+.
T Consensus       473 rvaiep~~p~em~~L~~glkll~~adp~v~i~v~~~gEhv-----l~~aGevhlerc~kDL~efa~i~i~vSeP~vpfrE  547 (887)
T KOG0467         473 RVAIEPDDPDEMDKLVEGLKLLNQADPFVKIRVEENGEHV-----LVTAGEVHLERCLKDLKEFAKIEISVSEPLVPFRE  547 (887)
T ss_pred             EEEEECCCHHHHHHHHHHHHHHCCCCHHHHHHHHHCCCEE-----EEECCHHHHHHHHHHHHHHHCEEEEECCCCCCHHH
T ss_conf             9996318867768899887766056406678876254103-----44301777998998876553068872487631565


Q ss_pred             EEECCCE---------------------------------------------------E--ECC-----------CH---
Q ss_conf             5315645---------------------------------------------------4--126-----------96---
Q gi|254780321|r  384 YMHDGSM---------------------------------------------------Q--KLS-----------NP---  396 (606)
Q Consensus       384 ~~~dG~~---------------------------------------------------~--~Vd-----------~p---  396 (606)
                      |..+++.                                                   +  .++           ++   
T Consensus       548 T~~e~s~l~~~~~I~~~~~~~~~~~~ki~~~~~pl~~~~v~~l~~~~~ti~~i~~~~~~~~~i~e~~k~~~~e~ls~~~s  627 (887)
T KOG0467         548 TIIEDSDLLANLSIGQETKCLPRGQLKIKLRVVPLSGAVVDLLDKNSSLISNILRGESRQVPIDESQKGSFEENLSLLIS  627 (887)
T ss_pred             HCCCCCHHHHHHHCCCCCCCCCCCCEEEEEEECCCCCCEECCCCCCCHHCCCHHCCCCCCCCCCCCCCCCCCCCCCHHHH
T ss_conf             40453010023322732110301233677664046652221243321100110125444430111124530023237999


Q ss_pred             ----HH-----------------C----------------CC---------HHHH-------------------------
Q ss_conf             ----66-----------------2----------------58---------6778-------------------------
Q gi|254780321|r  397 ----ID-----------------M----------------PE---------VTKI-------------------------  405 (606)
Q Consensus       397 ----~~-----------------~----------------p~---------~~~i-------------------------  405 (606)
                          ..                 |                +.         ...+                         
T Consensus       628 ~~~~~~~ek~~e~~~~~~~~~~Afgp~r~g~nilf~~~~~~~~s~~~~t~~~~~l~~~ivsgfql~~~sGPlc~Ep~~g~  707 (887)
T KOG0467         628 LERLYEFEKPREKLGSFKDQIIAFGPRRVGPNILFNKDSKLYRSVRRGTPFVARLSESIVSGFQLATSSGPLCNEPMQGI  707 (887)
T ss_pred             HHHHHHCCCCHHHHHHHHHHHHCCCCCCCCCCEEECCCCCHHHHHHHCCHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCE
T ss_conf             98876416627777788751001141335886013200031254540555787899987666756650686324674207


Q ss_pred             --------------------------------------HHHHCCEEEEEEEECCCCCHHHHHHHHHHHHEEECCCC--CC
Q ss_conf             --------------------------------------88623269999980831000389998863001424433--68
Q gi|254780321|r  406 --------------------------------------AELREPWIQVTIITPNEYLGSILKLCQERRGIQIDMSH--LD  445 (606)
Q Consensus       406 --------------------------------------~~i~EPi~~~~I~~P~ey~G~Vm~~l~~RRG~~~~m~~--~~  445 (606)
                                                            ..+..||+.++|.+-.|++|.+-.-+++|+|++..=+.  ..
T Consensus       708 ~~~~es~~~e~~e~~~~~~GQviTa~Kescr~Afl~~~pRl~~aMYsC~I~t~~e~LGkvYAVlskR~gkVLsEem~EgT  787 (887)
T KOG0467         708 CFVLESGSAEEMESDGNIGGQLITAVKDSCRAAFLCWSPRIMAAMYSCDIQTASEVLGKVYAVLSKRHGKVLSEEMKEGT  787 (887)
T ss_pred             EEEEECCCCCCCCCCCCCCCEEHHHHHHHHHHHHHCCCHHHHHHHEEEEEEEHHHHHHHHHHHHHHHCCHHHHHHHHCCC
T ss_conf             99964057532224577574108999999999986278777666564345323877556785442201321015663788


Q ss_pred             CEEEEEEEECHHHHHHHHHHHHHHHCCCEEEEEEEECCCEECCE
Q ss_conf             36999999604333220468767635741888985435464366
Q gi|254780321|r  446 NRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDYRDSDL  489 (606)
Q Consensus       446 ~~~~i~~~vPl~Eli~~f~~~LkS~T~G~as~~ye~~~Y~~~dl  489 (606)
                      +.-.+++.+|-.|- |||.++++--|+|-|+--.-|+||+-.|.
T Consensus       788 ~~F~V~aliPVvES-FgFadeiRK~TSG~A~pQLvFShwEvId~  830 (887)
T KOG0467         788 GFFIVTALIPVVES-FGFADEIRKGTSGAASPQLVFSHWEVIDE  830 (887)
T ss_pred             CCEEEEEEEEEECC-CCHHHHHHHCCCCCCCHHHHCCCCEEECC
T ss_conf             75799997401215-55799986105655463300034178337


No 23 
>cd01890 LepA LepA subfamily.  LepA belongs to the GTPase family of and exhibits significant homology to the translation factors EF-G and EF-Tu, indicating its possible involvement in translation and association with the ribosome.  LepA is ubiquitous in bacteria and eukaryota (e.g. yeast GUF1p), but is missing from archaea.  This pattern of phyletic distribution suggests that LepA evolved through a duplication of the EF-G gene in bacteria, followed by early transfer into the eukaryotic lineage, most likely from the promitochondrial endosymbiont.  Yeast GUF1p is not essential and mutant cells did not reveal any marked phenotype.
Probab=100.00  E-value=0  Score=419.52  Aligned_cols=179  Identities=70%  Similarity=1.069  Sum_probs=176.7

Q ss_pred             EEEEEECCCCCCHHHHHHHHHHHCCCCCCCCCCCEEECCCHHHHHHCCEEEEEEEEEEEECCCCCEEEEEEEECCCCCHH
Q ss_conf             17999801389877889999998298054444311305867798719505232799997437884389999617873002
Q gi|254780321|r   12 RNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVRLNYTSTDAKDYQLNLIDTPGHVDF   91 (606)
Q Consensus        12 RN~~IiaHvDhGKTTL~d~lL~~tg~i~~~~~~~~vlD~~~~EreRGITIka~~~~~~~~~~~~~~y~iNlIDTPGH~DF   91 (606)
                      |||||+||+|||||||+|+||+.+|.+++++..++++|++++|+||||||+++.+++.|...+|+.|.+||||||||.||
T Consensus         1 RNiaiiGHvd~GKTTL~~~ll~~tg~i~~~~~~~~~~D~~~~E~eRgiTi~~~~~~~~~~~~~~~~~~in~iDtPGh~dF   80 (179)
T cd01890           1 RNFSIIAHIDHGKSTLADRLLELTGTVSKREMKEQVLDSMDLERERGITIKAQTVRLNYKAKDGQEYLLNLIDTPGHVDF   80 (179)
T ss_pred             CEEEEECCCCCCHHHHHHHHHHHCCCCCCCCCCCEECCCCHHHHHCCCEEEEEEEEEEEECCCCCCEEEEEEECCCCCCC
T ss_conf             95999948998989999999998599541457324416517678638668743368884136787148999989986451


Q ss_pred             HHHHHHHHHHCCEEEEEEECCCCCCHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             79999999730268999986878865589999999970996799832678875321133888775553223210001110
Q gi|254780321|r   92 TYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQAIDNNHEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAK  171 (606)
Q Consensus        92 ~~EV~r~l~a~dgaiLvVdA~~Gvq~QT~~~~~~A~~~~l~~I~viNKiD~~~A~~e~v~~ei~~~~g~~~~~ii~vSAk  171 (606)
                      .+|+.|++++||+|||||||.+|+|+||+++|.+|.+.++|+|+||||||+++||++++.+|+++.+|+++.+++++||+
T Consensus        81 ~~~~~~al~~~D~allVVda~~Gv~~qT~~~~~~a~~~~~p~ivviNKiD~~~ad~~~v~~~i~~~~g~~~~~~v~vSA~  160 (179)
T cd01890          81 SYEVSRSLAACEGALLLVDATQGVEAQTLANFYLALENNLEIIPVINKIDLPSADPERVKQQIEDVLGLDPSEAILVSAK  160 (179)
T ss_pred             HHHHHHHHHHHCEEEEEEECCCCCCHHHHHHHHHHHHCCCCEEEEEECCCCCCCCHHHHHHHHHHHHCCCCCCEEEEECC
T ss_conf             77898899754427899864778737489999999876998899986555677899999999999868897674884378


Q ss_pred             CCCCCCHHHHHHHHHHHCC
Q ss_conf             0223200678776321000
Q gi|254780321|r  172 TGEGIPLLLERIVQQLPSP  190 (606)
Q Consensus       172 tG~GV~~LLd~Iv~~iP~P  190 (606)
                      +|.||++|||+|++++|+|
T Consensus       161 ~g~gv~~Ll~~i~~~ip~p  179 (179)
T cd01890         161 TGLGVEDLLEAIVERIPPP  179 (179)
T ss_pred             CCCCHHHHHHHHHHHCCCC
T ss_conf             8979899999999648898


No 24 
>cd01891 TypA_BipA TypA (tyrosine phosphorylated protein A)/BipA subfamily.  BipA is a protein belonging to the ribosome-binding family of GTPases and is widely distributed in bacteria and plants.  BipA was originally described as a protein that is induced in Salmonella typhimurium after exposure to bactericidal/permeability-inducing protein (a cationic antimicrobial protein produced by neutrophils), and has since been identified in E. coli as well.  The properties thus far described for BipA are related to its role in the process of pathogenesis by enteropathogenic E. coli.  It appears to be involved in the regulation of several processes important for infection, including rearrangements of the cytoskeleton of the host, bacterial resistance to host defense peptides, flagellum-mediated cell motility, and expression of K5 capsular genes.  It has been proposed that BipA may utilize a novel mechanism to regulate the expression of target genes.  In addition, BipA from enteropathogenic E. co
Probab=100.00  E-value=0  Score=399.64  Aligned_cols=176  Identities=42%  Similarity=0.698  Sum_probs=161.7

Q ss_pred             HCEEEEEECCCCCCHHHHHHHHHHHCCCCCCCC-CCCEEECCCHHHHHHCCEEEEEEEEEEEECCCCCEEEEEEEECCCC
Q ss_conf             531799980138987788999999829805444-4311305867798719505232799997437884389999617873
Q gi|254780321|r   10 RIRNFSIVAHIDHGKSTLADRFIQHCRGLTERE-MSSQVLDNMDIERERGITIKAQTVRLNYTSTDAKDYQLNLIDTPGH   88 (606)
Q Consensus        10 ~IRN~~IiaHvDhGKTTL~d~lL~~tg~i~~~~-~~~~vlD~~~~EreRGITIka~~~~~~~~~~~~~~y~iNlIDTPGH   88 (606)
                      |||||||+||+|||||||+|+||+.+|.+.+++ ..+++||++++||||||||+++.+++.|     +++++||||||||
T Consensus         1 nIRNv~iiGHvd~GKTTL~~~Ll~~tg~~~~~~~~~~~~~D~~~~E~ergiTI~~~~~~~~~-----~~~~~n~IDtPGH   75 (194)
T cd01891           1 DIRNIAIIAHVDHGKTTLVDALLKQSGTFRENEEVEERVMDSNDLERERGITILAKNTAVTY-----KDTKINIVDTPGH   75 (194)
T ss_pred             CCCEEEEECCCCCCHHHHHHHHHHHCCCCCCCCCCCEEEECCCHHHHHCCCCEEEEEEEEEE-----CCEEEEEEECCCC
T ss_conf             98789999068987999999999974876304652168614758888728763345899998-----9988999989984


Q ss_pred             CHHHHHHHHHHHHCCEEEEEEECCCCCCHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCCHHHHHHHHH---HHHHH--
Q ss_conf             0027999999973026899998687886558999999997099679983267887532113388877555---32232--
Q gi|254780321|r   89 VDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQAIDNNHEIITVLNKADLPSADPDRVKKQIEETI---GISTE--  163 (606)
Q Consensus        89 ~DF~~EV~r~l~a~dgaiLvVdA~~Gvq~QT~~~~~~A~~~~l~~I~viNKiD~~~A~~e~v~~ei~~~~---g~~~~--  163 (606)
                      .||.+|+.+++++||+|||||||.+|||+||+++|.+|.+.++++|+||||||+++|+++++.+|+.+++   +...+  
T Consensus        76 ~dF~~~~~~~~~~~D~ailVVdA~~Gv~~QT~~~l~~a~~~~~~~iv~iNK~D~~~a~~~~v~~ei~~~~~~~~~~~~~~  155 (194)
T cd01891          76 ADFGGEVERVLSMVDGVLLLVDASEGPMPQTRFVLKKALELGLKPIVVINKIDRPDARPEEVVDEVFDLFIELGATEEQL  155 (194)
T ss_pred             HHHHHHHHHHHHHCCEEEEEEECCCCCCHHHHHHHHHHHHCCCCEEEEEECCCCCCCCHHHHHHHHHHHHHHCCCCCCCC
T ss_conf             77777898776434467898653789758999999999872997499885645898889999999999998639993335


Q ss_pred             --HHHHHHHHCC----------CCCCHHHHHHHHHHHCC
Q ss_conf             --1000111002----------23200678776321000
Q gi|254780321|r  164 --DALLVSAKTG----------EGIPLLLERIVQQLPSP  190 (606)
Q Consensus       164 --~ii~vSAktG----------~GV~~LLd~Iv~~iP~P  190 (606)
                        .++++||++|          .+|++|||+|++++|+|
T Consensus       156 ~~pii~~SA~~G~~~d~~~~~~~~~~~ll~ai~~~iP~P  194 (194)
T cd01891         156 DFPVLYASAKNGWASLNLEDPSEDLEPLFDTIIEHVPAP  194 (194)
T ss_pred             CCCEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHHCCCC
T ss_conf             885787256553357788656465999999999658898


No 25 
>cd01885 EF2 EF2 (for archaea and eukarya).  Translocation requires hydrolysis of a molecule of GTP and is mediated by EF-G in bacteria and by eEF2 in eukaryotes.  The eukaryotic elongation factor eEF2 is a GTPase involved in the translocation of the peptidyl-tRNA from the A site to the P site on the ribosome.  The 95-kDa protein is highly conserved, with 60% amino acid sequence identity between the human and yeast proteins.  Two major mechanisms are known to regulate protein elongation and both involve eEF2.  First, eEF2 can be modulated by reversible phosphorylation.  Increased levels of phosphorylated eEF2 reduce elongation rates presumably because phosphorylated eEF2 fails to bind the ribosomes.  Treatment of mammalian cells with agents that raise the cytoplasmic Ca2+ and cAMP levels reduce elongation rates by activating the kinase responsible for phosphorylating eEF2.  In contrast, treatment of cells with insulin increases elongation rates by promoting eEF2 dephosphorylation.  Seco
Probab=100.00  E-value=0  Score=386.41  Aligned_cols=179  Identities=39%  Similarity=0.652  Sum_probs=154.5

Q ss_pred             EEEEEECCCCCCHHHHHHHHHHHCCCCCCCCC-CCEEECCCHHHHHHCCEEEEEEEEEEEE-----CCCCCEEEEEEEEC
Q ss_conf             17999801389877889999998298054444-3113058677987195052327999974-----37884389999617
Q gi|254780321|r   12 RNFSIVAHIDHGKSTLADRFIQHCRGLTEREM-SSQVLDNMDIERERGITIKAQTVRLNYT-----STDAKDYQLNLIDT   85 (606)
Q Consensus        12 RN~~IiaHvDhGKTTL~d~lL~~tg~i~~~~~-~~~vlD~~~~EreRGITIka~~~~~~~~-----~~~~~~y~iNlIDT   85 (606)
                      ||||||||+|||||||+|+||+.+|.++++.. ..++||++++||||||||||+++++.|.     ..+|++|.||||||
T Consensus         1 RNi~iigHvdhGKTTL~D~Ll~~~g~i~~~~~g~~~~~D~~~~E~eRgiTIks~~isl~~~~~~~~~~~~~~~~inlIDT   80 (222)
T cd01885           1 RNICIIAHVDHGKTTLSDSLLASAGIISEKLAGKARYMDSREDEQERGITMKSSAISLYFEYEEEDKADGNEYLINLIDS   80 (222)
T ss_pred             CEEEEECCCCCCHHHHHHHHHHHCCCCCHHCCCCEEECCCHHHHHHCCCEEEEEEEEEEEEECCCCCCCCCCEEEEEEEC
T ss_conf             96999866887799999999998598412106634651424334205415862268999860344345688638999728


Q ss_pred             CCCCHHHHHHHHHHHHCCEEEEEEECCCCCCHHHHHHHHHHHHCCCCEEEEECCCCCC----CCCCCCHH-------HHH
Q ss_conf             8730027999999973026899998687886558999999997099679983267887----53211338-------887
Q gi|254780321|r   86 PGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQAIDNNHEIITVLNKADLP----SADPDRVK-------KQI  154 (606)
Q Consensus        86 PGH~DF~~EV~r~l~a~dgaiLvVdA~~Gvq~QT~~~~~~A~~~~l~~I~viNKiD~~----~A~~e~v~-------~ei  154 (606)
                      |||+||++||+|+|++||||||||||.+|||+||+++|++|++.++|+|+|||||||.    ..+|+++.       +++
T Consensus        81 PGH~dF~~ev~~al~~~DgailVVDa~eGv~~qT~~vl~~a~~~~l~~il~iNKiDRli~el~l~p~day~~l~~iie~v  160 (222)
T cd01885          81 PGHVDFSSEVTAALRLCDGALVVVDAVEGVCVQTETVLRQALKERVKPVLVINKIDRLILELKLSPEEAYQRLARIIEQV  160 (222)
T ss_pred             CCHHHHHHHHHHHHHHCCEEEEEECCCCCCCHHHHHHHHHHHHCCCCEEEEEECCCCCCHHCCCCHHHHHHHHHHHHHHH
T ss_conf             85698999999999856817996104578577899999999985999799998903650011799899999999999999


Q ss_pred             HHHHH----------------HHH--HHHHHHHHHCCCCC--------CHHHHHHHHHHHCC
Q ss_conf             75553----------------223--21000111002232--------00678776321000
Q gi|254780321|r  155 EETIG----------------IST--EDALLVSAKTGEGI--------PLLLERIVQQLPSP  190 (606)
Q Consensus       155 ~~~~g----------------~~~--~~ii~vSAktG~GV--------~~LLd~Iv~~iP~P  190 (606)
                      -.++.                +++  .+++++||+.|.+.        .+|||+|++++|+|
T Consensus       161 N~~i~~~~~~~~~~~~~~~~~~~p~~gnV~f~Sa~~Gw~f~l~~fa~ly~ll~~iv~~iP~P  222 (222)
T cd01885         161 NAIIGTYADEEFKEKDDEKWYFSPQKGNVAFGSALHGWGFTIIKFARIYAVLEMVVKHLPSP  222 (222)
T ss_pred             HHHHHHHCHHHHCCCCCCCEEECCCCCCEEEEECCCCCCCCCCCHHHHHHHHHHHHHHCCCC
T ss_conf             99998723043303553210207777838999832377126754121899999999628998


No 26 
>cd04170 EF-G_bact Elongation factor G (EF-G) subfamily.  Translocation is mediated by EF-G (also called translocase).  The structure of EF-G closely resembles that of the complex between EF-Tu and tRNA.  This is an example of molecular mimicry; a protein domain evolved so that it mimics the shape of a tRNA molecule.  EF-G in the GTP form binds to the ribosome, primarily through the interaction of its EF-Tu-like domain with the 50S subunit.  The binding of EF-G to the ribosome in this manner stimulates the GTPase activity of EF-G.  On GTP hydrolysis, EF-G undergoes a conformational change that forces its arm deeper into the A site on the 30S subunit.  To accommodate this domain, the peptidyl-tRNA in the A site moves to the P site, carrying the mRNA and the deacylated tRNA with it.  The ribosome may be prepared for these rearrangements by the initial binding of EF-G as well.  The dissociation of EF-G leaves the ribosome ready to accept the next aminoacyl-tRNA into the A site.  This group
Probab=100.00  E-value=0  Score=385.33  Aligned_cols=142  Identities=32%  Similarity=0.404  Sum_probs=134.2

Q ss_pred             EEEEECCCCCCHHHHHHHHHHHCCCCCCCC---CCCEEECCCHHHHHHCCEEEEEEEEEEEECCCCCEEEEEEEECCCCC
Q ss_conf             799980138987788999999829805444---43113058677987195052327999974378843899996178730
Q gi|254780321|r   13 NFSIVAHIDHGKSTLADRFIQHCRGLTERE---MSSQVLDNMDIERERGITIKAQTVRLNYTSTDAKDYQLNLIDTPGHV   89 (606)
Q Consensus        13 N~~IiaHvDhGKTTL~d~lL~~tg~i~~~~---~~~~vlD~~~~EreRGITIka~~~~~~~~~~~~~~y~iNlIDTPGH~   89 (606)
                      ||+|+||+|+|||||+|+|||.+|.+.+.+   .+++++|++++||||||||.++.+++.|     ++++|||||||||+
T Consensus         1 Ni~iigH~~aGKTtL~E~lL~~~g~i~~~G~V~~g~t~~D~~~~E~~RgiSi~s~~~~~~w-----~~~~inliDTPG~~   75 (268)
T cd04170           1 NIALVGHSGSGKTTLAEALLYATGAIDRLGSVEDGTTVSDYDPEEIKRKMSISTSVAPLEW-----KGHKINLIDTPGYA   75 (268)
T ss_pred             CEEEEECCCCCHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCHHHHHCCCCEECCEEEEEE-----CCEEEEEEECCCCH
T ss_conf             9899908999989999999996699665765458973577878898679675135578888-----99799998698975


Q ss_pred             HHHHHHHHHHHHCCEEEEEEECCCCCCHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCCHHHHHHHHHH
Q ss_conf             0279999999730268999986878865589999999970996799832678875321133888775553
Q gi|254780321|r   90 DFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQAIDNNHEIITVLNKADLPSADPDRVKKQIEETIG  159 (606)
Q Consensus        90 DF~~EV~r~l~a~dgaiLvVdA~~Gvq~QT~~~~~~A~~~~l~~I~viNKiD~~~A~~e~v~~ei~~~~g  159 (606)
                      ||++||+|+|+++|+||+||||.+|||+||+..|+.|.++++|+|+||||||+++||++++.++|++.++
T Consensus        76 DF~~e~~~aL~v~D~Av~Vida~~GVe~~T~~~w~~~~~~~iP~i~fINKmDr~~ad~~~~l~~i~~~lg  145 (268)
T cd04170          76 DFVGETRAALRAADAALVVVSAQSGVEVGTEKLWEFADEAGIPRIIFINKMDRERADFDKTLAALQEAFG  145 (268)
T ss_pred             HHHHHHHHHHCCCCEEEEEECCCCCHHHHHHHHHHHHHHCCCCEEEEEECCCCCCCCHHHHHHHHHHHHC
T ss_conf             7999999984047839999418754768799999999985999899997878789964779999999868


No 27 
>cd04169 RF3 RF3 subfamily.  Peptide chain release factor 3 (RF3) is a protein involved in the termination step of translation in bacteria.  Termination occurs when class I release factors (RF1 or RF2) recognize the stop codon at the A-site of the ribosome and activate the release of the nascent polypeptide.  The class II release factor RF3 then initiates the release of the class I RF from the ribosome.  RF3 binds to the RF/ribosome complex in the inactive (GDP-bound) state.  GDP/GTP exchange occurs, followed by the release of the class I RF.  Subsequent hydrolysis of GTP to GDP triggers the release of RF3 from the ribosome.  RF3 also enhances the efficiency of class I RFs at less preferred stop codons and at stop codons in weak contexts.
Probab=100.00  E-value=0  Score=384.90  Aligned_cols=176  Identities=35%  Similarity=0.578  Sum_probs=158.6

Q ss_pred             HCEEEEEECCCCCCHHHHHHHHHHHCCCCCCC-------CCCCEEECCCHHHHHHCCEEEEEEEEEEEECCCCCEEEEEE
Q ss_conf             53179998013898778899999982980544-------44311305867798719505232799997437884389999
Q gi|254780321|r   10 RIRNFSIVAHIDHGKSTLADRFIQHCRGLTER-------EMSSQVLDNMDIERERGITIKAQTVRLNYTSTDAKDYQLNL   82 (606)
Q Consensus        10 ~IRN~~IiaHvDhGKTTL~d~lL~~tg~i~~~-------~~~~~vlD~~~~EreRGITIka~~~~~~~~~~~~~~y~iNl   82 (606)
                      ++|||||+||+|+|||||+|+|||.+|.+.+.       +.+++++|++++|++|||||.++.+++.|     ++++|||
T Consensus         1 ~~Rniai~gH~gaGKTtL~EalL~~~G~i~r~G~V~~~~~~g~t~~D~~~eE~~R~iSi~~~~~~~~w-----~~~kinl   75 (267)
T cd04169           1 RRRTFAIISHPDAGKTTLTEKLLLFGGAIREAGAVKARKSRKHATSDWMEIEKQRGISVTSSVMQFEY-----RDCVINL   75 (267)
T ss_pred             CCCEEEEECCCCCCHHHHHHHHHHHCCCCCCCCEEEECCCCCCCCCCCHHHHHHCCCEEECCEEEEEE-----CCEEEEE
T ss_conf             90179998479999899999999866863338546303688860468879998659448636378878-----9989999


Q ss_pred             EECCCCCHHHHHHHHHHHHCCEEEEEEECCCCCCHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCCHHHHHHHHHHHHH
Q ss_conf             61787300279999999730268999986878865589999999970996799832678875321133888775553223
Q gi|254780321|r   83 IDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQAIDNNHEIITVLNKADLPSADPDRVKKQIEETIGIST  162 (606)
Q Consensus        83 IDTPGH~DF~~EV~r~l~a~dgaiLvVdA~~Gvq~QT~~~~~~A~~~~l~~I~viNKiD~~~A~~e~v~~ei~~~~g~~~  162 (606)
                      ||||||.||.+|+.++|++||+||+||||.+|||+||+..|..|.++++|.++||||||+++||++++.++|++.|+...
T Consensus        76 iDTPG~~DF~~e~~~al~v~D~AviVv~a~~GVe~~T~~~w~~a~~~~iP~iifINKmDr~~adf~~~l~~i~~~lg~~~  155 (267)
T cd04169          76 LDTPGHEDFSEDTYRTLTAVDSAVMVIDAAKGVEPQTRKLFEVCRLRGIPIITFINKLDREGRDPLELLDEIEEELGIDC  155 (267)
T ss_pred             EECCCCHHHHHHHHHHHHHHHCEEEEEECCCCCCHHHHHHHHHHHHCCCCEEEEEECCCCCCCCHHHHHHHHHHHHCCCC
T ss_conf             97969778999999999886454799525666535589999999972999799985345678987899999999868775


Q ss_pred             ----------------------------------------------------------------------------H---
Q ss_conf             ----------------------------------------------------------------------------2---
Q gi|254780321|r  163 ----------------------------------------------------------------------------E---  163 (606)
Q Consensus       163 ----------------------------------------------------------------------------~---  163 (606)
                                                                                                  +   
T Consensus       156 vpi~lPig~~~~f~GvVDl~~~~a~~~~~~~~~~~~~~~~~~~~~~~~~~e~~~~l~e~~~e~~el~~e~~~~~~~e~i~  235 (267)
T cd04169         156 TPLTWPIGMGKDFKGVYDRRTGEVELYDRGAGGATIAPEETKGLDDPKLDELGGDLAEQLREELELLEGAGPEFDQEAFL  235 (267)
T ss_pred             CEEEEEECCCCCEEEEEECCCCEEEEECCCCCCCEEEECCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHH
T ss_conf             11687751699447999867798998007889954542578867779999975999999973356775365505199998


Q ss_pred             -----HHHHHHHHCCCCCCHHHHHHHHHHHCC
Q ss_conf             -----100011100223200678776321000
Q gi|254780321|r  164 -----DALLVSAKTGEGIPLLLERIVQQLPSP  190 (606)
Q Consensus       164 -----~ii~vSAktG~GV~~LLd~Iv~~iP~P  190 (606)
                           .++++||.++.||+.|||+|++++|+|
T Consensus       236 ~g~i~PV~~GSA~~~~GV~~LLd~I~~~lPsP  267 (267)
T cd04169         236 AGELTPVFFGSALNNFGVQELLDALVDLAPAP  267 (267)
T ss_pred             HCCEEEEEEEECCCCCCHHHHHHHHHHHCCCC
T ss_conf             29787899988898809999999999767899


No 28 
>KOG0468 consensus
Probab=100.00  E-value=0  Score=369.82  Aligned_cols=467  Identities=25%  Similarity=0.361  Sum_probs=342.1

Q ss_pred             HHCEEEEEECCCCCCHHHHHHHHHHHCCCCCC--CCCCCEEECCCHHHHHHCCEEEEEEEEEEEECCCCCEEEEEEEECC
Q ss_conf             25317999801389877889999998298054--4443113058677987195052327999974378843899996178
Q gi|254780321|r    9 SRIRNFSIVAHIDHGKSTLADRFIQHCRGLTE--REMSSQVLDNMDIERERGITIKAQTVRLNYTSTDAKDYQLNLIDTP   86 (606)
Q Consensus         9 ~~IRN~~IiaHvDhGKTTL~d~lL~~tg~i~~--~~~~~~vlD~~~~EreRGITIka~~~~~~~~~~~~~~y~iNlIDTP   86 (606)
                      +.|||++++||-.||||+|.|.|.++|.---.  .+..-+++|.+..|+|||+|||++.+++.....+++.|.+|++|||
T Consensus       126 ~~irnV~l~GhLhhGKT~l~D~Lv~~tHp~~~~~~e~~lrytD~l~~E~eRg~sIK~~p~Tl~l~D~~~KS~l~nilDTP  205 (971)
T KOG0468         126 ERIRNVGLVGHLHHGKTALMDLLVEQTHPDFSKNTEADLRYTDTLFYEQERGCSIKSTPVTLVLSDSKGKSYLMNILDTP  205 (971)
T ss_pred             CEEEEEEEEECCCCCHHHHHHHHCEECCCCCCCCCCCCCCCCCCCHHHHHCCCEEEECCEEEEEECCCCCEEEEEEECCC
T ss_conf             40799988611456715787763131346555542356313664245675485676132289985676724335552588


Q ss_pred             CCCHHHHHHHHHHHHCCEEEEEEECCCCCCHHHHHHHHHHHHCCCCEEEEECCCCC-------CCCCC----CCHHHHHH
Q ss_conf             73002799999997302689999868788655899999999709967998326788-------75321----13388877
Q gi|254780321|r   87 GHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQAIDNNHEIITVLNKADL-------PSADP----DRVKKQIE  155 (606)
Q Consensus        87 GH~DF~~EV~r~l~a~dgaiLvVdA~~Gvq~QT~~~~~~A~~~~l~~I~viNKiD~-------~~A~~----e~v~~ei~  155 (606)
                      ||+||+-|+.++|++.|||+|||||.+|||-+|...+..|.+..+++.+|||||||       |-.|.    ..+.++|-
T Consensus       206 GHVnF~DE~ta~l~~sDgvVlvvDv~EGVmlntEr~ikhaiq~~~~i~vviNKiDRLilELkLPP~DAY~KLrHii~~iN  285 (971)
T KOG0468         206 GHVNFSDETTASLRLSDGVVLVVDVAEGVMLNTERIIKHAIQNRLPIVVVINKVDRLILELKLPPMDAYYKLRHIIDEIN  285 (971)
T ss_pred             CCCCCHHHHHHHHHHCCEEEEEEECCCCCEEEHHHHHHHHHHCCCCEEEEEEHHHHHHHHHCCCHHHHHHHHHHHHHHHC
T ss_conf             75550688888865236379999822570520999999987426767999741678999816983889999878999862


Q ss_pred             HHHH-HHHH----------HHHHHH-------------------------------------------------------
Q ss_conf             5553-2232----------100011-------------------------------------------------------
Q gi|254780321|r  156 ETIG-ISTE----------DALLVS-------------------------------------------------------  169 (606)
Q Consensus       156 ~~~g-~~~~----------~ii~vS-------------------------------------------------------  169 (606)
                      +++. +..+          ++.+.|                                                       
T Consensus       286 ~~is~~s~~~~~~~sP~~gNvcFaS~~~g~cFtl~sFak~Y~~~~~~~~~d~Fa~RLWGdvYf~~ktrkF~kk~~~~~~~  365 (971)
T KOG0468         286 NLISTFSKDDNPVVSPILGNVCFASGKLGFCFTLKSFAKLYADAHGHIDVDDFAKRLWGDVYFHSKTRKFVKKPPDGSGS  365 (971)
T ss_pred             CHHHHCCCCCCCCCCCCCCCEEEECCCCCEEEEHHHHHHHHHHHCCCCCHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCC
T ss_conf             41221025666412644476344215544166657788888986088515441033310000046652001479887664


Q ss_pred             ------------------------------HHC---------CCCCCHHH---------------HHHHHHHHCCCCH--
Q ss_conf             ------------------------------100---------22320067---------------8776321000111--
Q gi|254780321|r  170 ------------------------------AKT---------GEGIPLLL---------------ERIVQQLPSPTSP--  193 (606)
Q Consensus       170 ------------------------------Akt---------G~GV~~LL---------------d~Iv~~iP~P~~~--  193 (606)
                                                    |.-         -.++.+||               |++++++|+|...  
T Consensus       366 rsFVeFILePlYKi~sq~igd~~~~l~~~l~e~~v~ls~e~~k~n~rPll~lvc~~ffg~~sgfvd~~v~hi~sP~e~a~  445 (971)
T KOG0468         366 RSFVEFILEPLYKIFSQVIGDEKDSLKGLLAELGVRLSKEAYKLNPRPLLRLVCKSFFGIESGFVDMPVEHIPSPRENAA  445 (971)
T ss_pred             CHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHCCCCCHHHHHCCCCHHHHHHHHHHCCCHHHHHHHHHHHCCCHHHHHC
T ss_conf             02345567689999999851033201204666410246777623851799999998615303465755764688233111


Q ss_pred             ---------------------HHHHCCCCCCCCCEEE-CCCCCEEEEEEECCCCCCCCCEEEEECCCC---------CCC
Q ss_conf             ---------------------1220123310121011-475725999981698735584588733556---------421
Q gi|254780321|r  194 ---------------------EGANAPLKALLIDSWY-NSYLGVMVLVRIINGQLTKGQSIRLMGTNA---------KYQ  242 (606)
Q Consensus       194 ---------------------~~~~~Pl~alVfds~~-D~~~G~I~~~RV~sG~lk~Gd~I~~~~~g~---------~~~  242 (606)
                                           -++++||-..+.+.+- |.-.--.+++||+||+++.|+.|.....+-         ..+
T Consensus       446 ~K~~hsy~G~~~~~i~~~m~~c~~~~pLm~h~tklyp~dD~~~f~~f~rv~Sg~~~~~q~V~vlgeny~leDEeD~~~~~  525 (971)
T KOG0468         446 RKAEHSYTGTKDSLIYEGMVECNASGPLMVHVTKLYPRDDTVQFHVFGRVYSGQVVTGQDVRVLGENYSLEDEEDMVICE  525 (971)
T ss_pred             CCCCEEECCCCCCHHHHHHHHHCCCCCEEEEEECCEECCCCEEEEEEEEEEECCEEECCEEEEEECCCCCCCCCCCEEEE
T ss_conf             21100302887525889998517777516874041204775035554245304066155235740136679855101334


Q ss_pred             CCCCCCCCCC-EEEEHHCCCCCHHHHHHCCCCCCCCC-CCCEECCCCCCCC-CCCCCCC-CCCCEEEEEECCCCHHHHHH
Q ss_conf             0122233554-12401012471233220110024444-5420004667853-2364552-22212664212677024578
Q gi|254780321|r  243 VERIGILTPK-MIDIEALYPGEIGVMIASIKEVSHTR-VGDTITDDSSPTT-SALPGFK-PIQPVVFCGLFPVDATQFEN  318 (606)
Q Consensus       243 v~~ig~~~~~-~~~v~~l~aGdVG~ii~gik~l~~~~-vGDTl~~~~~p~~-~~Lp~~~-~~~P~v~~~i~p~~~~d~~~  318 (606)
                      |.+++++... +.+++.+.||..- +   |+++++.- ---||+..+.+.. .-.++++ .+.|++-.++.|.|+++..|
T Consensus       526 v~el~v~~arY~i~V~~~~~G~~V-L---I~Gidq~i~KtaTi~~~~~ked~yiFrpl~~~t~~VvKiaveP~nPsELPK  601 (971)
T KOG0468         526 VGELWVVRARYRIPVSRAPAGLWV-L---IEGVDQSIVKTATIKSLEYKEDVYIFRPLKFNTEPVVKVAVEPLNPSELPK  601 (971)
T ss_pred             EEEEEEEEEEEEEEECCCCCCCEE-E---EECCCHHHHHHHHEECCCCCCCEEECCCHHCCCCCEEEEEECCCCHHHHHH
T ss_conf             100456655678884246887589-9---844656776554100136665304325432177642899834688466267


Q ss_pred             HHHHHHHHHHHCCCCCCCC-CCCCCCCCEEEEEECCHHHHHHHHHHHHHHC-CCEEEEECCCCCEEEEEEC---------
Q ss_conf             8999988864112211125-6760004202899637678988898886644-9506973782330335315---------
Q gi|254780321|r  319 LRTAINKLRLNDASFSFEL-ENSTALGFGFRCGFLGLLHLEIIQERLEREF-SLNLIGTSPSVVYELYMHD---------  387 (606)
Q Consensus       319 L~~aL~kL~~~D~sl~~e~-Ets~aLg~Gfr~gglG~LHLeVi~eRL~rEf-g~ev~~t~P~V~Ykv~~~d---------  387 (606)
                      +-++|.|....=|.+.-.- |+.+..     +.|-|||-|+-+..-||.-| .+|+-++-|-|.|-++..+         
T Consensus       602 mldgLrKinKsYPl~~tkVEESGEHv-----ilGtGElYmDcvlyDLR~~yseieikvaDPvv~F~Et~vetssikcfae  676 (971)
T KOG0468         602 MLDGLRKINKSYPLVITKVEESGEHV-----ILGTGELYMDCVLYDLRKSYSEIEIKVADPVVRFCETVVETSSIKCFAE  676 (971)
T ss_pred             HHHHHHHHCCCCCCEEEEHHHCCCEE-----EECCCHHHHHHHHHHHHHHHHHHCEEECCCEEEEEEEEECCCCHHHHCC
T ss_conf             88998753112771787622267458-----8527611278899999987765033323852688876522541123204


Q ss_pred             -------------------------CCEEECC-CHH-------------------HC-----------------------
Q ss_conf             -------------------------6454126-966-------------------62-----------------------
Q gi|254780321|r  388 -------------------------GSMQKLS-NPI-------------------DM-----------------------  399 (606)
Q Consensus       388 -------------------------G~~~~Vd-~p~-------------------~~-----------------------  399 (606)
                                               |. ..++ |+-                   -|                       
T Consensus       677 tpnkknkItmiaEPlek~l~eDiEng~-v~I~wn~krl~effqt~YdWDlLAaRsiWaFgpd~~GpNiL~dDTLp~evdk  755 (971)
T KOG0468         677 TPNKKNKITMIAEPLEKGLAEDIENGV-VVIDWNRKRLGEFFQTKYDWDLLAARSIWAFGPDYTGPNILLDDTLPTEVDK  755 (971)
T ss_pred             CCCCCCCEEEEECHHHHHHHHHHHCCE-EEECCCHHHHHHHHHCCCCHHHHHHCCEECCCCCCCCCCEEECCCCCCHHHH
T ss_conf             888667425550100000567865380-7733666666566510366013420431223787789733205767201148


Q ss_pred             -----------------------------------------------------CCHHH---------HHHHHCCEEEEEE
Q ss_conf             -----------------------------------------------------58677---------8886232699999
Q gi|254780321|r  400 -----------------------------------------------------PEVTK---------IAELREPWIQVTI  417 (606)
Q Consensus       400 -----------------------------------------------------p~~~~---------i~~i~EPi~~~~I  417 (606)
                                                                           |.+.+         ...++||+..++|
T Consensus       756 ~ll~~vkesivQGFqW~trEGPLc~EpIr~VkfKlld~~ia~e~l~rgggQiIPtaRrv~YsafL~AtPrLmEP~Y~VEi  835 (971)
T KOG0468         756 NLLSSVKESIVQGFQWGTREGPLCDEPIRNVKFKLLDAVIAPEPLHRGGGQIIPTARRVAYSAFLMATPRLMEPVYLVEI  835 (971)
T ss_pred             HHHHHHHHHHHHHHHHHHCCCCCCCCCCCCEEEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHHHHHCHHHCCCEEEEEE
T ss_conf             88888899999988887504876677322306898511047642014787001678888888787525353185589997


Q ss_pred             EECCCCCHHHHHHHHHHHHEEECCCCCCC--EEEEEEEECHHHHHHHHHHHHHHHCCCEEEEEEEECCCEE
Q ss_conf             80831000389998863001424433683--6999999604333220468767635741888985435464
Q gi|254780321|r  418 ITPNEYLGSILKLCQERRGIQIDMSHLDN--RAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDYRD  486 (606)
Q Consensus       418 ~~P~ey~G~Vm~~l~~RRG~~~~m~~~~~--~~~i~~~vPl~Eli~~f~~~LkS~T~G~as~~ye~~~Y~~  486 (606)
                      .+|.+.+-.|-+.+++|||.+.......|  .-.+.+-+|--|- +||-+.|+.-|+|.|---.-|.|||.
T Consensus       836 ~apad~v~~Vy~vl~rRRGhV~~d~p~pGSPly~v~a~iPvieS-fGFETDLR~hTqGqa~C~~vF~HW~~  905 (971)
T KOG0468         836 TAPADCVPAVYTVLSRRRGHVTQDIPVPGSPLYTVKAYLPVIES-FGFETDLRVHTQGQAFCLSVFDHWRI  905 (971)
T ss_pred             ECCCCHHHHHHHHHHHHCCCEEECCCCCCCCHHHEEEECCCCCC-CCCCCCEEEECCCHHHHHHHHHHCCC
T ss_conf             43642388999999862573233488899844550463013223-67520026630642578776563131


No 29 
>cd04167 Snu114p Snu114p subfamily.  Snu114p is one of several proteins that make up the U5 small nuclear ribonucleoprotein (snRNP) particle.  U5 is a component of the spliceosome, which catalyzes the splicing of pre-mRNA to remove introns.  Snu114p is homologous to EF-2, but typically contains an additional N-terminal domain not found in Ef-2.  This protein is part of the GTP translation factor family and the Ras superfamily, characterized by five G-box motifs.
Probab=100.00  E-value=0  Score=378.99  Aligned_cols=179  Identities=35%  Similarity=0.527  Sum_probs=156.0

Q ss_pred             EEEEEECCCCCCHHHHHHHHHHHCCCCCCCCC----CCEEECCCHHHHHHCCEEEEEEEEEEEECCCCCEEEEEEEECCC
Q ss_conf             17999801389877889999998298054444----31130586779871950523279999743788438999961787
Q gi|254780321|r   12 RNFSIVAHIDHGKSTLADRFIQHCRGLTEREM----SSQVLDNMDIERERGITIKAQTVRLNYTSTDAKDYQLNLIDTPG   87 (606)
Q Consensus        12 RN~~IiaHvDhGKTTL~d~lL~~tg~i~~~~~----~~~vlD~~~~EreRGITIka~~~~~~~~~~~~~~y~iNlIDTPG   87 (606)
                      ||||||||+|||||||+|+||+.|+.+..+..    ..++||++++||||||||+++.+++.|...+|+.|.||||||||
T Consensus         1 RNvaiigHvdhGKTTL~d~Ll~~t~~~~~~~~~~~~~~~~~D~~~~E~eRgiTI~s~~~sl~~~~~~~k~~~inlIDTPG   80 (213)
T cd04167           1 RNVAIAGHLHHGKTSLLDMLIEQTHDLTPSGKDGWKPLRYTDIRKDEQERGISIKSSPISLVLPDSKGKSYLFNIIDTPG   80 (213)
T ss_pred             CEEEEECCCCCCHHHHHHHHHHHHHHHHHHCCCCCCEEEEECCCHHHHHHCCCEECCEEEEEEECCCCCEEEEEEEECCC
T ss_conf             95999827898989999999997344555404442113575164665420355861459999825667505787788987


Q ss_pred             CCHHHHHHHHHHHHCCEEEEEEECCCCCCHHHHHHHHHHHHCCCCEEEEECCCCC-------CCCC----CCCHHHHHHH
Q ss_conf             3002799999997302689999868788655899999999709967998326788-------7532----1133888775
Q gi|254780321|r   88 HVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQAIDNNHEIITVLNKADL-------PSAD----PDRVKKQIEE  156 (606)
Q Consensus        88 H~DF~~EV~r~l~a~dgaiLvVdA~~Gvq~QT~~~~~~A~~~~l~~I~viNKiD~-------~~A~----~e~v~~ei~~  156 (606)
                      |+||++||+++|++||||+|||||.+|||+||+++|++|.+.++|+|+|||||||       |.+|    +.++.+|+..
T Consensus        81 H~dF~~ev~~al~~~DgailVVDa~eGv~~qT~~~l~~a~~~~l~~ilviNKiDRLi~el~l~p~day~~~~~ii~~vn~  160 (213)
T cd04167          81 HVNFMDEVAAALRLSDGVVLVVDVVEGVTSNTERLIRHAILEGLPIVLVINKIDRLILELKLPPNDAYFKLRHIIDEVNN  160 (213)
T ss_pred             CHHHHHHHHHHHHHCCEEEEEEECCCCCCHHHHHHHHHHHHCCCCEEEEEECCCCCHHHCCCCHHHHHHHHHHHHHHHHH
T ss_conf             24179999988863776799998788875779999999998699989999882343144069989999989999999999


Q ss_pred             HHH-----------HHHHHHHHHHHHCCC--------CCCHHHHHHHHHHHCC
Q ss_conf             553-----------223210001110022--------3200678776321000
Q gi|254780321|r  157 TIG-----------ISTEDALLVSAKTGE--------GIPLLLERIVQQLPSP  190 (606)
Q Consensus       157 ~~g-----------~~~~~ii~vSAktG~--------GV~~LLd~Iv~~iP~P  190 (606)
                      ++.           -...+++++||+.|.        .+.+|+|+|++++|+|
T Consensus       161 ~i~~~~~~~~~~~~p~~~nV~f~Sa~~gw~ftl~~fa~~y~l~d~i~~~ip~P  213 (213)
T cd04167         161 IIASFSTTLSFLFSPENGNVCFASSKFGFCFTLESFAKKYGLVDSIVSNIPSP  213 (213)
T ss_pred             HHHHHCCCCCCEECCCCCCEEEEEECCCEEECCCCHHHHHHHHHHHHHHCCCC
T ss_conf             99970787351656887969999700052123623211689999999638898


No 30 
>cd01886 EF-G Elongation factor G (EF-G) subfamily.  Translocation is mediated by EF-G (also called translocase).  The structure of EF-G closely resembles that of the complex between EF-Tu and tRNA.  This is an example of molecular mimicry; a protein domain evolved so that it mimics the shape of a tRNA molecule.  EF-G in the GTP form binds to the ribosome, primarily through the interaction of its EF-Tu-like domain with the 50S subunit.  The binding of EF-G to the ribosome in this manner stimulates the GTPase activity of EF-G. On GTP hydrolysis, EF-G undergoes a conformational change that forces its arm deeper into the A site on the 30S subunit.  To accommodate this domain, the peptidyl-tRNA in the A site moves to the P site, carrying the mRNA and the deacylated tRNA with it.  The ribosome may be prepared for these rearrangements by the initial binding of EF-G as well.  The dissociation of EF-G leaves the ribosome ready to accept the next aminoacyl-tRNA into the A site.  This group conta
Probab=100.00  E-value=0  Score=372.55  Aligned_cols=142  Identities=44%  Similarity=0.572  Sum_probs=134.0

Q ss_pred             EEEEECCCCCCHHHHHHHHHHHCCCCCCCC---CCCEEECCCHHHHHHCCEEEEEEEEEEEECCCCCEEEEEEEECCCCC
Q ss_conf             799980138987788999999829805444---43113058677987195052327999974378843899996178730
Q gi|254780321|r   13 NFSIVAHIDHGKSTLADRFIQHCRGLTERE---MSSQVLDNMDIERERGITIKAQTVRLNYTSTDAKDYQLNLIDTPGHV   89 (606)
Q Consensus        13 N~~IiaHvDhGKTTL~d~lL~~tg~i~~~~---~~~~vlD~~~~EreRGITIka~~~~~~~~~~~~~~y~iNlIDTPGH~   89 (606)
                      ||+|+||+|+|||||+|+||+.+|.+.+.+   .+++++|++++|++|||||.++.+++.|     ++++|||||||||.
T Consensus         1 Niai~gH~gaGKTtL~EalL~~ag~i~r~G~v~~g~tv~D~~~eE~~R~isi~~~~~~~~w-----~~~~inliDTPG~~   75 (270)
T cd01886           1 NIGIIAHIDAGKTTTTERILYYTGRIHKIGEVHGGGATMDFMEQERERGITIQSAATTCFW-----KDHRINIIDTPGHV   75 (270)
T ss_pred             CEEEEECCCCCHHHHHHHHHHHCCCCCCCCEECCCCCCCCCCHHHHHCCCEEECCEEEEEE-----CCEEEEEEECCCCH
T ss_conf             9899968999988999999986687355815538975566848898768707336689998-----99899998696967


Q ss_pred             HHHHHHHHHHHHCCEEEEEEECCCCCCHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCCHHHHHHHHHH
Q ss_conf             0279999999730268999986878865589999999970996799832678875321133888775553
Q gi|254780321|r   90 DFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQAIDNNHEIITVLNKADLPSADPDRVKKQIEETIG  159 (606)
Q Consensus        90 DF~~EV~r~l~a~dgaiLvVdA~~Gvq~QT~~~~~~A~~~~l~~I~viNKiD~~~A~~e~v~~ei~~~~g  159 (606)
                      ||++|+.++|+|+|+||+||||.+|||+||+..|..|.++++|+|+||||||+++||++++.++|++.++
T Consensus        76 DF~~e~~~aL~~~D~AviVv~a~~GVe~~T~~~w~~~~~~~lP~i~fINKmDre~ad~~~~l~~i~~~lg  145 (270)
T cd01886          76 DFTIEVERSLRVLDGAVAVFDAVAGVEPQTETVWRQADRYNVPRIAFVNKMDRTGADFFRVVEQIREKLG  145 (270)
T ss_pred             HHHHHHHHHHHHHCEEEEEEECCCCHHHHHHHHHHHHHHCCCCEEEEEECCCCCCCCCHHHHHHHHHHHC
T ss_conf             8899999998775559999846764426369999889984999899998878778871668999999858


No 31 
>PRK12317 elongation factor 1-alpha; Reviewed
Probab=100.00  E-value=0  Score=364.25  Aligned_cols=267  Identities=28%  Similarity=0.476  Sum_probs=216.9

Q ss_pred             CEEEEEECCCCCCHHHHHHHHHHHCCCCCCCCC----------------CCEEECCCHHHHHHCCEEEEEEEEEEEECCC
Q ss_conf             317999801389877889999998298054444----------------3113058677987195052327999974378
Q gi|254780321|r   11 IRNFSIVAHIDHGKSTLADRFIQHCRGLTEREM----------------SSQVLDNMDIERERGITIKAQTVRLNYTSTD   74 (606)
Q Consensus        11 IRN~~IiaHvDhGKTTL~d~lL~~tg~i~~~~~----------------~~~vlD~~~~EreRGITIka~~~~~~~~~~~   74 (606)
                      -=|++++||||||||||+.|||+.+|.++.+..                -..+||.+++||+|||||     .+.|.+++
T Consensus         7 ~l~i~~~GhVD~GKSTL~G~Ll~~~g~~~~~~~~~~~~~~~~~g~~s~~~a~~~D~~~eEr~rGiTi-----d~~~~~f~   81 (426)
T PRK12317          7 HLNLAVIGHVDHGKSTLVGRLLYETGAVDEHIIEEYEEEAKKKGKESFKFAWVMDRLKEERERGVTI-----DLAHKKFE   81 (426)
T ss_pred             EEEEEEEEECCCCHHHHHHHHHHHCCCCCHHHHHHHHHHHHHCCCCCCEEEEECCCCHHHHHCCCEE-----EEEEEEEE
T ss_conf             8499999522876888876898772994489999999899864877521432125786687558278-----83169995


Q ss_pred             CCEEEEEEEECCCCCHHHHHHHHHHHHCCEEEEEEECCC--CCCHHHHHHHHHHHHCCCC-EEEEECCCCCCCCCC---C
Q ss_conf             843899996178730027999999973026899998687--8865589999999970996-799832678875321---1
Q gi|254780321|r   75 AKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQ--GVEAQTLANVYQAIDNNHE-IITVLNKADLPSADP---D  148 (606)
Q Consensus        75 ~~~y~iNlIDTPGH~DF~~EV~r~l~a~dgaiLvVdA~~--Gvq~QT~~~~~~A~~~~l~-~I~viNKiD~~~A~~---e  148 (606)
                      ++++.++|||+|||.||.-....+.+.+|.|+|||||.+  |+++||++|+.+|...|++ +|++|||||+.+.+.   +
T Consensus        82 ~~~~~~~iiD~PGH~~fi~nmi~Gas~~D~ailvV~A~~~~G~~~QT~eHl~l~~~lgi~~iiV~vnKmD~v~~~~~~~~  161 (426)
T PRK12317         82 TDKYYFTIIDCPGHRDFVKNMITGASQADAAVLVVSARDAGGVMPQTREHVFLARTLGINQLIVAINKMDAVNYDEKRYN  161 (426)
T ss_pred             CCCCEEEEEECCCCHHHHHHHHHHHCCCCEEEEEEECCCCCCCCHHHHHHHHHHHHHCCCEEEEEEECCCCCCCCHHHHH
T ss_conf             49816999878963667877874534677279999636566764778999999998099839999953335677889999


Q ss_pred             CHHHHHHHHH---HHHHHH--HHHHHHHCCCCCCH------------HHHHHHHHHHCCCCHHHHHCCCCCCCCCEEECC
Q ss_conf             3388877555---322321--00011100223200------------678776321000111122012331012101147
Q gi|254780321|r  149 RVKKQIEETI---GISTED--ALLVSAKTGEGIPL------------LLERIVQQLPSPTSPEGANAPLKALLIDSWYNS  211 (606)
Q Consensus       149 ~v~~ei~~~~---g~~~~~--ii~vSAktG~GV~~------------LLd~Iv~~iP~P~~~~~~~~Pl~alVfds~~D~  211 (606)
                      ++..++.+++   |+..++  ++|+||.+|.|+..            |++++ +.+++|.  +..+.||++.|.+.+.-+
T Consensus       162 ~i~~~~~~~l~~~g~~~~~i~~iPiSa~~Gdni~~~s~~~~Wy~G~tLl~~L-~~~~~~~--~~~~~p~r~~I~~v~~~~  238 (426)
T PRK12317        162 EVKEEVSKLLKMVGYKPDDIPFIPVSAFEGDNVVKKSDNTPWYNGPTLLEAL-DALKPPE--KPTDKPLRIPIQDVYSIT  238 (426)
T ss_pred             HHHHHHHHHHHHCCCCCCCCEEEEEECCCCCCCCCCCCCCCCCCCHHHHHHH-HCCCCCC--CCCCCCEEEEEEEEEEEC
T ss_conf             9999999999970988034708875323465641167668632207899998-6377776--655785355787788406


Q ss_pred             CCCEEEEEEECCCCCCCCCEEEEECCCCCCCCCCCCCCCCCEEEEHHCCCCC-HHHHHHCCCCCCCCCCCCEECCCCCC
Q ss_conf             5725999981698735584588733556421012223355412401012471-23322011002444454200046678
Q gi|254780321|r  212 YLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVERIGILTPKMIDIEALYPGE-IGVMIASIKEVSHTRVGDTITDDSSP  289 (606)
Q Consensus       212 ~~G~I~~~RV~sG~lk~Gd~I~~~~~g~~~~v~~ig~~~~~~~~v~~l~aGd-VG~ii~gik~l~~~~vGDTl~~~~~p  289 (606)
                      ..|++..|+|.+|+++.||+|.+.++++..+|..+..   +..+++++.||| |+..+.++ +..+++.||.||++++|
T Consensus       239 g~Gtvv~G~v~sG~i~~Gd~v~i~Ps~~~~~VksI~~---~~~~v~~a~aG~~v~l~L~~i-~~~dI~rG~Vl~~~~~~  313 (426)
T PRK12317        239 GVGTVPVGRVETGVLKVGDKVVFMPAGKVGEVKSIEM---HHEELPQAEPGDNIGFNVRGV-GKNDIKRGDVAGHTDNP  313 (426)
T ss_pred             CCEEEEEEEECCCCCCCCCEEEEECCCCCEEEEEEEE---CCCEEEEEECCCEEEEEEECC-CHHCCCCCCEEECCCCC
T ss_conf             8707998684438543799999967998658976886---694788995898699998367-44227786489479999


No 32 
>cd04168 TetM_like Tet(M)-like subfamily.  Tet(M), Tet(O), Tet(W), and OtrA are tetracycline resistance genes found in Gram-positive and Gram-negative bacteria.  Tetracyclines inhibit protein synthesis by preventing aminoacyl-tRNA from binding to the ribosomal acceptor site.  This subfamily contains tetracycline resistance proteins that function through ribosomal protection and are typically found on mobile genetic elements, such as transposons or plasmids, and are often conjugative.  Ribosomal protection proteins are homologous to the elongation factors EF-Tu and EF-G.  EF-G and Tet(M) compete for binding on the ribosomes.  Tet(M) has a higher affinity than EF-G, suggesting these two proteins may have overlapping binding sites and that Tet(M) must be released before EF-G can bind.  Tet(M) and Tet(O) have been shown to have ribosome-dependent GTPase activity.  These proteins are part of the GTP translation factor family, which includes EF-G, EF-Tu, EF2, LepA, and SelB.
Probab=100.00  E-value=0  Score=365.72  Aligned_cols=172  Identities=37%  Similarity=0.541  Sum_probs=156.7

Q ss_pred             EEEEECCCCCCHHHHHHHHHHHCCCCCCCC---CCCEEECCCHHHHHHCCEEEEEEEEEEEECCCCCEEEEEEEECCCCC
Q ss_conf             799980138987788999999829805444---43113058677987195052327999974378843899996178730
Q gi|254780321|r   13 NFSIVAHIDHGKSTLADRFIQHCRGLTERE---MSSQVLDNMDIERERGITIKAQTVRLNYTSTDAKDYQLNLIDTPGHV   89 (606)
Q Consensus        13 N~~IiaHvDhGKTTL~d~lL~~tg~i~~~~---~~~~vlD~~~~EreRGITIka~~~~~~~~~~~~~~y~iNlIDTPGH~   89 (606)
                      ||+|+||+|||||||+|+||+.||.+++.+   .+++++|++++||+|||||.++.+++.|     ++++|||||||||.
T Consensus         1 Niai~gH~~~GKTtL~e~lL~~~g~i~r~G~v~~g~t~~D~~~eE~~r~isi~~~~~~~~~-----~~~~~n~iDtPG~~   75 (237)
T cd04168           1 NIGILAHVDAGKTTLTESLLYTSGAIRKLGSVDKGTTRTDTMELERQRGITIFSAVASFQW-----EDTKVNLIDTPGHM   75 (237)
T ss_pred             CEEEECCCCCCHHHHHHHHHHHCCHHHHCCCEECCCCCCCCHHHHHHHCCEEEEEEEEEEE-----CCEEEEEEECCCCH
T ss_conf             9899938998999999999996571222663306830378549989848703105899998-----99879998898846


Q ss_pred             HHHHHHHHHHHHCCEEEEEEECCCCCCHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCCHHHHHHHHHHHH--------
Q ss_conf             027999999973026899998687886558999999997099679983267887532113388877555322--------
Q gi|254780321|r   90 DFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQAIDNNHEIITVLNKADLPSADPDRVKKQIEETIGIS--------  161 (606)
Q Consensus        90 DF~~EV~r~l~a~dgaiLvVdA~~Gvq~QT~~~~~~A~~~~l~~I~viNKiD~~~A~~e~v~~ei~~~~g~~--------  161 (606)
                      ||.+|+.++|+++|+||+||||.+|||+||..+|..|.++++|+++||||||+++||++++.++|++.++..        
T Consensus        76 dF~~e~~~al~~~D~av~Vv~a~~Gv~~~t~~~~~~~~~~~~P~iifiNKmDre~adf~~~l~~i~~~l~~~~~p~~~p~  155 (237)
T cd04168          76 DFIAEVERSLSVLDGAILVISAVEGVQAQTRILWRLLRKLNIPTIIFVNKIDRAGADLEKVYQEIKEKLSSDIVPMQKVG  155 (237)
T ss_pred             HHHHHHHHHHHHCCCEEEEEECCCCCCCCHHHHHHHHHHCCCCEEEEEECCCCCCCCHHHHHHHHHHHHCCCEEEEECCC
T ss_conf             56668988976348169999658882234499999999859985998624457899999999999999789747677775


Q ss_pred             -------------------------------------HHH----------------HHHHHHHCCCCCCHHHHHHHHHHH
Q ss_conf             -------------------------------------321----------------000111002232006787763210
Q gi|254780321|r  162 -------------------------------------TED----------------ALLVSAKTGEGIPLLLERIVQQLP  188 (606)
Q Consensus       162 -------------------------------------~~~----------------ii~vSAktG~GV~~LLd~Iv~~iP  188 (606)
                                                           .++                ++++||.+|.||++|||+|++++|
T Consensus       156 ~~~~~~~~~~~~~~liE~vae~DD~LlEkyLe~~elt~eel~~~L~~~~~~g~i~PV~~GSA~~n~GV~~LLd~i~~~~P  235 (237)
T cd04168         156 LAPNICETNEIDDEFWETLAEGDDELLEKYLEGGPIEELELDNELSARIAKRKVFPVYHGSALKGIGIEELLEGITKLFP  235 (237)
T ss_pred             CCCCCCCCCCCCHHHHHHHHCCCHHHHHHHHCCCCCCHHHHHHHHHHHHHCCCEEEEEECCCCCCCCHHHHHHHHHHHCC
T ss_conf             55664445441088999876469999998857898678899999999997492988996789989599999999998778


Q ss_pred             C
Q ss_conf             0
Q gi|254780321|r  189 S  189 (606)
Q Consensus       189 ~  189 (606)
                      |
T Consensus       236 S  236 (237)
T cd04168         236 T  236 (237)
T ss_pred             C
T ss_conf             9


No 33 
>PRK05124 cysN sulfate adenylyltransferase subunit 1; Provisional
Probab=100.00  E-value=0  Score=351.17  Aligned_cols=268  Identities=22%  Similarity=0.342  Sum_probs=211.5

Q ss_pred             HHCEEEEEECCCCCCHHHHHHHHHHHCCCCCCCCC------------------CCEEECCCHHHHHHCCEEEEEEEEEEE
Q ss_conf             25317999801389877889999998298054444------------------311305867798719505232799997
Q gi|254780321|r    9 SRIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREM------------------SSQVLDNMDIERERGITIKAQTVRLNY   70 (606)
Q Consensus         9 ~~IRN~~IiaHvDhGKTTL~d~lL~~tg~i~~~~~------------------~~~vlD~~~~EreRGITIka~~~~~~~   70 (606)
                      +.+=||.++||||||||||..|||+.+|.+.++..                  =..+||.++.||||||||     .+.|
T Consensus        25 k~~l~~v~~GhVD~GKSTl~GrlL~~~~~v~~~~~~~~~~~s~~~g~~~~~~~~a~l~D~l~~ERe~GiTI-----dva~   99 (475)
T PRK05124         25 KSLLRFLTCGSVDDGKSTLIGRLLHDTKQIYEDQLASLHNDSKRHGTQGEKLDLALLVDGLQAEREQGITI-----DVAY   99 (475)
T ss_pred             CCEEEEEEECCCCCCHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHCCCCCCEEEEEEECCCHHHHHCCCEE-----EEEE
T ss_conf             98579999905579778888999998199788999999999998288777222444205998898669716-----9567


Q ss_pred             ECCCCCEEEEEEEECCCCCHHHHHHHHHHHHCCEEEEEEECCCCCCHHHHHHHHHHHHCCCC-EEEEECCCCCCCCC---
Q ss_conf             43788438999961787300279999999730268999986878865589999999970996-79983267887532---
Q gi|254780321|r   71 TSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQAIDNNHE-IITVLNKADLPSAD---  146 (606)
Q Consensus        71 ~~~~~~~y~iNlIDTPGH~DF~~EV~r~l~a~dgaiLvVdA~~Gvq~QT~~~~~~A~~~~l~-~I~viNKiD~~~A~---  146 (606)
                      .++++++++++++|||||.||.--....-+-+|.|||||||.+|+++||++|++++...|++ +|++|||||+.+.+   
T Consensus       100 ~~f~t~~r~~~i~DaPGH~~f~~NMitGas~aD~aiLvVdA~~G~~~QTreH~~i~~llGI~~iIVaVNKMDlV~~~~~~  179 (475)
T PRK05124        100 RYFSTEKRKFIIADTPGHEQYTRNMATGASTCDLAILLIDARKGVLDQTRRHSFIATLLGIKHLVVAVNKMDLVDYSEEV  179 (475)
T ss_pred             EEEECCCEEEEEEECCCHHHHHHHHHHHHHHCCEEEEEEECCCCCHHHHHHHHHHHHHCCCCEEEEEEECHHCCCCCHHH
T ss_conf             89953876899973796387788898888767889999989889478889999999865998599998504313543999


Q ss_pred             CCCHHHHHHHHH---HHHHH-HHHHHHHHCCCCC------------CHHHHHHHHHHHCCCCHHHHHCCCCCCCCCEEEC
Q ss_conf             113388877555---32232-1000111002232------------0067877632100011112201233101210114
Q gi|254780321|r  147 PDRVKKQIEETI---GISTE-DALLVSAKTGEGI------------PLLLERIVQQLPSPTSPEGANAPLKALLIDSWYN  210 (606)
Q Consensus       147 ~e~v~~ei~~~~---g~~~~-~ii~vSAktG~GV------------~~LLd~Iv~~iP~P~~~~~~~~Pl~alVfds~~D  210 (606)
                      ++++..++.+++   |+.++ .++|+||.+|.||            ..||+++ +.++.|..  ..+.|||+.|-+..-.
T Consensus       180 f~~I~~e~~~~l~~~g~~~~v~~IPISal~GdNIv~~S~~m~WY~GptLle~L-e~~~~~~~--~~~~pfRlPVq~V~r~  256 (475)
T PRK05124        180 FERIREDYLTFAEQLPGNLDIRFVPLSALEGDNVVSQSESMPWYSGPTLLEVL-ETVDIQRE--VDAQPFRFPVQYVNRP  256 (475)
T ss_pred             HHHHHHHHHHHHHHCCCCCCCCEEECCCCCCCCCCCCCCCCCCCCCCCHHHHH-HCCCCCCC--CCCCCCCCCCEEEECC
T ss_conf             99999999999997499888507754134576762156678745675399998-55888876--5556655665798626


Q ss_pred             CCCCEEEEEEECCCCCCCCCEEEEECCCCCCCCCCCCCCCCCEEEEHHCCCCCHHHHHHCCCCCCCCCCCCEECCCCCC
Q ss_conf             7572599998169873558458873355642101222335541240101247123322011002444454200046678
Q gi|254780321|r  211 SYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVERIGILTPKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSP  289 (606)
Q Consensus       211 ~~~G~I~~~RV~sG~lk~Gd~I~~~~~g~~~~v~~ig~~~~~~~~v~~l~aGdVG~ii~gik~l~~~~vGDTl~~~~~p  289 (606)
                      .+-++...|||.||++++||+|.++++|++-+|.+|..+.   .+++++.|||-  +...+++--++..||.||++++|
T Consensus       257 ~~~~rg~~G~I~sG~i~~GD~V~vlPsg~~a~Vk~I~~~~---~~~~~A~aG~s--V~l~L~deiDIsRGdVl~~~~~~  330 (475)
T PRK05124        257 NLDFRGYAGTLASGVVKVGDRVKVLPSGKESNVARIVTFD---GDLEEAFAGEA--ITLVLEDEIDISRGDLLVAADEA  330 (475)
T ss_pred             CCCCEEEEEEEEECEECCCCEEEECCCCCEEEEEEEEECC---CCCCCCCCCCE--EEEEEECCCCCCCCCEEECCCCC
T ss_conf             8773168899713327179989993899758989999658---65254389987--99996034468998389738998


No 34 
>PTZ00336 elongation factor 1-alpha; Provisional
Probab=100.00  E-value=0  Score=354.38  Aligned_cols=265  Identities=26%  Similarity=0.453  Sum_probs=212.1

Q ss_pred             EEEEEECCCCCCHHHHHHHHHHHCCCCCCCCC-------C---------CEEECCCHHHHHHCCEEEEEEEEEEEECCCC
Q ss_conf             17999801389877889999998298054444-------3---------1130586779871950523279999743788
Q gi|254780321|r   12 RNFSIVAHIDHGKSTLADRFIQHCRGLTEREM-------S---------SQVLDNMDIERERGITIKAQTVRLNYTSTDA   75 (606)
Q Consensus        12 RN~~IiaHvDhGKTTL~d~lL~~tg~i~~~~~-------~---------~~vlD~~~~EreRGITIka~~~~~~~~~~~~   75 (606)
                      =||+++||||||||||+.|||+.+|.++++..       .         ..+||.+++||||||||     .+.|.+++.
T Consensus         8 lni~~~GhVD~GKSTL~G~Ll~~~~~v~~~~l~~~~~~~~~~g~~s~~~a~~~D~~~~Er~rGiTi-----d~~~~~f~t   82 (449)
T PTZ00336          8 MNLVVVGHVDAGKSTATGHLIYKCGGIDKRTIEKFEKEAAEIGKASFKYAWVLDKLKAERERGITI-----DIALWKFES   82 (449)
T ss_pred             EEEEEEECCCCCHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHCCCCHHHHHHHCCCHHHHCCCEEE-----EEEEEEEEC
T ss_conf             399999277896888899999874884789999999999871875143254512772232287589-----867999974


Q ss_pred             CEEEEEEEECCCCCHHHHHHHHHHHHCCEEEEEEECCCCCCH-------HHHHHHHHHHHCCCC-EEEEECCCCCC--C-
Q ss_conf             438999961787300279999999730268999986878865-------589999999970996-79983267887--5-
Q gi|254780321|r   76 KDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEA-------QTLANVYQAIDNNHE-IITVLNKADLP--S-  144 (606)
Q Consensus        76 ~~y~iNlIDTPGH~DF~~EV~r~l~a~dgaiLvVdA~~Gvq~-------QT~~~~~~A~~~~l~-~I~viNKiD~~--~-  144 (606)
                      .+++++|||+|||.||.--.....+.+|.|||||||.+|+++       ||++|+.+|...|++ +|++|||||.+  + 
T Consensus        83 ~~~~~~iiD~PGH~~fi~nmi~Gas~aD~aiLVVdA~~G~~e~g~~~~gQTreHl~i~~~Lgv~~iiV~vNKmD~~~v~~  162 (449)
T PTZ00336         83 PKSVFTIIDAPGHRDFIKNMITGTSQADAAILMIDSTHGGFEAGISKDGQTREHALLAFTLGVKQMVVCCNKMDDKTVTY  162 (449)
T ss_pred             CCEEEEEEECCCHHHHHHHHHHHHCCCCEEEEEEECCCCCEECCCCCCCCCHHHHHHHHHCCCCEEEEEEECCCCCCCCC
T ss_conf             98489998689468889999976500676799998787741035566775399999998669977999986201566211


Q ss_pred             --CCCCCHHHHHHHHH---HHHHHH--HHHHHHHCCCCCC------------HHHHHHHHHHHCCCCHHHHHCCCCCCCC
Q ss_conf             --32113388877555---322321--0001110022320------------0678776321000111122012331012
Q gi|254780321|r  145 --ADPDRVKKQIEETI---GISTED--ALLVSAKTGEGIP------------LLLERIVQQLPSPTSPEGANAPLKALLI  205 (606)
Q Consensus       145 --A~~e~v~~ei~~~~---g~~~~~--ii~vSAktG~GV~------------~LLd~Iv~~iP~P~~~~~~~~Pl~alVf  205 (606)
                        .+++++..++..++   |+..++  ++|+||.+|.|+-            .||+++ +.+++|.  +..+.||++.|-
T Consensus       163 ~~~r~~~i~~e~~~~l~~~g~~~~~v~~IPiSa~~Gdni~~~s~~~~Wy~GptLl~~L-d~~~~~~--r~~~~p~r~pV~  239 (449)
T PTZ00336        163 AQSRYDEISKEVGAYLKRVGYNPEKVRFIPISGWQGDNMIEKSDNMPWYKGPTLLDAL-DMLEPPV--RPVDKPLRLPLQ  239 (449)
T ss_pred             CHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCEECCCHHHHHH-HCCCCCC--CCCCCCCCCCCC
T ss_conf             3789999999999999874999000543542010477753265557541052489997-5448987--756676423401


Q ss_pred             CEEECCCCCEEEEEEECCCCCCCCCEEEEECCCCCCCCCCCCCCCCCEEEEHHCCCCC-HHHHHHCCCCCCCCCCCCEEC
Q ss_conf             1011475725999981698735584588733556421012223355412401012471-233220110024444542000
Q gi|254780321|r  206 DSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVERIGILTPKMIDIEALYPGE-IGVMIASIKEVSHTRVGDTIT  284 (606)
Q Consensus       206 ds~~D~~~G~I~~~RV~sG~lk~Gd~I~~~~~g~~~~v~~ig~~~~~~~~v~~l~aGd-VG~ii~gik~l~~~~vGDTl~  284 (606)
                      +.+.-+..|.+..|||.+|++++||+|.+++++++.+|..|..   +..+++++.||| ||..+.++ +..+++.||.++
T Consensus       240 ~vf~~~g~gtvv~G~V~sG~v~~Gd~V~i~Ps~~~~~VksI~~---~~~~v~~A~aG~~V~i~L~~i-~~~dI~rGdVl~  315 (449)
T PTZ00336        240 DVYKIGGIGTVPVGRVETGIMKPGDVVTFAPANVTTEVKSIEM---HHEQLAEAQPGDNVGFNVKNV-SVKDIRRGNVCG  315 (449)
T ss_pred             EEEECCCCCEEEEEEEECCCCCCCCEEEECCCCCEEEEEEEEE---CCCEECEECCCCEEEEECCCC-CHHCCCCCCEEE
T ss_conf             0773278831888999436305899999917998799989998---993859677998478924887-353078863996


Q ss_pred             CCCC
Q ss_conf             4667
Q gi|254780321|r  285 DDSS  288 (606)
Q Consensus       285 ~~~~  288 (606)
                      +..+
T Consensus       316 ~~~~  319 (449)
T PTZ00336        316 NSKN  319 (449)
T ss_pred             CCCC
T ss_conf             2899


No 35 
>PTZ00141 elongation factor 1 alpha; Provisional
Probab=100.00  E-value=0  Score=349.83  Aligned_cols=266  Identities=25%  Similarity=0.403  Sum_probs=214.1

Q ss_pred             CEEEEEECCCCCCHHHHHHHHHHHCCCCCCCCC-----------C-----CEEECCCHHHHHHCCEEEEEEEEEEEECCC
Q ss_conf             317999801389877889999998298054444-----------3-----113058677987195052327999974378
Q gi|254780321|r   11 IRNFSIVAHIDHGKSTLADRFIQHCRGLTEREM-----------S-----SQVLDNMDIERERGITIKAQTVRLNYTSTD   74 (606)
Q Consensus        11 IRN~~IiaHvDhGKTTL~d~lL~~tg~i~~~~~-----------~-----~~vlD~~~~EreRGITIka~~~~~~~~~~~   74 (606)
                      .=||+++||||||||||+.|||+.+|.++++..           .     +.+||.++.||||||||     .+.|.+++
T Consensus         7 ~l~i~~~GhVD~GKSTL~G~Ll~~~g~v~~~~~~~~~~~~~~~g~~~~~~a~~~D~~~~Er~rGiTi-----dv~~~~f~   81 (443)
T PTZ00141          7 HINLVVIGHVDSGKSTTTGHLIYKLGGIDKRTIEKFEKESAEMGKGSFKYAWVLDKLKAERERGITI-----DIALWKFE   81 (443)
T ss_pred             EEEEEEECCCCCCHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHCCCCCEEHHHHCCCHHHHHCCCEE-----EEEEEEEE
T ss_conf             6599999477982888899999873884688999998888871787200044530776676367107-----34799994


Q ss_pred             CCEEEEEEEECCCCCHHHHHHHHHHHHCCEEEEEEECCCCCCH-------HHHHHHHHHHHCCCC-EEEEECCCCCCCC-
Q ss_conf             8438999961787300279999999730268999986878865-------589999999970996-7998326788753-
Q gi|254780321|r   75 AKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEA-------QTLANVYQAIDNNHE-IITVLNKADLPSA-  145 (606)
Q Consensus        75 ~~~y~iNlIDTPGH~DF~~EV~r~l~a~dgaiLvVdA~~Gvq~-------QT~~~~~~A~~~~l~-~I~viNKiD~~~A-  145 (606)
                      ..+++++|||+|||.||.--.....+.+|.|||||||.+|++.       ||++|+.+|...|++ +|++|||||+.+. 
T Consensus        82 t~~~~~~iiD~PGH~~fi~nmi~Gas~aD~ailvVdA~~G~~e~gf~~~gQTreH~~i~~~lgv~~iIVaVNKmD~v~~~  161 (443)
T PTZ00141         82 TPKYYYTVIDAPGHRDFIKNMITGTSQADVALLVVPAEVGGFEGAFSKEGQTREHALLAFTLGVKQIIVGINKMDTCDYK  161 (443)
T ss_pred             CCCEEEEEEECCCHHHHHHHHHHHHCCCCEEEEEEECCCCCCCCCCCCCCCCHHHHHHHHHCCCCEEEEEEEEECCCCCH
T ss_conf             39889999989972888999996341077589999867785213466678639999999973997599999962156660


Q ss_pred             --CCCCHHHHHHHHH---HHHHHH--HHHHHHHCCCCC------------CHHHHHHHHHHHCCCCHHHHHCCCCCCCCC
Q ss_conf             --2113388877555---322321--000111002232------------006787763210001111220123310121
Q gi|254780321|r  146 --DPDRVKKQIEETI---GISTED--ALLVSAKTGEGI------------PLLLERIVQQLPSPTSPEGANAPLKALLID  206 (606)
Q Consensus       146 --~~e~v~~ei~~~~---g~~~~~--ii~vSAktG~GV------------~~LLd~Iv~~iP~P~~~~~~~~Pl~alVfd  206 (606)
                        +++++..++.+++   |+..++  ++|+||.+|.|+            ..|++++ +.+++|.  ...+.||++.|-+
T Consensus       162 e~~f~~i~~~~~~~l~~~g~~~~~i~~iPiSa~~Gdni~~~s~~~~Wy~G~tLle~L-d~~~~~~--~~~~~p~r~pI~~  238 (443)
T PTZ00141        162 EDRYEEIQKEVCGYLKKVGYNAEKVPFVPISGFEGDNMIEKSDKMPWYKGKTLVEAL-DTMEPPK--RPVDKPLRLPLQG  238 (443)
T ss_pred             HHHHHHHHHHHHHHHHHCCCCCCCCEEEECCCCCCCCCCCCCCCCCEEHHHHHHHHH-HCCCCCC--CCCCCCCCCCEEE
T ss_conf             999999999999999973999566618963412466532466556442356899998-5689875--6555665340503


Q ss_pred             EEECCCCCEEEEEEECCCCCCCCCEEEEECCCCCCCCCCCCCCCCCEEEEHHCCCCC-HHHHHHCCCCCCCCCCCCEECC
Q ss_conf             011475725999981698735584588733556421012223355412401012471-2332201100244445420004
Q gi|254780321|r  207 SWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVERIGILTPKMIDIEALYPGE-IGVMIASIKEVSHTRVGDTITD  285 (606)
Q Consensus       207 s~~D~~~G~I~~~RV~sG~lk~Gd~I~~~~~g~~~~v~~ig~~~~~~~~v~~l~aGd-VG~ii~gik~l~~~~vGDTl~~  285 (606)
                      .+.-+..|.+..|+|.+|+++.||+|.+++++.+.+|..|..   ...+++++.||| |+..+.++ +..+++.||.||+
T Consensus       239 v~~~~g~gtvv~G~V~sG~i~~Gd~v~i~Ps~~~~~VksI~~---~~~~v~~A~aG~~V~i~L~~i-~~~dI~rG~Vl~~  314 (443)
T PTZ00141        239 VYKIGGIGTVPVGRVETGILKAGMVLTFAPSAVTTECKSVEM---HHEVVEEARPGDNVGFNVKNV-STKDIKRGHVASD  314 (443)
T ss_pred             EEEECCCCEEEEEEEEEEEEECCCEEEECCCCCEEEEEEEEE---CCCEECEECCCCEEEEECCCC-CHHHCCCCEEEEC
T ss_conf             886168732787676156995697899877998899989998---996908786998379945898-6530278619766


Q ss_pred             CCC
Q ss_conf             667
Q gi|254780321|r  286 DSS  288 (606)
Q Consensus       286 ~~~  288 (606)
                      +.+
T Consensus       315 ~~~  317 (443)
T PTZ00141        315 SKN  317 (443)
T ss_pred             CCC
T ss_conf             999


No 36 
>COG5256 TEF1 Translation elongation factor EF-1alpha (GTPase) [Translation, ribosomal structure and biogenesis]
Probab=100.00  E-value=0  Score=348.84  Aligned_cols=273  Identities=30%  Similarity=0.500  Sum_probs=227.0

Q ss_pred             EEEEEECCCCCCHHHHHHHHHHHCCCCCCCCCC----------------CEEECCCHHHHHHCCEEEEEEEEEEEECCCC
Q ss_conf             179998013898778899999982980544443----------------1130586779871950523279999743788
Q gi|254780321|r   12 RNFSIVAHIDHGKSTLADRFIQHCRGLTEREMS----------------SQVLDNMDIERERGITIKAQTVRLNYTSTDA   75 (606)
Q Consensus        12 RN~~IiaHvDhGKTTL~d~lL~~tg~i~~~~~~----------------~~vlD~~~~EreRGITIka~~~~~~~~~~~~   75 (606)
                      -|++.|||||||||||..||||.+|.|+.+.+.                ..+||++.+|||||+||     ...+..++.
T Consensus         8 ~nl~~iGHVD~GKSTl~GrLly~~G~id~~tmeK~~~ea~~~gK~sf~fawvlD~tkeERerGvTi-----~~~~~~fet   82 (428)
T COG5256           8 LNLVFIGHVDAGKSTLVGRLLYDLGEIDKRTMEKLEKEAKELGKESFKFAWVLDKTKEERERGVTI-----DVAHSKFET   82 (428)
T ss_pred             EEEEEECCCCCCCHHHHHHHHHHHCCCCHHHHHHHHHHHHHCCCCCEEEEEEECCCHHHHHCCEEE-----EEEEEEEEC
T ss_conf             289998378787034455657773797989999999999861977168999853886678666689-----977788643


Q ss_pred             CEEEEEEEECCCCCHHHHHHHHHHHHCCEEEEEEECCCC-------CCHHHHHHHHHHHHCCCC-EEEEECCCCCCCCC-
Q ss_conf             438999961787300279999999730268999986878-------865589999999970996-79983267887532-
Q gi|254780321|r   76 KDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQG-------VEAQTLANVYQAIDNNHE-IITVLNKADLPSAD-  146 (606)
Q Consensus        76 ~~y~iNlIDTPGH~DF~~EV~r~l~a~dgaiLvVdA~~G-------vq~QT~~~~~~A~~~~l~-~I~viNKiD~~~A~-  146 (606)
                      ..|.++|||||||-||.-+.....+.+|.|+|||||..|       ++.||++|..+|...|+. +|++|||||.++.| 
T Consensus        83 ~k~~~tIiDaPGHrdFvknmItGasqAD~aVLVV~a~~~efE~g~~~~gQtrEH~~La~tlGi~~lIVavNKMD~v~wde  162 (428)
T COG5256          83 DKYNFTIIDAPGHRDFVKNMITGASQADVAVLVVDARDGEFEAGFGVGGQTREHAFLARTLGIKQLIVAVNKMDLVSWDE  162 (428)
T ss_pred             CCCEEEEEECCCHHHHHHHHHCCHHHCCEEEEEEECCCCCCCCCCCCCCCHHHHHHHHHHCCCCEEEEEEECCCCCCCCH
T ss_conf             77058996078467789876313313367999998889831014365875167899998569756999997156666279


Q ss_pred             --CCCHHHHHHHH---HHHHHHH--HHHHHHHCCCCC------------CHHHHHHHHHHHCCCCHHHHHCCCCCCCCCE
Q ss_conf             --11338887755---5322321--000111002232------------0067877632100011112201233101210
Q gi|254780321|r  147 --PDRVKKQIEET---IGISTED--ALLVSAKTGEGI------------PLLLERIVQQLPSPTSPEGANAPLKALLIDS  207 (606)
Q Consensus       147 --~e~v~~ei~~~---~g~~~~~--ii~vSAktG~GV------------~~LLd~Iv~~iP~P~~~~~~~~Pl~alVfds  207 (606)
                        ++++..++..+   +|+.+++  .+|+||.+|.|+            ..||+++- .+.+|..  ..|+||+..|.|.
T Consensus       163 ~rf~ei~~~v~~l~k~~G~~~~~v~FIPiSg~~G~Nl~~~s~~~pWY~GpTLleaLd-~~~~p~~--~~d~Plr~pI~~v  239 (428)
T COG5256         163 ERFEEIVSEVSKLLKMVGYNPKDVPFIPISGFKGDNLTKKSENMPWYKGPTLLEALD-QLEPPER--PLDKPLRLPIQDV  239 (428)
T ss_pred             HHHHHHHHHHHHHHHHCCCCCCCCEEEECCCCCCCCCCCCCCCCCCCCCCHHHHHHH-CCCCCCC--CCCCCEEEEEEEE
T ss_conf             999999999999999719986677079622446776332676786724871898974-5578987--7788817680017


Q ss_pred             EECCCCCEEEEEEECCCCCCCCCEEEEECCCCCCCCCCCCCCCCCEEEEHHCCCCC-HHHHHHCCCCCCCCCCCCEECCC
Q ss_conf             11475725999981698735584588733556421012223355412401012471-23322011002444454200046
Q gi|254780321|r  208 WYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVERIGILTPKMIDIEALYPGE-IGVMIASIKEVSHTRVGDTITDD  286 (606)
Q Consensus       208 ~~D~~~G~I~~~RV~sG~lk~Gd~I~~~~~g~~~~v~~ig~~~~~~~~v~~l~aGd-VG~ii~gik~l~~~~vGDTl~~~  286 (606)
                      +--...|.+.++||.+|.|++||+|.++..+..-+++.+   ..+..+.+.+.+|| ||+-+.++ ...+++.||.+++.
T Consensus       240 ~~i~~~gtv~vGrVEsG~i~~g~~v~~~p~~~~~evksi---e~~~~~~~~a~~GD~i~~~vrgv-~~~dI~~Gdv~~~~  315 (428)
T COG5256         240 YSISGIGTVPVGRVESGVIKPGQKVTFMPAGVVGEVKSI---EMHHEEISQAEPGDNVGFNVRGV-EKNDIRRGDVIGHS  315 (428)
T ss_pred             EEECCCCEEEEEEEEEEEECCCCEEEEECCCCEEEEEEE---EECCCCCCCCCCCCEEEEEECCC-CHHCCCCCCEECCC
T ss_conf             871688547887886134516987999648612787645---61266544478987688983577-54316776574047


Q ss_pred             CCCCCCCCCCC
Q ss_conf             67853236455
Q gi|254780321|r  287 SSPTTSALPGF  297 (606)
Q Consensus       287 ~~p~~~~Lp~~  297 (606)
                      ++|.... +.|
T Consensus       316 ~n~~t~~-~~f  325 (428)
T COG5256         316 DNPPTVS-PEF  325 (428)
T ss_pred             CCCCCCC-CCE
T ss_conf             8886435-131


No 37 
>PRK12736 elongation factor Tu; Reviewed
Probab=100.00  E-value=0  Score=352.17  Aligned_cols=279  Identities=22%  Similarity=0.328  Sum_probs=211.8

Q ss_pred             CCCCCCCH-HHCEEEEEECCCCCCHHHHHHHHHHHCCCCCCCCCC-CEEECCCHHHHHHCCEEEEEEEEEEEECCCCCEE
Q ss_conf             98889985-253179998013898778899999982980544443-1130586779871950523279999743788438
Q gi|254780321|r    1 MQKKPTPL-SRIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMS-SQVLDNMDIERERGITIKAQTVRLNYTSTDAKDY   78 (606)
Q Consensus         1 ~~~~~~p~-~~IRN~~IiaHvDhGKTTL~d~lL~~tg~i~~~~~~-~~vlD~~~~EreRGITIka~~~~~~~~~~~~~~y   78 (606)
                      |+|+-..- +.-=|++++||||||||||+.+|+...+....+.+. ...+|.+++||+|||||..     .+..++++++
T Consensus         1 ~~~~~~~~~k~~~ni~~~GHVD~GKSTL~g~L~~~~~~~~~~~~~~~~~~D~~~eEr~rGiTid~-----~~~~~~t~~~   75 (394)
T PRK12736          1 MAKEKFERSKPHVNIGTIGHVDHGKTTLTAAITKVLAERGLAQAKDYASIDAAPEEKARGITINT-----AHVEYETEKR   75 (394)
T ss_pred             CCCCCCCCCCCEEEEEEEEECCCCHHHHHHHHHHHHHHCCCCHHHHHHHHCCCHHHHCCCCEEEE-----EEEEEECCCE
T ss_conf             96001278998749999951288489899897504545065102222331166556247821784-----1899972883


Q ss_pred             EEEEEECCCCCHHHHHHHHHHHHCCEEEEEEECCCCCCHHHHHHHHHHHHCCCC-EEEEECCCCCCCC--CCCCHHHHHH
Q ss_conf             999961787300279999999730268999986878865589999999970996-7998326788753--2113388877
Q gi|254780321|r   79 QLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQAIDNNHE-IITVLNKADLPSA--DPDRVKKQIE  155 (606)
Q Consensus        79 ~iNlIDTPGH~DF~~EV~r~l~a~dgaiLvVdA~~Gvq~QT~~~~~~A~~~~l~-~I~viNKiD~~~A--~~e~v~~ei~  155 (606)
                      .+++||+|||.||.....+..+.+|.|||||||.+|+++||++|+.++...|++ +|++|||||+.+.  ..+.+..++.
T Consensus        76 ~~~~iD~PGH~~fi~nmi~Ga~~~D~alLVV~A~~G~~~QT~EHl~l~~~lgv~~~IV~vnK~D~v~~~~~~~~v~~~i~  155 (394)
T PRK12736         76 HYAHVDCPGHADYVKNMITGAAQMDGAILVVAATDGPMPQTREHILLARQVGVPYIVVFLNKVDLVDDEELLELVEMEVR  155 (394)
T ss_pred             EEEEEECCCCHHHHCCEEEEECCCCEEEEEEECCCCCHHHHHHHHHHHHHHCCCCEEEEEECCCCCCHHHHHHHHHHHHH
T ss_conf             69998889725431104443534665899998587746779999999998299915999988789983999999999999


Q ss_pred             HHH---HHHHHH--HHHHHHHCCC--------CCCHHHHHHHHHHHCCCCHHHHHCCCCCCCCCEEECCCCCEEEEEEEC
Q ss_conf             555---322321--0001110022--------320067877632100011112201233101210114757259999816
Q gi|254780321|r  156 ETI---GISTED--ALLVSAKTGE--------GIPLLLERIVQQLPSPTSPEGANAPLKALLIDSWYNSYLGVMVLVRII  222 (606)
Q Consensus       156 ~~~---g~~~~~--ii~vSAktG~--------GV~~LLd~Iv~~iP~P~~~~~~~~Pl~alVfds~~D~~~G~I~~~RV~  222 (606)
                      +++   +++.++  ++++||.+|.        ++..||+++-+.+|.|..  +.+.||++.|.+.+..+..|.+..|||.
T Consensus       156 ~~l~~~g~~~~~ip~i~~s~~~~~~~~~~~~~~i~~Ll~~ld~~~~~p~r--~~~~p~r~~Id~vf~v~G~GtVvtG~V~  233 (394)
T PRK12736        156 ELLSEYDFPGDDIPVIRGSALKALEGDPKWEDAIMELMDAVDEYIPTPER--DTDKPFLMPVEDVFSITGRGTVVTGRVE  233 (394)
T ss_pred             HHHHHCCCCCCCCCEEEEECCCCCCCCCHHHHHHHHHHHHHHHHCCCCCC--CCCCCEEEEEEEEEEECCCEEEEEEEEE
T ss_conf             99987699912060998454361368873577899999999852778888--7777628871117860897589999980


Q ss_pred             CCCCCCCCEEEEECCCCCCCCCCCCCCCCCEEEEHHCCCCC-HHHHHHCCCCCCCCCCCCEECCCCC
Q ss_conf             98735584588733556421012223355412401012471-2332201100244445420004667
Q gi|254780321|r  223 NGQLTKGQSIRLMGTNAKYQVERIGILTPKMIDIEALYPGE-IGVMIASIKEVSHTRVGDTITDDSS  288 (606)
Q Consensus       223 sG~lk~Gd~I~~~~~g~~~~v~~ig~~~~~~~~v~~l~aGd-VG~ii~gik~l~~~~vGDTl~~~~~  288 (606)
                      +|+++.||++.+++.+...++ .+.-+..+..+++++.||| ++..+.|+ +.++++.||.||.++.
T Consensus       234 sG~i~~Gd~v~i~~~~~~~~~-~VrsI~~~~~~v~~a~aG~~v~l~L~gi-d~~~i~rG~vL~~~~~  298 (394)
T PRK12736        234 RGTVKVGDEVEIVGIKETQKT-TVTGVEMFRKLLDEGQAGDNVGVLLRGV-DRDEVERGQVLAKPGS  298 (394)
T ss_pred             ECEEECCCEEEEEECCCCCEE-EEEEEEECCCCCCCCCCCCEEEEEECCC-CHHHCCCEEEEECCCC
T ss_conf             146865998999707998079-9998736783724804767899997689-9899671669966998


No 38 
>PRK00049 elongation factor Tu; Reviewed
Probab=100.00  E-value=0  Score=346.20  Aligned_cols=277  Identities=23%  Similarity=0.334  Sum_probs=207.0

Q ss_pred             CCCCCCCHH-HCEEEEEECCCCCCHHHHHHHHHHHCCCCCCC--CCCCEEECCCHHHHHHCCEEEEEEEEEEEECCCCCE
Q ss_conf             988899852-53179998013898778899999982980544--443113058677987195052327999974378843
Q gi|254780321|r    1 MQKKPTPLS-RIRNFSIVAHIDHGKSTLADRFIQHCRGLTER--EMSSQVLDNMDIERERGITIKAQTVRLNYTSTDAKD   77 (606)
Q Consensus         1 ~~~~~~p~~-~IRN~~IiaHvDhGKTTL~d~lL~~tg~i~~~--~~~~~vlD~~~~EreRGITIka~~~~~~~~~~~~~~   77 (606)
                      |.||...-+ --=|++++||||||||||+.+|+........+  ......+|.+++||+|||||..     .+..++.++
T Consensus         1 ~~~~~~~~~kp~~ni~~~GHVD~GKSTL~g~Lt~~l~~~~g~~~~~~~~~~D~~~eEr~rGiTid~-----~~~~~~t~~   75 (397)
T PRK00049          1 MAKEKFERTKPHVNVGTIGHVDHGKTTLTAAITKVLAKKYGGAEAKAYDQIDNAPEEKARGITINT-----AHVEYETEK   75 (397)
T ss_pred             CCCCCCCCCCCEEEEEEEECCCCCHHHHHHHHHHHHHHHCCCCCHHHHHHCCCCHHHHHCCCEEEE-----EEEEEECCC
T ss_conf             973342789983299999125888999999998666654385310013330257667625816998-----799997288


Q ss_pred             EEEEEEECCCCCHHHHHHHHHHHHCCEEEEEEECCCCCCHHHHHHHHHHHHCCCC-EEEEECCCCCCC-C-CCCCHHHHH
Q ss_conf             8999961787300279999999730268999986878865589999999970996-799832678875-3-211338887
Q gi|254780321|r   78 YQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQAIDNNHE-IITVLNKADLPS-A-DPDRVKKQI  154 (606)
Q Consensus        78 y~iNlIDTPGH~DF~~EV~r~l~a~dgaiLvVdA~~Gvq~QT~~~~~~A~~~~l~-~I~viNKiD~~~-A-~~e~v~~ei  154 (606)
                      +.+++||+|||.||.--.....+.+|.|+|||||.+|+|+||++|+.+|...|++ +|++|||||+.+ . .++.+..++
T Consensus        76 ~~~~~iD~PGH~~fiknmI~Ga~~~D~alLVV~A~~G~~~QT~EHl~l~~~LGv~~~iV~vnK~D~v~~~~~~~~v~~~i  155 (397)
T PRK00049         76 RHYAHVDCPGHADYVKNMITGAAQMDGAILVVSAADGPMPQTREHILLARQVGVPYIVVFLNKCDMVDDEELLELVEMEV  155 (397)
T ss_pred             CEEEEECCCCHHHHHHHHHHHHCCCCEEEEEEECCCCCCHHHHHHHHHHHHHCCCEEEEEEECCCCCCCHHHHHHHHHHH
T ss_conf             14999517863888999873012156799999748886652899999999809982799998668888599999999999


Q ss_pred             HHHH---HHHHHH--HHHHHHHCCC----------CCCHHHHHHHHHHHCCCCHHHHHCCCCCCCCCEEECCCCCEEEEE
Q ss_conf             7555---322321--0001110022----------320067877632100011112201233101210114757259999
Q gi|254780321|r  155 EETI---GISTED--ALLVSAKTGE----------GIPLLLERIVQQLPSPTSPEGANAPLKALLIDSWYNSYLGVMVLV  219 (606)
Q Consensus       155 ~~~~---g~~~~~--ii~vSAktG~----------GV~~LLd~Iv~~iP~P~~~~~~~~Pl~alVfds~~D~~~G~I~~~  219 (606)
                      .+++   ++..++  ++++||.+|.          |+..||+++-+++|.|.  ++.++||++.|-+.+.-+..|.|..|
T Consensus       156 ~~~l~~~~f~~~~ipiv~~S~~~~~~~~~~~~~~~~i~~Ll~~ld~~~~~p~--r~~~~p~r~~Id~vf~i~G~GtVVtG  233 (397)
T PRK00049        156 RELLSKYDFPGDDTPIIRGSALKALEEIGDPEWEAKILELMEAVDSYIPEPE--RAIDKPFLMPIEDVFSISGRGTVVTG  233 (397)
T ss_pred             HHHHHHCCCCCCCCCEEEEEEEEECCCCCCCCHHHHHHHHHHHHHHHCCCCC--CCCCCCEEEEECCEEEECCCCEEEEE
T ss_conf             9999846998444768985500311477865317899999999986477888--88888607772338876797279998


Q ss_pred             EECCCCCCCCCEEEEECCC--CCCCCCCCCCCCCCEEEEHHCCCCC-HHHHHHCCCCCCCCCCCCEECCCCC
Q ss_conf             8169873558458873355--6421012223355412401012471-2332201100244445420004667
Q gi|254780321|r  220 RIINGQLTKGQSIRLMGTN--AKYQVERIGILTPKMIDIEALYPGE-IGVMIASIKEVSHTRVGDTITDDSS  288 (606)
Q Consensus       220 RV~sG~lk~Gd~I~~~~~g--~~~~v~~ig~~~~~~~~v~~l~aGd-VG~ii~gik~l~~~~vGDTl~~~~~  288 (606)
                      +|.+|+++.||+|.+++.+  .+.++..   +..+..+++++.||| ++..+.|+ +.++++.|+.||.+..
T Consensus       234 tv~sG~i~~Gd~v~i~~~~~~~~~~Vks---Iq~~~~~v~~a~aG~~v~i~L~gi-~~~~I~rG~vL~~p~~  301 (397)
T PRK00049        234 RVERGIIKVGEEVEIVGIRDTQKTTVTG---VEMFRKLLDEGQAGDNVGLLLRGI-KREDVERGQVLAKPGS  301 (397)
T ss_pred             EEEEEEECCCCEEEEEECCCCCEEEEEE---EEECCEEEEEECCCCEEEEEECCC-CHHHCCCCCEEECCCC
T ss_conf             9800056079989996069884799999---996270702635887799997799-8898576019956998


No 39 
>cd00881 GTP_translation_factor GTP translation factor family.  This family consists primarily of translation initiation, elongation, and release factors, which play specific roles in protein translation.  In addition, the family includes Snu114p, a component of the U5 small nuclear riboprotein particle which is a component of the spliceosome and is involved in excision of introns, TetM, a tetracycline resistance gene that protects the ribosome from tetracycline binding, and the unusual subfamily CysN/ATPS, which has an unrelated function (ATP sulfurylase) acquired through lateral transfer of the EF1-alpha gene and development of a new function.
Probab=100.00  E-value=0  Score=345.38  Aligned_cols=173  Identities=40%  Similarity=0.616  Sum_probs=157.0

Q ss_pred             EEEEECCCCCCHHHHHHHHHHHCCCCCCCCC-CCEEECCCHHHHHHCCEEEEEEEEEEEECCCCCEEEEEEEECCCCCHH
Q ss_conf             7999801389877889999998298054444-311305867798719505232799997437884389999617873002
Q gi|254780321|r   13 NFSIVAHIDHGKSTLADRFIQHCRGLTEREM-SSQVLDNMDIERERGITIKAQTVRLNYTSTDAKDYQLNLIDTPGHVDF   91 (606)
Q Consensus        13 N~~IiaHvDhGKTTL~d~lL~~tg~i~~~~~-~~~vlD~~~~EreRGITIka~~~~~~~~~~~~~~y~iNlIDTPGH~DF   91 (606)
                      ||||+||+|||||||+++||+.++.+.++.. ..+++|++++||||||||.+....+.|     +++++||||||||.||
T Consensus         1 Nv~iiGh~d~GKTTL~~~Ll~~~~~~~~~~~~~~~~~d~~~~E~~rgiTi~~~~~~~~~-----~~~~i~~iDTPGh~~f   75 (189)
T cd00881           1 NVGIAGHVDHGKTTLTERLLYVTGDIERDGTVEETFLDVLKEERERGITIKSGVATFEW-----PDRRVNFIDTPGHEDF   75 (189)
T ss_pred             CEEEECCCCCCHHHHHHHHHHHCCCCCCCCCEEEEEECCCHHHHHCCCEEEEEEEEEEE-----CCEEEEEEECCCCHHH
T ss_conf             98999179989999999999764723568625888505777888638413222799998-----9989999969981889


Q ss_pred             HHHHHHHHHHCCEEEEEEECCCCCCHHHHHHHHHHHHCCCCEEEEECCCCCCC-CCCCCHHHHHHHHHHHH---------
Q ss_conf             79999999730268999986878865589999999970996799832678875-32113388877555322---------
Q gi|254780321|r   92 TYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQAIDNNHEIITVLNKADLPS-ADPDRVKKQIEETIGIS---------  161 (606)
Q Consensus        92 ~~EV~r~l~a~dgaiLvVdA~~Gvq~QT~~~~~~A~~~~l~~I~viNKiD~~~-A~~e~v~~ei~~~~g~~---------  161 (606)
                      ..++.++++++|+|||||||.+|+++||+.+|.++...++|+|+||||||+.+ ++++++.+|+.+.+...         
T Consensus        76 ~~~~~~~l~~aD~ailvVda~~G~~~qt~~~~~~~~~~~~p~iv~iNKiD~~~~~~~~~~~~ei~~~l~~~~~~~~~~~~  155 (189)
T cd00881          76 SSEVIRGLSVSDGAILVVDANEGVQPQTREHLRIAREGGLPIIVAINKIDRVGEEDLEEVLREIKELLGLIGFISTKEEG  155 (189)
T ss_pred             HHHHHHHHHHCCEEEEEEECCCCCCHHHHHHHHHHHHCCCCEEEEEECCCCCCHHHHHHHHHHHHHHHHHHCCHHHHHHC
T ss_conf             99999998646856999987989987899999999976998799998971877562999999999998753210232110


Q ss_pred             -----HHHHHHHHHHCCCCCCHHHHHHHHHHHCC
Q ss_conf             -----32100011100223200678776321000
Q gi|254780321|r  162 -----TEDALLVSAKTGEGIPLLLERIVQQLPSP  190 (606)
Q Consensus       162 -----~~~ii~vSAktG~GV~~LLd~Iv~~iP~P  190 (606)
                           ...++++||++|.||++|||+|++++|+|
T Consensus       156 ~~~~~~~piv~iSA~~G~gv~~Lld~i~~~lP~p  189 (189)
T cd00881         156 TRNGLLVPIVPGSALTGIGVEELLEAIVEHLPPP  189 (189)
T ss_pred             CCCCCCCEEEEEECCCCCCHHHHHHHHHHHCCCC
T ss_conf             1258877599988867869799999999768799


No 40 
>cd01884 EF_Tu EF-Tu subfamily.  This subfamily includes orthologs of translation elongation factor EF-Tu in bacteria, mitochondria, and chloroplasts.  It is one of several GTP-binding translation factors found in the larger family of GTP-binding elongation factors.  The eukaryotic counterpart, eukaryotic translation elongation factor 1 (eEF-1 alpha), is excluded from this family.  EF-Tu is one of the most abundant proteins in bacteria, as well as, one of the most highly conserved, and in a number of species the gene is duplicated with identical function.  When bound to GTP, EF-Tu can form a complex with any (correctly) aminoacylated tRNA except those for initiation and for selenocysteine, in which case EF-Tu is replaced by other factors.  Transfer RNA is carried to the ribosome in these complexes for protein translation.
Probab=100.00  E-value=0  Score=346.98  Aligned_cols=174  Identities=27%  Similarity=0.411  Sum_probs=147.1

Q ss_pred             EEEEEECCCCCCHHHHHHHHHHHCCCCCCCC-CCCEEECCCHHHHHHCCEEEEEEEEEEEECCCCCEEEEEEEECCCCCH
Q ss_conf             1799980138987788999999829805444-431130586779871950523279999743788438999961787300
Q gi|254780321|r   12 RNFSIVAHIDHGKSTLADRFIQHCRGLTERE-MSSQVLDNMDIERERGITIKAQTVRLNYTSTDAKDYQLNLIDTPGHVD   90 (606)
Q Consensus        12 RN~~IiaHvDhGKTTL~d~lL~~tg~i~~~~-~~~~vlD~~~~EreRGITIka~~~~~~~~~~~~~~y~iNlIDTPGH~D   90 (606)
                      .||+||||||||||||+++|++..+....+. .....+|++++||||||||.++.+.+     +|.++.+|+||||||.|
T Consensus         3 ~Ni~iiGHVDhGKTTL~~~l~~~~~~~~~~~~~~~~~~D~~~~EreRGiTI~~~~~~~-----~~~~~~~~~IDtPGH~d   77 (195)
T cd01884           3 VNVGTIGHVDHGKTTLTAAITKVLAKKGGAKFKKYDEIDKAPEEKARGITINTAHVEY-----ETANRHYAHVDCPGHAD   77 (195)
T ss_pred             EEEEEEEECCCCHHHHHHHHHHHHHHHCCCCCCCCHHCCCCHHHHCCCCCCCCEEEEE-----ECCCEEEEECCCCCHHH
T ss_conf             7999996058869899999999886634444112001005466650588614418999-----60881699626896077


Q ss_pred             HHHHHHHHHHHCCEEEEEEECCCCCCHHHHHHHHHHHHCCCC-EEEEECCCCCCCCC--CCCHHHHHHHHH---HHHHHH
Q ss_conf             279999999730268999986878865589999999970996-79983267887532--113388877555---322321
Q gi|254780321|r   91 FTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQAIDNNHE-IITVLNKADLPSAD--PDRVKKQIEETI---GISTED  164 (606)
Q Consensus        91 F~~EV~r~l~a~dgaiLvVdA~~Gvq~QT~~~~~~A~~~~l~-~I~viNKiD~~~A~--~e~v~~ei~~~~---g~~~~~  164 (606)
                      |..++.|+++.+|+|||||||.+|+|+||++|+.+|...|++ +|++|||||+++.+  ++.+..|+.+++   |++.++
T Consensus        78 F~~~~i~g~~~~D~aiLVVdA~eGv~~QT~eh~~la~~lgi~~iiV~iNK~D~~~~~~~~~~v~~ei~~~l~~~g~~~~~  157 (195)
T cd01884          78 YIKNMITGAAQMDGAILVVSATDGPMPQTREHLLLARQVGVPYIVVFLNKADMVDDEELLELVEMEVRELLSKYGFDGDN  157 (195)
T ss_pred             HHHHHHHHHHHCCEEEEEEECCCCCCHHHHHHHHHHHHHCCCCEEEEEECCCCCCCHHHHHHHHHHHHHHHHHCCCCCCC
T ss_conf             88899863511362689985277874789999999998099962799968778987899999999999999842999556


Q ss_pred             --HHHHHHHCCC----------CCCHHHHHHHHHHHCC
Q ss_conf             --0001110022----------3200678776321000
Q gi|254780321|r  165 --ALLVSAKTGE----------GIPLLLERIVQQLPSP  190 (606)
Q Consensus       165 --ii~vSAktG~----------GV~~LLd~Iv~~iP~P  190 (606)
                        ++|+||++|.          |+.+|||+|++++|+|
T Consensus       158 ~p~ip~Sa~~g~~~~~~~~~~~~i~~Lldai~~~iP~P  195 (195)
T cd01884         158 TPIVRGSALKALEGDDPNKWVKKILELLDALDSYIPTP  195 (195)
T ss_pred             CEEEEEEHHHHHCCCCCCCCCCCHHHHHHHHHHHCCCC
T ss_conf             82999773875357888755369999999999648998


No 41 
>PRK12735 elongation factor Tu; Reviewed
Probab=100.00  E-value=0  Score=343.45  Aligned_cols=277  Identities=23%  Similarity=0.348  Sum_probs=208.2

Q ss_pred             CCCCCCCHH-HCEEEEEECCCCCCHHHHHHHHHHHCCCCCCCCCCC-EEECCCHHHHHHCCEEEEEEEEEEEECCCCCEE
Q ss_conf             988899852-531799980138987788999999829805444431-130586779871950523279999743788438
Q gi|254780321|r    1 MQKKPTPLS-RIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSS-QVLDNMDIERERGITIKAQTVRLNYTSTDAKDY   78 (606)
Q Consensus         1 ~~~~~~p~~-~IRN~~IiaHvDhGKTTL~d~lL~~tg~i~~~~~~~-~vlD~~~~EreRGITIka~~~~~~~~~~~~~~y   78 (606)
                      |.|+...-+ .-=|++++||||||||||+.+|+...+....+.... .-+|..++||+|||||..     .+..++++++
T Consensus         1 ~~~~~~~~~kp~ini~~~GHVD~GKSTL~g~Lt~~~~~~~~~~~~~~~~~D~~~eEr~rGiTid~-----~~~~fet~~~   75 (396)
T PRK12735          1 MAKEKFERTKPHVNVGTIGHVDHGKTTLTAAITTVLAKKGGGEAKAYDQIDNAPEEKARGITINT-----SHVEYETANR   75 (396)
T ss_pred             CCCCCCCCCCCEEEEEEEECCCCCHHHHHHHHHHHHHHHCCCCCCCHHHHCCCHHHHCCCEEEEE-----EEEEEECCCE
T ss_conf             97233278998349999942688589899998614545246431221221166567437737985-----6999973980


Q ss_pred             EEEEEECCCCCHHHHHHHHHHHHCCEEEEEEECCCCCCHHHHHHHHHHHHCCCC-EEEEECCCCCCC-CC-CCCHHHHHH
Q ss_conf             999961787300279999999730268999986878865589999999970996-799832678875-32-113388877
Q gi|254780321|r   79 QLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQAIDNNHE-IITVLNKADLPS-AD-PDRVKKQIE  155 (606)
Q Consensus        79 ~iNlIDTPGH~DF~~EV~r~l~a~dgaiLvVdA~~Gvq~QT~~~~~~A~~~~l~-~I~viNKiD~~~-A~-~e~v~~ei~  155 (606)
                      .+++||+|||.||.--.....+.+|.|||||||.+|+|+||++|+.++...|++ +|++|||||+.+ .+ .+.+..++.
T Consensus        76 ~~~~iD~PGHe~fiknMI~Ga~~aD~alLVV~A~~G~~~QTrEHl~l~~~lgv~~~iV~vnK~D~v~~~~~~e~v~~~i~  155 (396)
T PRK12735         76 HYAHVDCPGHADYVKNMITGAAQMDGAILVVSAADGPMPQTREHILLARQVGVPYIVVFLNKCDMVDDEELLELVEMEVR  155 (396)
T ss_pred             EEEEEECCCHHHHHHHHHHCCCCCCEEEEEEECCCCCCHHHHHHHHHHHHHCCCEEEEEEECCCCCCHHHHHHHHHHHHH
T ss_conf             59998368668877666410042567999998687875316999999998399858999987588881999999999999


Q ss_pred             HHH---HHHHHH--HHHHHHHCCC----------CCCHHHHHHHHHHHCCCCHHHHHCCCCCCCCCEEECCCCCEEEEEE
Q ss_conf             555---322321--0001110022----------3200678776321000111122012331012101147572599998
Q gi|254780321|r  156 ETI---GISTED--ALLVSAKTGE----------GIPLLLERIVQQLPSPTSPEGANAPLKALLIDSWYNSYLGVMVLVR  220 (606)
Q Consensus       156 ~~~---g~~~~~--ii~vSAktG~----------GV~~LLd~Iv~~iP~P~~~~~~~~Pl~alVfds~~D~~~G~I~~~R  220 (606)
                      +++   +++.++  ++++||..+.          ++.+|++++-+++|.|.  ++.++||++.|-+.+..+..|.|.+|+
T Consensus       156 ~~l~~~~f~~~~~piv~~S~~~~~~~~~~~~~~~~i~~Ll~~l~~~~~~p~--r~~~~pfrl~Id~vf~v~G~GtVVtGt  233 (396)
T PRK12735        156 ELLSKYDFPGDDTPIIRGSALKALEGDAEWIGEAKILELMEALDSYIPTPE--RAIDKPFLMPIEDVFSISGRGTVVTGR  233 (396)
T ss_pred             HHHHHCCCCCCCCCEEEEEEEECCCCCCCCCCHHHHHHHHHHHHHHCCCCC--CCCCCCEEEEEEEEEEECCCCEEEEEE
T ss_conf             999855999664779996733722588743444779999999885267877--777886599976477767971599989


Q ss_pred             ECCCCCCCCCEEEEEC--CCCCCCCCCCCCCCCCEEEEHHCCCCC-HHHHHHCCCCCCCCCCCCEECCCCC
Q ss_conf             1698735584588733--556421012223355412401012471-2332201100244445420004667
Q gi|254780321|r  221 IINGQLTKGQSIRLMG--TNAKYQVERIGILTPKMIDIEALYPGE-IGVMIASIKEVSHTRVGDTITDDSS  288 (606)
Q Consensus       221 V~sG~lk~Gd~I~~~~--~g~~~~v~~ig~~~~~~~~v~~l~aGd-VG~ii~gik~l~~~~vGDTl~~~~~  288 (606)
                      |.+|+++.||++.++.  .+.+.++..+   ..+..+++++.||| ++.-+.|+ +.++++.||.||.+..
T Consensus       234 V~sG~i~~Gd~v~i~~~~~~~~~~V~sI---q~~~~~v~~a~aG~~v~l~L~gi-~~~~i~rG~VL~~p~~  300 (396)
T PRK12735        234 VERGIVKVGDEVEIVGIKDTQKTTVTGV---EMFRKLLDEGQAGDNVGVLLRGT-KREDVERGQVLAKPGS  300 (396)
T ss_pred             EEEEEECCCCEEEEEECCCCCEEEEEEE---EECCCCCCEECCCCEEEEEECCC-CHHHCCCEEEEECCCC
T ss_conf             8121562799899972699846999999---98670802714887899994799-8898562679966998


No 42 
>TIGR00483 EF-1_alpha translation elongation factor EF-1, subunit alpha; InterPro: IPR004539   Translation elongation factors are responsible for two main processes during protein synthesis on the ribosome , , . EF1A (or EF-Tu) is responsible for the selection and binding of the cognate aminoacyl-tRNA to the A-site (acceptor site) of the ribosome. EF2 (or EF-G) is responsible for the translocation of the peptidyl-tRNA from the A-site to the P-site (peptidyl-tRNA site) of the ribosome, thereby freeing the A-site for the next aminoacyl-tRNA to bind. Elongation factors are responsible for achieving accuracy of translation and both EF1A and EF2 are remarkably conserved throughout evolution.   EF1A (also known as EF-1alpha or EF-Tu) is a G-protein. It forms a ternary complex of EF1A-GTP-aminoacyltRNA. The binding of aminoacyl-tRNA stimulates GTP hydrolysis by EF1A, causing a conformational change in EF1A that causes EF1A-GDP to detach from the ribosome, leaving the aminoacyl-tRNA attached at the A-site. Only the cognate aminoacyl-tRNA can induce the required conformational change in EF1A through its tight anticodon-codon binding , . EF1A-GDP is returned to its active state, EF1A-GTP, through the action of another elongation factor, EF1B (also known as EF-Ts or EF-1beta/gamma/delta).   This entry represents EF1A proteins found primarily in eukaryotic (eEF1A) and archaeal (aEF1A) organisms, these proteins being more closely related to one another than to EF1A (or EF-Tu) found in bacteria (IPR004541 from INTERPRO).   More information about these proteins can be found at Protein of the Month: Elongation Factors . ; GO: 0003746 translation elongation factor activity, 0005525 GTP binding, 0006414 translational elongation, 0005737 cytoplasm.
Probab=100.00  E-value=0  Score=350.80  Aligned_cols=320  Identities=27%  Similarity=0.434  Sum_probs=246.7

Q ss_pred             CEEEEEECCCCCCHHHHHHHHHHHCCCCCCC-------CCC---------CEEECCCHHHHHHCCEEEEEEEEEEEECCC
Q ss_conf             3179998013898778899999982980544-------443---------113058677987195052327999974378
Q gi|254780321|r   11 IRNFSIVAHIDHGKSTLADRFIQHCRGLTER-------EMS---------SQVLDNMDIERERGITIKAQTVRLNYTSTD   74 (606)
Q Consensus        11 IRN~~IiaHvDhGKTTL~d~lL~~tg~i~~~-------~~~---------~~vlD~~~~EreRGITIka~~~~~~~~~~~   74 (606)
                      .=|+++|||||||||||+.+|||.||.|.++       |+.         ..|||.+..||||||||     .+.+.-++
T Consensus         7 ~~Nv~~IGHVD~GKST~~G~Lly~~G~I~~~~~eK~~kEa~e~GK~~F~fa~V~D~Lk~ERERGvTI-----D~A~~KFe   81 (445)
T TIGR00483         7 HINVAFIGHVDHGKSTLVGRLLYKAGAIDEQLLEKLKKEAQEKGKASFEFAWVMDRLKEERERGVTI-----DVAHKKFE   81 (445)
T ss_pred             EEEEEEEEEEECCCCHHHHHHHHHCCCCCHHHHHHHHHHHHHCCCCEEEEEEEECCCCCCCCCCCHH-----HHHHHHCC
T ss_conf             2448998254088502667777542896589999998757551873036765431100000156224-----33445417


Q ss_pred             CCEEEEEEEECCCCCHHHHHHHHHHHHCCEEEEEEECCCC-------CCHHHHHHHHHHHHCCCC-EEEEECCCCCCCCC
Q ss_conf             8438999961787300279999999730268999986878-------865589999999970996-79983267887532
Q gi|254780321|r   75 AKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQG-------VEAQTLANVYQAIDNNHE-IITVLNKADLPSAD  146 (606)
Q Consensus        75 ~~~y~iNlIDTPGH~DF~~EV~r~l~a~dgaiLvVdA~~G-------vq~QT~~~~~~A~~~~l~-~I~viNKiD~~~A~  146 (606)
                      ..+|.+++||||||-||.--..-.-+-+|+|+||||..++       +++||++|..||.-.|+. +|+.|||||..+.|
T Consensus        82 T~KY~~TivDcPGHRDFiKNMITGaSQADaAvLv~~v~~~~~~ag~~~~pQTrEH~~La~TLGi~QliVAiNKMD~V~yd  161 (445)
T TIGR00483        82 TDKYEVTIVDCPGHRDFIKNMITGASQADAAVLVVAVDDGEFEAGISVQPQTREHVFLARTLGINQLIVAINKMDSVNYD  161 (445)
T ss_pred             CCCEEEEEEECCCCCHHHHHCCCCCCCCCEEEEEEECCCCCCCCCEEECCCCHHHHHHHHHHCCEEEEEEECCCCCEECC
T ss_conf             88516999846987013431126675124279999525441024012178605778887750320453331024610027


Q ss_pred             ---CCCHHHHHHH-H---HHHHHHH--HHHHHHHCCCCC------------------------CHHHHHHHHHHHCCCCH
Q ss_conf             ---1133888775-5---5322321--000111002232------------------------00678776321000111
Q gi|254780321|r  147 ---PDRVKKQIEE-T---IGISTED--ALLVSAKTGEGI------------------------PLLLERIVQQLPSPTSP  193 (606)
Q Consensus       147 ---~e~v~~ei~~-~---~g~~~~~--ii~vSAktG~GV------------------------~~LLd~Iv~~iP~P~~~  193 (606)
                         ++...+++.+ +   +|..+++  .+|+||..|.||                        ..||||+ +.+-+|.  
T Consensus       162 ~~~f~~~~~~~s~~l~K~vGY~p~~v~FiP~s~~~GDN~~~~s~~~PWYkgwe~e~~agvv~G~TL~EA~-D~~~~P~--  238 (445)
T TIGR00483       162 EEEFEALKKEVSEQLLKKVGYKPDEVPFIPISAFEGDNVIKKSENTPWYKGWEKETKAGVVKGKTLLEAL-DALEPPE--  238 (445)
T ss_pred             HHHHHHHHHHHHHHHHHHHCCCCCCCCEEEECCCCCCCHHHHHCCCCCCCCCCCCCCCEEECCCHHHHHH-HHHCCCC--
T ss_conf             7899999999999899874887561232540354676134330388852552200023022184589887-3104786--


Q ss_pred             HHHHCCCCCCCCCEEECCCCCEEEEEEECCCCCCCCCEEEEECCCCCCCCCCCCCCCCCEEEEHHCCCCC-HHHHHHCCC
Q ss_conf             1220123310121011475725999981698735584588733556421012223355412401012471-233220110
Q gi|254780321|r  194 EGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVERIGILTPKMIDIEALYPGE-IGVMIASIK  272 (606)
Q Consensus       194 ~~~~~Pl~alVfds~~D~~~G~I~~~RV~sG~lk~Gd~I~~~~~g~~~~v~~ig~~~~~~~~v~~l~aGd-VG~ii~gik  272 (606)
                      .-.|.|||..|-|.+.-...|.|-.|||.+|.|++|+.|.+-+.|-+-+|+.|   .++..+++++.+|| ||+-+.|+ 
T Consensus       239 kp~d~PLRiPiQDVY~I~GvGTVPVGRVEtGvl~~G~~V~F~PAGVsgEVKSi---EMHHE~i~~a~PGDNiGFNVrgV-  314 (445)
T TIGR00483       239 KPVDKPLRIPIQDVYSITGVGTVPVGRVETGVLKPGDKVVFEPAGVSGEVKSI---EMHHEQIEQAEPGDNIGFNVRGV-  314 (445)
T ss_pred             CCCCCCCCCCCCCEEEECCEEECCCCCEECCEEECCCEEEECCCCCCCCEEEE---EECCCCCCCCCCCCCCCEEECCC-
T ss_conf             43467730553003575336622346020242644887896378843121367---61134366777787412200155-


Q ss_pred             CCCCCCCCCEECCCCC-CCCCCCCCCCC-----CCC-EEEEEECCCCHHHHHHHHHHHHHH-HHHCCCC-CCCCCCCCCC
Q ss_conf             0244445420004667-85323645522-----221-266421267702457889999888-6411221-1125676000
Q gi|254780321|r  273 EVSHTRVGDTITDDSS-PTTSALPGFKP-----IQP-VVFCGLFPVDATQFENLRTAINKL-RLNDASF-SFELENSTAL  343 (606)
Q Consensus       273 ~l~~~~vGDTl~~~~~-p~~~~Lp~~~~-----~~P-~v~~~i~p~~~~d~~~L~~aL~kL-~~~D~sl-~~e~Ets~aL  343 (606)
                      ..++++.||.-.+++| |-. ....|.-     -+| .+++|.-|+=..--+++.=....| ...||.- ++..|+-+.|
T Consensus       315 s~kdIrRGdV~G~~~NdPP~-v~~~F~A~~vVL~HP~~ItvGYtPV~~~HTA~~AC~F~EL~~K~d~rtG~~~Ee~P~FL  393 (445)
T TIGR00483       315 SKKDIRRGDVAGHPDNDPPK-VAKEFTAQIVVLQHPGAITVGYTPVLHAHTAQIACRFVELLKKLDPRTGQVLEENPQFL  393 (445)
T ss_pred             CCCCCCCCCCCCCCCCCCCC-CCCCCCCEEEEECCCCEEEECCCCCCCCCCHHHHHHHHHHHHHCCCCCCCCCCCCCCCC
T ss_conf             60220014303788875872-10144127999728976773565630143113333168888550733585014787512


No 43 
>PRK04000 translation initiation factor IF-2 subunit gamma; Validated
Probab=100.00  E-value=0  Score=342.08  Aligned_cols=270  Identities=24%  Similarity=0.308  Sum_probs=200.1

Q ss_pred             CCCCCCCHHHCEEEEEECCCCCCHHHHHHHHHHHCCCCCCCCCCCEEECCCHHHHHHCCEEEEEEEEEEEEC---CCC--
Q ss_conf             988899852531799980138987788999999829805444431130586779871950523279999743---788--
Q gi|254780321|r    1 MQKKPTPLSRIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVRLNYTS---TDA--   75 (606)
Q Consensus         1 ~~~~~~p~~~IRN~~IiaHvDhGKTTL~d~lL~~tg~i~~~~~~~~vlD~~~~EreRGITIka~~~~~~~~~---~~~--   75 (606)
                      |.....|   -=|++++||||||||||+.+|   ||..         +|..++|++|||||+..-+.+.+..   .++  
T Consensus         1 ~~~~~~p---~vNIgtiGHVDHGKTTLv~aL---Tg~~---------tdr~~eE~~RGiTI~LG~a~~~~~~~~~~~~~~   65 (410)
T PRK04000          1 MWEFVQP---EVNIGMVGHVDHGKTTLVQAL---TGVW---------TDTHSEELKRGITIRLGYADATIYKCPNCEGPE   65 (410)
T ss_pred             CCCCCCC---CCEEEEEEEECCCHHHHHHHH---HCCC---------CCCCHHHHHCCCCCCCCCCCEEHHCCCCCCCCC
T ss_conf             9877899---526999965178699999887---3975---------423887886488121051010012054555444


Q ss_pred             ----------------CEEEEEEEECCCCCHHHHHHHHHHHHCCEEEEEEECCCCC-CHHHHHHHHHHHHCCCC-EEEEE
Q ss_conf             ----------------4389999617873002799999997302689999868788-65589999999970996-79983
Q gi|254780321|r   76 ----------------KDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGV-EAQTLANVYQAIDNNHE-IITVL  137 (606)
Q Consensus        76 ----------------~~y~iNlIDTPGH~DF~~EV~r~l~a~dgaiLvVdA~~Gv-q~QT~~~~~~A~~~~l~-~I~vi  137 (606)
                                      ...++++||+|||.||........+.+|+|||||||.+|+ ||||++|+.++...|++ +|+++
T Consensus        66 ~~~~~~~~~~~~~~~~~~r~is~VD~PGHe~fi~nMi~Gas~~D~alLVVaA~eG~p~pQT~EHl~i~~~lgi~~~iV~l  145 (410)
T PRK04000         66 AYTTEPTCPKCGSETELLRRVSFVDAPGHETLMATMLSGAALMDGAVLVIAANEPCPQPQTKEHLMALDIIGIKNIVIVQ  145 (410)
T ss_pred             CEEEECCCCCCCCCCCCCCEEEEEECCCHHHHHHHHHHHHCCCCEEEEEEECCCCCCCCCHHHHHHHHHHCCCCCEEEEE
T ss_conf             13530233444555443316999979887999999984021266799998657787677149999999980998379999


Q ss_pred             CCCCCCCCC-CCCHHHHHHHHH---HHHHHHHHHHHHHCCCCCCHHHHHHHHHHHCCCCHHHHHCCCCCCCCCEE-----
Q ss_conf             267887532-113388877555---32232100011100223200678776321000111122012331012101-----
Q gi|254780321|r  138 NKADLPSAD-PDRVKKQIEETI---GISTEDALLVSAKTGEGIPLLLERIVQQLPSPTSPEGANAPLKALLIDSW-----  208 (606)
Q Consensus       138 NKiD~~~A~-~e~v~~ei~~~~---g~~~~~ii~vSAktG~GV~~LLd~Iv~~iP~P~~~~~~~~Pl~alVfds~-----  208 (606)
                      ||||+.+.+ .+.+.+||.+++   .++...++++||.+|.|++.|+++|.+++|.|.  ++.++||++.|-.++     
T Consensus       146 nK~Dlv~~e~~~~~~~ei~~~l~g~~~~~~piipvSa~~g~~i~~L~~~l~~~~~~p~--r~~~~~f~m~Vdr~F~i~g~  223 (410)
T PRK04000        146 NKIDLVSKEKALENYEQIKEFVKGTVAENAPIIPVSALHGVNIDALIEAIEEEIPTPE--RDLDKPPLMYVARSFDVNKP  223 (410)
T ss_pred             ECCCCCCHHHHHHHHHHHHHHHCCCCCCCCCEEEEECCCCCCCCHHHHHHHHHCCCCC--CCCCCCCEEEEEEEEEECCC
T ss_conf             6256789899999999999987067656899999647778894089998986277877--78889944899888850579


Q ss_pred             ---ECCCCCEEEEEEECCCCCCCCCEEEEECCCCCCC---------CCCCCCCCCCEEEEHHCCCCC-HHHHHH---CCC
Q ss_conf             ---1475725999981698735584588733556421---------012223355412401012471-233220---110
Q gi|254780321|r  209 ---YNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQ---------VERIGILTPKMIDIEALYPGE-IGVMIA---SIK  272 (606)
Q Consensus       209 ---~D~~~G~I~~~RV~sG~lk~Gd~I~~~~~g~~~~---------v~~ig~~~~~~~~v~~l~aGd-VG~ii~---gik  272 (606)
                         ++.++|.|+.|+|.+|+++.||+|.+.+..+..+         ..++--+..+..+++++.||+ ||.-+.   +++
T Consensus       224 Gt~~~~~~G~VvtGtv~~G~ik~GD~vei~Pg~~~~~~~~~~~~pi~t~V~si~~~~~~~~~a~aG~~vai~~~ld~~i~  303 (410)
T PRK04000        224 GTPPEKLKGGVIGGSLIQGVLKVGDEIEIRPGIKVEKGGKTKWEPITTKITSLRAGGEKVEEARPGGLVGVGTKLDPALT  303 (410)
T ss_pred             CCCCCCCCCCEEEEEEEEEEEECCCEEEEECCCCCCCCCCCCCCCCEEEEEEEEECCEEHHEECCCCEEEECCCCCCCCC
T ss_conf             86553564417888997627842998999447433456653112212699899747839110136765852233455533


Q ss_pred             CCCCCCCCCEECCCCC
Q ss_conf             0244445420004667
Q gi|254780321|r  273 EVSHTRVGDTITDDSS  288 (606)
Q Consensus       273 ~l~~~~vGDTl~~~~~  288 (606)
                       -.|...|+.++.+..
T Consensus       304 -r~D~~rG~Vl~~pg~  318 (410)
T PRK04000        304 -KADALAGSVAGKPGT  318 (410)
T ss_pred             -HHHHHCCCEEECCCC
T ss_conf             -557415655435997


No 44 
>CHL00071 tufA elongation factor Tu
Probab=100.00  E-value=0  Score=339.37  Aligned_cols=267  Identities=21%  Similarity=0.338  Sum_probs=206.3

Q ss_pred             CEEEEEECCCCCCHHHHHHHHHHHCCCCCCCCCCC-EEECCCHHHHHHCCEEEEEEEEEEEECCCCCEEEEEEEECCCCC
Q ss_conf             31799980138987788999999829805444431-13058677987195052327999974378843899996178730
Q gi|254780321|r   11 IRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSS-QVLDNMDIERERGITIKAQTVRLNYTSTDAKDYQLNLIDTPGHV   89 (606)
Q Consensus        11 IRN~~IiaHvDhGKTTL~d~lL~~tg~i~~~~~~~-~vlD~~~~EreRGITIka~~~~~~~~~~~~~~y~iNlIDTPGH~   89 (606)
                      -=|++++||||||||||+.+|++..+...++.+.. +-+|..++||+|||||     .+.+..+++.++.+++||+|||.
T Consensus        12 ~vni~~~GHVD~GKSTL~g~L~~~~~~~~~~~~~~~~~~D~~~eEr~rGiTi-----d~~~~~~et~~~~~~~iD~PGH~   86 (409)
T CHL00071         12 HVNIGTIGHVDHGKTTLTAAITMTLAANGGAKGKKYDEIDSAPEEKARGITI-----NTAHVEYETENRHYAHVDCPGHA   86 (409)
T ss_pred             EEEEEEECCCCCCHHHHHHHHHHHHHHCCCHHHHHHHHCCCCHHHHHCCCEE-----EECEEEEECCCEEEEEEECCCHH
T ss_conf             6999999545883999999986453004513343155323797687369448-----80248996287599998679678


Q ss_pred             HHHHHHHHHHHHCCEEEEEEECCCCCCHHHHHHHHHHHHCCCC-EEEEECCCCCCC-CC-CCCHHHHHHHHH---HHHHH
Q ss_conf             0279999999730268999986878865589999999970996-799832678875-32-113388877555---32232
Q gi|254780321|r   90 DFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQAIDNNHE-IITVLNKADLPS-AD-PDRVKKQIEETI---GISTE  163 (606)
Q Consensus        90 DF~~EV~r~l~a~dgaiLvVdA~~Gvq~QT~~~~~~A~~~~l~-~I~viNKiD~~~-A~-~e~v~~ei~~~~---g~~~~  163 (606)
                      ||.-...+..+.+|.|+|||||.+|+++||++|+.+|...|++ +|++|||||+.+ .+ .+.+..++.+++   ++..+
T Consensus        87 ~fv~nmi~Gas~aD~alLVV~A~~G~~~QTkEHl~l~~~lgV~~~IVavnKmD~v~~~~~~e~i~~~i~~~l~~~g~~~~  166 (409)
T CHL00071         87 DYVKNMITGAAQMDGAILVVSAADGPMPQTKEHILLAKQVGVPNIVVFLNKEDQVDDEELLELVELEVRELLDKYDFPGD  166 (409)
T ss_pred             HHHHHHHHHHCCCCCEEEEEECCCCCCCCHHHHHHHHHHCCCCCEEEEEECCCCCCHHHHHHHHHHHHHHHHHHCCCCCC
T ss_conf             99999875230158128999868788500499999999739993655555679854899999999999999997399845


Q ss_pred             H--HHHHHHHCCC------------------CCCHHHHHHHHHHHCCCCHHHHHCCCCCCCCCEEECCCCCEEEEEEECC
Q ss_conf             1--0001110022------------------3200678776321000111122012331012101147572599998169
Q gi|254780321|r  164 D--ALLVSAKTGE------------------GIPLLLERIVQQLPSPTSPEGANAPLKALLIDSWYNSYLGVMVLVRIIN  223 (606)
Q Consensus       164 ~--ii~vSAktG~------------------GV~~LLd~Iv~~iP~P~~~~~~~~Pl~alVfds~~D~~~G~I~~~RV~s  223 (606)
                      +  ++++||..|.                  +...|++++-.++|.|.  ++.++||++.|-+++.-+.+|.|+.|+|.+
T Consensus       167 ~i~~vp~sa~~~~~~~~~~~~~~~~~~~w~~~~~~Ll~~l~~~~p~~~--r~~~~p~r~~Id~vf~v~G~GtVv~G~v~s  244 (409)
T CHL00071        167 EIPIVAGSALLALEALIENPKIKRGENKWVDKIYNLMDAVDSYIPTPE--RDTDKPFLMAIEDVFSITGRGTVATGRIER  244 (409)
T ss_pred             CCEEEECCHHHHHHHHCCCCCCCCCCCCHHHHHHHHHHHHHHCCCCCC--CCCCCCEEEEECCEEECCCCEEEEEEEEEE
T ss_conf             560896521332343125875455656124479999998872377888--876776064422147538978899999914


Q ss_pred             CCCCCCCEEEEECCC--CCCCCCCCCCCCCCEEEEHHCCCCC-HHHHHHCCCCCCCCCCCCEECCCCC
Q ss_conf             873558458873355--6421012223355412401012471-2332201100244445420004667
Q gi|254780321|r  224 GQLTKGQSIRLMGTN--AKYQVERIGILTPKMIDIEALYPGE-IGVMIASIKEVSHTRVGDTITDDSS  288 (606)
Q Consensus       224 G~lk~Gd~I~~~~~g--~~~~v~~ig~~~~~~~~v~~l~aGd-VG~ii~gik~l~~~~vGDTl~~~~~  288 (606)
                      |+++.||++.+++.+  +..++..   ...+..+++++.||| ++.-+.|+ +..+++.||.||++..
T Consensus       245 G~v~~Gd~v~i~~~~~~~~~~Vks---I~~~~~~~~~a~aG~~v~l~L~gi-~~~~I~rG~VL~~p~~  308 (409)
T CHL00071        245 GTVKVGDTVEIVGLRETRTTTVTG---LEMFQKTLDEGLAGDNVGILLRGI-QKEDIERGMVLAKPGT  308 (409)
T ss_pred             CCCCCCCEEEEEECCCCCEEEEEE---EEECCCCCCEECCCCEEEEEECCC-CHHHCCCEEEEECCCC
T ss_conf             563499989999769986079999---998895988887998899997599-8788774689968999


No 45 
>cd01889 SelB_euk SelB subfamily.  SelB is an elongation factor needed for the co-translational incorporation of selenocysteine.  Selenocysteine is coded by a UGA stop codon in combination with a specific downstream mRNA hairpin.  In bacteria, the C-terminal part of SelB recognizes this hairpin, while the N-terminal part binds GTP and tRNA in analogy with elongation factor Tu (EF-Tu).  It specifically recognizes the selenocysteine charged tRNAsec, which has a UCA anticodon, in an EF-Tu like manner.  This allows insertion of selenocysteine at in-frame UGA stop codons.  In E. coli SelB binds GTP, selenocysteyl-tRNAsec and a stem-loop structure immediately downstream of the UGA codon (the SECIS sequence).  The absence of active SelB prevents the participation of selenocysteyl-tRNAsec in translation.  Archaeal and animal mechanisms of selenocysteine incorporation are more complex.  Although the SECIS elements have different secondary structures and conserved elements between archaea and euk
Probab=100.00  E-value=0  Score=339.70  Aligned_cols=172  Identities=27%  Similarity=0.399  Sum_probs=147.0

Q ss_pred             EEEEECCCCCCHHHHHHHHHHHCCCCCCCCCCCEEECCCHHHHHHCCEEEEEEEEEEE---------ECCCCCEEEEEEE
Q ss_conf             7999801389877889999998298054444311305867798719505232799997---------4378843899996
Q gi|254780321|r   13 NFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVRLNY---------TSTDAKDYQLNLI   83 (606)
Q Consensus        13 N~~IiaHvDhGKTTL~d~lL~~tg~i~~~~~~~~vlD~~~~EreRGITIka~~~~~~~---------~~~~~~~y~iNlI   83 (606)
                      ||||+||||||||||+++|++..++        ..+|++++||||||||+....++..         ...+|++|++|||
T Consensus         2 NV~iiGHVDhGKTTL~~~L~~~~~~--------~~~D~~~eE~eRGITi~~g~~~~~~~~~~~~~~~~~~~~~~~~i~~I   73 (192)
T cd01889           2 NVGVLGHVDSGKTSLAKALSEIAST--------AAFDKNPQSQERGITLDLGFSSFYVDKPKHLRELINPGEENLQITLV   73 (192)
T ss_pred             EEEEEEECCCCHHHHHHHHHHHCCC--------HHHHCCHHHHHCCCCEEEEEEEEEECCCCCCCCCCCCCCCCEEEEEE
T ss_conf             8999976178999999999833350--------12213588997797167100137851442211232346774589998


Q ss_pred             ECCCCCHHHHHHHHHHHHCCEEEEEEECCCCCCHHHHHHHHHHHHCCCCEEEEECCCCCCCCC-----CCCHHHHHHHHH
Q ss_conf             178730027999999973026899998687886558999999997099679983267887532-----113388877555
Q gi|254780321|r   84 DTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQAIDNNHEIITVLNKADLPSAD-----PDRVKKQIEETI  158 (606)
Q Consensus        84 DTPGH~DF~~EV~r~l~a~dgaiLvVdA~~Gvq~QT~~~~~~A~~~~l~~I~viNKiD~~~A~-----~e~v~~ei~~~~  158 (606)
                      |||||.||..++.++++++|+|+|||||.+|+|+||++||++|...++++|+|+||||+.+.+     ++++.+++.+++
T Consensus        74 DtPGH~df~~~~~~g~~~~D~ailvVda~~G~~~QT~eh~~~~~~~~~~~iv~iNK~D~v~~~~~~~~~~~i~~~l~~~l  153 (192)
T cd01889          74 DCPGHASLIRTIIGGAQIIDLMLLVVDATKGIQTQTAECLVIGEILCKKLIVVLNKIDLIPEEERERKIEKMKKKLQKTL  153 (192)
T ss_pred             ECCCCHHHHHHHHHHHHHCCCCEEEEECCCCCCHHHHHHHHHHHHCCCCEEEEEECCCCCCHHHHHHHHHHHHHHHHHHH
T ss_conf             77983889988888874326527999878888789999999999858997999974127881577999999999999998


Q ss_pred             ---HHHHHHHHHHHHHCCCCCCHHHHHHHHHHHCCCC
Q ss_conf             ---3223210001110022320067877632100011
Q gi|254780321|r  159 ---GISTEDALLVSAKTGEGIPLLLERIVQQLPSPTS  192 (606)
Q Consensus       159 ---g~~~~~ii~vSAktG~GV~~LLd~Iv~~iP~P~~  192 (606)
                         +++...++|+||++|.||++|+++|.+.+|+|..
T Consensus       154 ~~~~~~~~~iipiSA~~G~gi~eL~~~i~~lip~p~~  190 (192)
T cd01889         154 EKTRFKNSPIIPVSAKPGGGEAELGKDLNNLIVLPLI  190 (192)
T ss_pred             HHCCCCCCEEEEEECCCCCCHHHHHHHHHHHCCCCCC
T ss_conf             6538999849995789884989999888761899963


No 46 
>PRK05506 bifunctional sulfate adenylyltransferase subunit 1/adenylylsulfate kinase protein; Provisional
Probab=100.00  E-value=0  Score=328.70  Aligned_cols=268  Identities=22%  Similarity=0.330  Sum_probs=213.5

Q ss_pred             HHCEEEEEECCCCCCHHHHHHHHHHHCCCCCCCC------------CC------CEEECCCHHHHHHCCEEEEEEEEEEE
Q ss_conf             2531799980138987788999999829805444------------43------11305867798719505232799997
Q gi|254780321|r    9 SRIRNFSIVAHIDHGKSTLADRFIQHCRGLTERE------------MS------SQVLDNMDIERERGITIKAQTVRLNY   70 (606)
Q Consensus         9 ~~IRN~~IiaHvDhGKTTL~d~lL~~tg~i~~~~------------~~------~~vlD~~~~EreRGITIka~~~~~~~   70 (606)
                      +.+-||.++||||||||||..|||+.||.+.+..            ..      ..+||.++.|||+||||     .+.|
T Consensus         5 k~~l~~~~~G~VD~GKSTliGrlL~dt~~i~~d~~~~~~~~s~~~g~~~~~~~~a~l~D~l~~EreqGiTI-----Dva~   79 (613)
T PRK05506          5 KTLLRFITCGSVDDGKSTLIGRLLYDSKMIFEDQLAALERDSKKVGTQGDEIDLALLVDGLAAEREQGITI-----DVAY   79 (613)
T ss_pred             CCEEEEEEECCCCCCHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHCCCCCCEEEEEECCCCHHHHHCCCEE-----EEEE
T ss_conf             76258999936679788898899998199678999999999998189888603544214888898559716-----8567


Q ss_pred             ECCCCCEEEEEEEECCCCCHHHHHHHHHHHHCCEEEEEEECCCCCCHHHHHHHHHHHHCCCC-EEEEECCCCCCCCC---
Q ss_conf             43788438999961787300279999999730268999986878865589999999970996-79983267887532---
Q gi|254780321|r   71 TSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQAIDNNHE-IITVLNKADLPSAD---  146 (606)
Q Consensus        71 ~~~~~~~y~iNlIDTPGH~DF~~EV~r~l~a~dgaiLvVdA~~Gvq~QT~~~~~~A~~~~l~-~I~viNKiD~~~A~---  146 (606)
                      .++.++++++.++|||||.+|.--...+-+-+|.|||||||..|+..||+.|.+++...|++ +|++|||||+.+-+   
T Consensus        80 ~~F~t~~r~~~i~DaPGH~~y~rNMitgAs~ad~AilliDa~~G~~~QTrrH~~i~~llGI~~iivaVNKMDlV~y~~~~  159 (613)
T PRK05506         80 RYFSTPKRKFIVADTPGHEQYTRNMATGASTADLAIILVDARKGVLTQTRRHSFIASLLGIRHIVLAVNKMDLVDYDQEV  159 (613)
T ss_pred             EEEECCCEEEEEECCCCHHHHHHHHHHHHHHCCEEEEEEECCCCCHHHHHHHHHHHHHCCCCEEEEEEECCCCCCCHHHH
T ss_conf             78843870599942896798998999878653879999988879515518999999872987599998520124781999


Q ss_pred             CCCHHHHHHHH---HHHHHHHHHHHHHHCCCCC------------CHHHHHHHHHHHCCCCHHHHHCCCCCCCCCEEECC
Q ss_conf             11338887755---5322321000111002232------------00678776321000111122012331012101147
Q gi|254780321|r  147 PDRVKKQIEET---IGISTEDALLVSAKTGEGI------------PLLLERIVQQLPSPTSPEGANAPLKALLIDSWYNS  211 (606)
Q Consensus       147 ~e~v~~ei~~~---~g~~~~~ii~vSAktG~GV------------~~LLd~Iv~~iP~P~~~~~~~~Pl~alVfds~~D~  211 (606)
                      ++++.+++.++   +|+..-.++|+||+.|.||            ..||+.+ +.++.+..  ..+.|||+.|-...-..
T Consensus       160 f~~I~~~~~~~~~~l~~~~~~~IPISAl~GDNVv~~S~~m~WY~GptLle~L-e~~~~~~~--~~~~~fR~PVQ~V~Rp~  236 (613)
T PRK05506        160 FDRIVADYLAFAAKLGLTDVTFIPISALKGDNVVTRSARTPWYEGPSLLEHL-ETVEIAGD--RNLKDFRFPVQYVNRPN  236 (613)
T ss_pred             HHHHHHHHHHHHHHCCCCCCEEEECCCCCCCEEEECCCCCCCCCCCCHHHHH-HCCCCCCC--CCCCCCEEEEEEEECCC
T ss_conf             9999999999996579988759967357487476788788666786589997-37787866--44567121117874478


Q ss_pred             CCCEEEEEEECCCCCCCCCEEEEECCCCCCCCCCCCCCCCCEEEEHHCCCCCHHHHHHCCCCCCCCCCCCEECCCCCC
Q ss_conf             572599998169873558458873355642101222335541240101247123322011002444454200046678
Q gi|254780321|r  212 YLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVERIGILTPKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSP  289 (606)
Q Consensus       212 ~~G~I~~~RV~sG~lk~Gd~I~~~~~g~~~~v~~ig~~~~~~~~v~~l~aGdVG~ii~gik~l~~~~vGDTl~~~~~p  289 (606)
                      .-.+.-.|||.||++++||+|.+.++|++.+|++|..+.   .+++++.+|+-  +...+.+--++..||.|+.++++
T Consensus       237 ~dfRgyaGrI~sG~ikvGD~V~vlPSg~~s~Vk~I~~~~---~~~~~A~agqS--VtltL~dEIDISRGDvI~~~~~~  309 (613)
T PRK05506        237 LDFRGFAGTVASGVVRPGDEVVVLPSGKTSRVKRIVTYD---GELDEAFAGQA--VTLTLADEIDISRGDMLARADNP  309 (613)
T ss_pred             CCEEEEEEEECCEEECCCCEEEECCCCCEEEEEEEECCC---CCHHHCCCCCE--EEEEECCCEECCCCCEEECCCCC
T ss_conf             750579999841367269989987899879999998689---97641338980--89997462643798689648998


No 47 
>TIGR00475 selB selenocysteine-specific translation elongation factor; InterPro: IPR004535   In prokaryotes, the incorporation of selenocysteine as the 21st amino acid, encoded by TGA, requires several elements: SelC is the tRNA itself, SelD acts as a donor of reduced selenium, SelA modifies a serine residue on SelC into selenocysteine, and SelB is a selenocysteine-specific translation elongation factor. 3' or 5' non-coding elements of mRNA have been found as probable structures for directing selenocysteine incorporation .   This family describes the elongation factor SelB, a close homologue of EF-Tu. It may function by replacing EF-Tu. A C-terminal domain not found in EF-Tu is in all SelB sequences in the seed alignment except that from Methanococcus jannaschii. This family should not include an equivalent protein for eukaryotes. ; GO: 0003723 RNA binding, 0003746 translation elongation factor activity, 0005525 GTP binding, 0001514 selenocysteine incorporation, 0005737 cytoplasm.
Probab=100.00  E-value=0  Score=330.42  Aligned_cols=257  Identities=26%  Similarity=0.364  Sum_probs=212.8

Q ss_pred             EEEEECCCCCCHHHHHHHHHHHCCCCCCCCCCCEEECCCHHHH-HHCCEEEEEEEEEEEECCCCCE--EEEEEEECCCCC
Q ss_conf             7999801389877889999998298054444311305867798-7195052327999974378843--899996178730
Q gi|254780321|r   13 NFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIER-ERGITIKAQTVRLNYTSTDAKD--YQLNLIDTPGHV   89 (606)
Q Consensus        13 N~~IiaHvDhGKTTL~d~lL~~tg~i~~~~~~~~vlD~~~~Er-eRGITIka~~~~~~~~~~~~~~--y~iNlIDTPGH~   89 (606)
                      ||+..||||||||||+-+|   ||.-+.      -.|.+|+|+ .|||||     .+.|.+.+..+  +.+.|||.|||.
T Consensus         2 ~~at~GHvDHGKT~L~k~L---Tgi~st------sa~~lPeEkqKRG~tI-----DLGfAy~~l~~~n~~l~~iDvPGHe   67 (627)
T TIGR00475         2 IIATAGHVDHGKTTLLKAL---TGIDST------SADRLPEEKQKRGMTI-----DLGFAYLPLPDINKRLGFIDVPGHE   67 (627)
T ss_pred             EEEEECCCCHHHHHHHHHH---CCCCCH------HHHCCCCCCCCCCCEE-----ECCCEECCCCCCCCCCEEEECCCHH
T ss_conf             6873124450479999985---064301------2312774102576624-----6042003677777133478559738


Q ss_pred             HHHHHHHHHHHHCCEEEEEEECCCCCCHHHHHHHHHHHHCCCC-EEEEECCCCCCC-CCCCCHHHHHHHHH---HHH-HH
Q ss_conf             0279999999730268999986878865589999999970996-799832678875-32113388877555---322-32
Q gi|254780321|r   90 DFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQAIDNNHE-IITVLNKADLPS-ADPDRVKKQIEETI---GIS-TE  163 (606)
Q Consensus        90 DF~~EV~r~l~a~dgaiLvVdA~~Gvq~QT~~~~~~A~~~~l~-~I~viNKiD~~~-A~~e~v~~ei~~~~---g~~-~~  163 (606)
                      -|..-...++..+|+|||||||.+||++||.+|+..+...++| .|+||||||+.+ +..+++..++..++   .+. ..
T Consensus        68 ~fl~n~lAg~~~i~~alLvVda~eG~~~QT~EHL~vl~~l~~~~~ivvltK~D~~d~~~~~~~E~~~~~~l~~~~~~~n~  147 (627)
T TIGR00475        68 KFLSNALAGIGGIDAALLVVDADEGVMTQTKEHLAVLKLLGIPELIVVLTKADRVDEEEVKRVEEELKEILEEYEFLKNA  147 (627)
T ss_pred             HHHHHHHHHHHHHHHHEEEECCCCCCCCCHHHHHHHHHHHCCCEEEEEEECCCCCCHHHHHHHHHHHHHHHHHHHHHCCC
T ss_conf             99999866756540100354157788532389999999708961999973467456589999999999998764321157


Q ss_pred             HHHHHHHHCCCCCCHHHHHHHHHHHCCCCHHHHHCCCCCCCCCEEEC-CCCCEEEEEEECCCCCCCCCEEEEECCCCCCC
Q ss_conf             10001110022320067877632100011112201233101210114-75725999981698735584588733556421
Q gi|254780321|r  164 DALLVSAKTGEGIPLLLERIVQQLPSPTSPEGANAPLKALLIDSWYN-SYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQ  242 (606)
Q Consensus       164 ~ii~vSAktG~GV~~LLd~Iv~~iP~P~~~~~~~~Pl~alVfds~~D-~~~G~I~~~RV~sG~lk~Gd~I~~~~~g~~~~  242 (606)
                      +++.+||+||.||++|=+.+-+...+-...++.+.|||+.| |+.|. ...|.|..|.+++|+++.||+|++.+.|+..+
T Consensus       148 ~~~~~SA~tG~Gi~~Lk~~L~~L~e~~~~~r~~~~~lr~~i-D~aF~vKG~GtVvtGt~f~G~VkvGD~~~~~pig~~~r  226 (627)
T TIGR00475       148 KIFKTSAKTGQGIEELKKELKNLLESLDIKRDKQKPLRLAI-DRAFKVKGAGTVVTGTAFSGEVKVGDKLVLEPIGKEVR  226 (627)
T ss_pred             CEEEEECCCCCCHHHHHHHHHHHHHHHHHHHCCCCCCCCCC-CEEEEECCCEEEEEEEEEEEEEEECCEEEEEECCCEEE
T ss_conf             47999134687778999999865777655420156665103-21558703024687557841689888899810583678


Q ss_pred             CCCCCCCCCCEEEEHHCCCCC-HHHHHHCCCCCCCCCCCCEECCCC
Q ss_conf             012223355412401012471-233220110024444542000466
Q gi|254780321|r  243 VERIGILTPKMIDIEALYPGE-IGVMIASIKEVSHTRVGDTITDDS  287 (606)
Q Consensus       243 v~~ig~~~~~~~~v~~l~aGd-VG~ii~gik~l~~~~vGDTl~~~~  287 (606)
                      |..+   +-+..+++.+.||| ||.-+.+=.+.+.+.-||.||...
T Consensus       227 vk~~---~~~~~~~~~A~AG~RiALnL~~~vd~~~~~RGDWll~~~  269 (627)
T TIGR00475       227 VKAI---QAQNQDVEKAVAGQRIALNLAADVDKEKLKRGDWLLILK  269 (627)
T ss_pred             EEEE---ECCCCCCCEEECHHHHHHHCCCCCCCCCCCCCCEEECCC
T ss_conf             8640---205885221002013654123457612256651220278


No 48 
>pfam06421 LepA_C GTP-binding protein LepA C-terminus. This family consists of the C-terminal region of several pro- and eukaryotic GTP-binding LepA proteins.
Probab=100.00  E-value=0  Score=342.98  Aligned_cols=108  Identities=65%  Similarity=1.027  Sum_probs=106.9

Q ss_pred             ECCCCCCEEEEEEEHHHHHHHHHHHHHHHHHCCCHHHCCCCCEEEECCEEEEEECCCCCCCCEEEEECCCCCCHHHHHHH
Q ss_conf             62882435687421577999999999998740870102002204564788974125642032032301777347877568
Q gi|254780321|r  496 VNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGGRIIARETVKARRKDVTAKCYGGDITRKRKLLE  575 (606)
Q Consensus       496 in~~~vdals~i~h~~~a~~~gr~~~~~L~~~iprq~F~v~iqa~~~~~iiare~i~~~rkdvt~kcygGd~trk~KLl~  575 (606)
                      |||++|||||+|||+++|+.+||.+|++||++||||||+|||||++||+|||||||+|+||||||||||||+|||+|||+
T Consensus         1 INge~VDALS~Ivhr~~A~~~gr~~v~kLKe~IPrq~f~v~IQA~ig~kiiAre~I~a~RKdVtak~ygGDitRK~KLL~   80 (108)
T pfam06421         1 INGKPVDALSFIVHRDKAYNRGRELVEKLKELIPRQQFEIPIQAAIGSKIIARETIKALRKNVLAKCYGGDISRKKKLLE   80 (108)
T ss_pred             CCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHCCCEEEHHCCCHHHCCEEEEECCCCHHHHHHHHH
T ss_conf             99974046787442998999999999999986879784799999984753540103023244433545998379999999


Q ss_pred             HHHHHHHHHHHCCCEECCHHHHHHHHCC
Q ss_conf             9884217875107744588999997424
Q gi|254780321|r  576 KQKEGKKRMRRFGRVDIPQSAFISILKT  603 (606)
Q Consensus       576 ~qk~GKkrmk~~g~v~ip~~af~~~l~~  603 (606)
                      +||+||||||++|+|+||||||+++|++
T Consensus        81 kQK~GKkrmk~~G~V~ip~eaF~~vLk~  108 (108)
T pfam06421        81 KQKEGKKRMKQVGNVEIPQEAFLAVLKL  108 (108)
T ss_pred             HHHHHHHHHHHCCCCCCCHHHHHHHHCC
T ss_conf             9986079998569971799999999739


No 49 
>PRK10512 selenocysteinyl-tRNA-specific translation factor; Provisional
Probab=100.00  E-value=4.2e-45  Score=322.45  Aligned_cols=249  Identities=26%  Similarity=0.381  Sum_probs=196.1

Q ss_pred             EEEECCCCCCHHHHHHHHHHHCCCCCCCCCCCEEECCCHHHHHHCCEEEEEEEEEEEECCC-CCEEEEEEEECCCCCHHH
Q ss_conf             9998013898778899999982980544443113058677987195052327999974378-843899996178730027
Q gi|254780321|r   14 FSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVRLNYTSTD-AKDYQLNLIDTPGHVDFT   92 (606)
Q Consensus        14 ~~IiaHvDhGKTTL~d~lL~~tg~i~~~~~~~~vlD~~~~EreRGITIka~~~~~~~~~~~-~~~y~iNlIDTPGH~DF~   92 (606)
                      |+..||||||||||+-+|   ||.-         .|.+++||+|||||     .+.|.+.+ ...-.+.|||.|||..|.
T Consensus         3 igTAGHVDHGKTsLvkAL---TG~d---------tDRL~EEk~RGiTI-----dLGFA~~~l~~g~~~g~VDVPGHErFI   65 (615)
T PRK10512          3 IATAGHVDHGKTTLLQAI---TGVN---------ADRLPEEKKRGMTI-----DLGYAYWPQPDGRVLGFIDVPGHEKFL   65 (615)
T ss_pred             EEEECCCCCCHHHHHHHH---HCCC---------CCCCHHHHHHCCEE-----EECEEEEECCCCCEEEEEECCCHHHHH
T ss_conf             996365477899999998---6888---------65697789718727-----713075557999789998799838999


Q ss_pred             HHHHHHHHHCCEEEEEEECCCCCCHHHHHHHHHHHHCCCC-EEEEECCCCCCCCC-CCCHHHHHHHHH---HHHHHHHHH
Q ss_conf             9999999730268999986878865589999999970996-79983267887532-113388877555---322321000
Q gi|254780321|r   93 YEVSRSLSACEGSLLVVDATQGVEAQTLANVYQAIDNNHE-IITVLNKADLPSAD-PDRVKKQIEETI---GISTEDALL  167 (606)
Q Consensus        93 ~EV~r~l~a~dgaiLvVdA~~Gvq~QT~~~~~~A~~~~l~-~I~viNKiD~~~A~-~e~v~~ei~~~~---g~~~~~ii~  167 (606)
                      --.-......|.|+|||+|.+||||||++|+..+...|++ .|+||||+|+.+.+ .+.+.+|+.+++   .+....+++
T Consensus        66 knMlAG~~gid~vlLVVAAdeGvMPQT~EHl~Il~lLgi~~giV~lTK~Dlvd~e~l~~v~~ei~~~l~~t~l~~~pi~~  145 (615)
T PRK10512         66 SNMLAGVGGIDHALLVVACDDGVMAQTREHLAILQLTGNPMLTVALTKADRVDEARIDEVRRQVLEVLREYGFAEAKLFV  145 (615)
T ss_pred             HHHHHHHHHCCEEEEEEECCCCCCCCHHHHHHHHHHHCCCEEEEEEECCCCCCHHHHHHHHHHHHHHHHCCCCCCCCEEE
T ss_conf             99974464378899999889987723799999999819982899997765689799999999999998447876797520


Q ss_pred             HHHHCCCCCCHHHHHHHHHHHCCCCHHHHHCCCCCCCCCEEEC-CCCCEEEEEEECCCCCCCCCEEEEECCCCCCCCCCC
Q ss_conf             1110022320067877632100011112201233101210114-757259999816987355845887335564210122
Q gi|254780321|r  168 VSAKTGEGIPLLLERIVQQLPSPTSPEGANAPLKALLIDSWYN-SYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVERI  246 (606)
Q Consensus       168 vSAktG~GV~~LLd~Iv~~iP~P~~~~~~~~Pl~alVfds~~D-~~~G~I~~~RV~sG~lk~Gd~I~~~~~g~~~~v~~i  246 (606)
                      |||.||.|+++|.+++.+..+ +.  ...+++||+.| |-.|. +..|.|++|.+.||+++.||++.+++.++..+|..+
T Consensus       146 vSa~tg~Gi~~L~~~L~~l~~-~~--~~~~~~fRL~I-DRvFsvkG~GTVVTGTl~sG~v~~GD~l~i~P~~~~~rVR~i  221 (615)
T PRK10512        146 TAATEGRGIDALREHLLQLPE-RE--HASQHRFRLAI-DRAFTVKGAGLVVTGTALSGEVKVGDTLWLTGVNKPMRVRAL  221 (615)
T ss_pred             CCCCCCCCHHHHHHHHHHHCC-CC--CCCCCCEEEEE-EEEEECCCCCEEEEEEEECCEECCCCEEEECCCCCEEEEEEH
T ss_conf             145666799999999986255-66--67677617883-118962688569999981471426998998699967987347


Q ss_pred             CCCCCCEEEEHHCCCCCHHHH-HHC-CCCCCCCCCCCEECCCC
Q ss_conf             233554124010124712332-201-10024444542000466
Q gi|254780321|r  247 GILTPKMIDIEALYPGEIGVM-IAS-IKEVSHTRVGDTITDDS  287 (606)
Q Consensus       247 g~~~~~~~~v~~l~aGdVG~i-i~g-ik~l~~~~vGDTl~~~~  287 (606)
                      ..   +..+++++.||+=.++ +.| + +.++++-||.|+.+.
T Consensus       222 Q~---h~~~v~~a~aG~R~AlNL~G~v-~~~~i~RGd~L~~~~  260 (615)
T PRK10512        222 HA---QNQPTETAHAGQRIALNIAGDA-EKEQINRGDWLLADA  260 (615)
T ss_pred             HH---CCCCCCEECCCCEEEEEECCCC-CHHHCCCCCEEECCC
T ss_conf             76---7981557327745999612544-672317866892388


No 50 
>PRK12312 infB translation initiation factor IF-2; Provisional
Probab=100.00  E-value=2.1e-44  Score=317.61  Aligned_cols=424  Identities=21%  Similarity=0.304  Sum_probs=275.2

Q ss_pred             EEEEECCCCCCHHHHHHHHHHHCCCCCCCCCCCEEECCCHHHHHHCCEEEEEEEEEEEECCCCCEEEEEEEECCCCCHHH
Q ss_conf             79998013898778899999982980544443113058677987195052327999974378843899996178730027
Q gi|254780321|r   13 NFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVRLNYTSTDAKDYQLNLIDTPGHVDFT   92 (606)
Q Consensus        13 N~~IiaHvDhGKTTL~d~lL~~tg~i~~~~~~~~vlD~~~~EreRGITIka~~~~~~~~~~~~~~y~iNlIDTPGH~DF~   92 (606)
                      =++|+||||||||||.|++- .|. +...|++             |||-.-.+..+.|     +.-+|.|||||||.-|+
T Consensus       119 vVtimGHVDHGKTsLLD~iR-~t~-V~~~EaG-------------GITQhIGA~~v~~-----~~~~itFiDTPGHeAFt  178 (610)
T PRK12312        119 IVTIMGHVDHGKTTLLDTIR-KTN-VVASEAG-------------GITQHIGAYQVEY-----QGKKITFIDTPGHEAFT  178 (610)
T ss_pred             EEEEECCCCCCHHHHHHHHH-CCC-CCCCCCC-------------CCCCEECEEEEEE-----CCCEEEEECCCCHHHHH
T ss_conf             89996772577225889985-486-4134677-------------6644004499986-----79768997289679899


Q ss_pred             HHHHHHHHHCCEEEEEEECCCCCCHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCCHHHHHHHHHHHHHHH------HH
Q ss_conf             999999973026899998687886558999999997099679983267887532113388877555322321------00
Q gi|254780321|r   93 YEVSRSLSACEGSLLVVDATQGVEAQTLANVYQAIDNNHEIITVLNKADLPSADPDRVKKQIEETIGISTED------AL  166 (606)
Q Consensus        93 ~EV~r~l~a~dgaiLvVdA~~Gvq~QT~~~~~~A~~~~l~~I~viNKiD~~~A~~e~v~~ei~~~~g~~~~~------ii  166 (606)
                      .-..|..+++|-|+|||+|.+||||||++...+|...++|+|++|||||+|+|+++++..|+.+ .|+.+++      ++
T Consensus       179 ~mR~RGa~vtDI~iLVVaaddGv~pQTiEaI~~ak~a~vpiiVAiNKiDkp~a~~~~v~~~L~~-~g~~~E~~GGdv~~V  257 (610)
T PRK12312        179 EMRARGAKVTDIVILVVAADDGVKPQTEEAIDHAKAANVPIIVFVNKMDKPNANPDRIKNELSK-YDLVPEEWGGDTPFV  257 (610)
T ss_pred             HHHHCCCCCCCEEEEEEECCCCCCHHHHHHHHHHHHCCCCEEEEECCCCCCCCCHHHHHHHHHH-HCCCHHHHCCCCEEE
T ss_conf             9997077654579999975789774269999999975998899850446788987899999987-076678857944599


Q ss_pred             HHHHHCCCCCCHHHHHHHHHHHCCCCHHHHHCCCCCCCCCEEECCCCCEEEEEEECCCCCCCCCEEEEECCCCCCCCCCC
Q ss_conf             01110022320067877632100011112201233101210114757259999816987355845887335564210122
Q gi|254780321|r  167 LVSAKTGEGIPLLLERIVQQLPSPTSPEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVERI  246 (606)
Q Consensus       167 ~vSAktG~GV~~LLd~Iv~~iP~P~~~~~~~~Pl~alVfds~~D~~~G~I~~~RV~sG~lk~Gd~I~~~~~g~~~~v~~i  246 (606)
                      ++||++|.|+++||++|.-..---.-..+++.|.++.|..+..|+.+|.++.+-|.+|+|+.||.+..-.+..  +|.. 
T Consensus       258 ~iSAktg~GId~LLe~IlL~AE~leLka~~~~~a~G~VIEsk~dkg~G~vatviVq~GtLk~GD~iV~G~~~G--kVRa-  334 (610)
T PRK12312        258 YGSALKNEGIDELLDSILLLAEILNLKANPNRLAIGTVIEAKLDKGKGPVATLIVQNGTLKVGDFIVAGSTYG--KIRS-  334 (610)
T ss_pred             EEECCCCCCHHHHHHHHHHHHHHHHHHCCCCCCCEEEEEEEEECCCCCCEEEEEEECCEEECCCEEEECCCCC--CCCE-
T ss_conf             9036879899999999999999876522789860699999786168763689998358781599899898668--6215-


Q ss_pred             CCCCCCEEEEHHCCCCCHHHHHHCCCCCCCCCCCCEECCCCCCCC-CCC----------------------CCCCC-CCC
Q ss_conf             233554124010124712332201100244445420004667853-236----------------------45522-221
Q gi|254780321|r  247 GILTPKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTT-SAL----------------------PGFKP-IQP  302 (606)
Q Consensus       247 g~~~~~~~~v~~l~aGdVG~ii~gik~l~~~~vGDTl~~~~~p~~-~~L----------------------p~~~~-~~P  302 (606)
                       .+.....+++++.++..- .+.|+.++  -..||.+...++... ..+                      ..+.. ..+
T Consensus       335 -m~d~~g~~lk~A~PS~pV-~I~Gl~~v--P~aGd~~~vv~~Ek~Ak~ia~~r~~~~~~~~~~~~~~e~~~~~~~~~~~k  410 (610)
T PRK12312        335 -MEDENGKKLKKALPSTPV-KVSGLNEV--PQAGDKFIVFNDEKFAKKIANEKKQKQKQNELKSLQLEDIKQNIDSGELK  410 (610)
T ss_pred             -EECCCCCCCCCCCCCCCE-EEECCCCC--CCCCCEEEECCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCC
T ss_conf             -773678614341799857-98467567--56797699728899999999999999999887440088899886336751


Q ss_pred             EEEEEECCCCHHHHHHHHHHHHHHHHHCCCCCCC--------------CCCCCCCCCEEEEEECCHHHHHHHHHHHHHHC
Q ss_conf             2664212677024578899998886411221112--------------56760004202899637678988898886644
Q gi|254780321|r  303 VVFCGLFPVDATQFENLRTAINKLRLNDASFSFE--------------LENSTALGFGFRCGFLGLLHLEIIQERLEREF  368 (606)
Q Consensus       303 ~v~~~i~p~~~~d~~~L~~aL~kL~~~D~sl~~e--------------~Ets~aLg~Gfr~gglG~LHLeVi~eRL~rEf  368 (606)
                      .+-.-+-.-..+..+.|.++|.++..++..+.+-              ..+|.|...||.+.-      +--..++-++.
T Consensus       411 ~l~vIIKADv~GSlEAI~~sL~kl~~~eV~i~Ii~agVG~ItesDV~LA~as~AiIigFNV~~------~~~a~~~A~~~  484 (610)
T PRK12312        411 ELNIIIKADVQGSLEAIKGIISKINVSGVKINIIRAAVGTISESDILLAQTSNSIIIGFNVKP------SAIIKKLAESQ  484 (610)
T ss_pred             EEEEEEEECCCCCHHHHHHHHHHCCCCCEEEEEEECCCCCCCHHHHHHHHHCCCCEEEECCCC------CHHHHHHHHHC
T ss_conf             233799846676499999998656886435778633457776889999986699189973768------87799987744


Q ss_pred             CCEEEEECCCCCEEEEEECCCEEECCCHHHCCCHHHHHHHHCCEEEEEEEECCCCCHHHHHHHHHHHHEEECCCC-----
Q ss_conf             950697378233033531564541269666258677888623269999980831000389998863001424433-----
Q gi|254780321|r  369 SLNLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEYLGSILKLCQERRGIQIDMSH-----  443 (606)
Q Consensus       369 g~ev~~t~P~V~Ykv~~~dG~~~~Vd~p~~~p~~~~i~~i~EPi~~~~I~~P~ey~G~Vm~~l~~RRG~~~~m~~-----  443 (606)
                      |+++...  +|+|+..  |.=            ...+..+++|...-.++=..+-. .+..  .++-|.+-+..-     
T Consensus       485 gV~Ir~y--~IIY~Li--Ddv------------k~~m~g~L~p~~~E~~iG~AeV~-~vF~--~sk~g~IAGc~V~~G~i  545 (610)
T PRK12312        485 GIKIRSH--NIIYKII--EEI------------EKILKGMLDPVYEEVVIGQAEVR-KLFK--HSKVGTIAGCYVTSGKV  545 (610)
T ss_pred             CCCEEEE--CHHHHHH--HHH------------HHHHHCCCCCCEEEEEEEEEEEE-EEEE--CCCCEEEEEEEEEECEE
T ss_conf             8626984--2288899--999------------99984589972479998999988-8886--48861789999974689


Q ss_pred             -CCCE------EEEEEEECHHHHHHHHHHHHHHHCCCE--EEEEEEECCCEECCEE
Q ss_conf             -6836------999999604333220468767635741--8889854354643667
Q gi|254780321|r  444 -LDNR------AMIVYELPLNEVIFDFYDRLKSVSKGY--ASFDYNVIDYRDSDLV  490 (606)
Q Consensus       444 -~~~~------~~i~~~vPl~Eli~~f~~~LkS~T~G~--as~~ye~~~Y~~~dlv  490 (606)
                       .+..      -.+.|+-.+..| .-|.+..+...+|+  |..=-.|..|+++|+.
T Consensus       546 ~r~~~vRVlR~~~vI~eG~I~SL-rr~KddVkEV~~G~ECGI~l~~f~di~~GDiI  600 (610)
T PRK12312        546 KRNAKVRVIRNGKVIHEGKIASL-KHLKDDVKEVEKGKECGIHIKNFNDIKENDII  600 (610)
T ss_pred             EECCEEEEEECCEEEEEEEEHHH-HHCCCCCCHHCCCCCCEEEECCCCCCCCCCEE
T ss_conf             71984899889999997167774-02010211205895324883273568769899


No 51 
>CHL00189 infB translation initiation factor 2; Provisional
Probab=100.00  E-value=2.7e-44  Score=316.91  Aligned_cols=426  Identities=19%  Similarity=0.265  Sum_probs=273.9

Q ss_pred             EEEEECCCCCCHHHHHHHHHHHCCCCCCCCCCCEEECCCHHHHHHCCEEEEEEEEEEEECCCCCEEEEEEEECCCCCHHH
Q ss_conf             79998013898778899999982980544443113058677987195052327999974378843899996178730027
Q gi|254780321|r   13 NFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVRLNYTSTDAKDYQLNLIDTPGHVDFT   92 (606)
Q Consensus        13 N~~IiaHvDhGKTTL~d~lL~~tg~i~~~~~~~~vlD~~~~EreRGITIka~~~~~~~~~~~~~~y~iNlIDTPGH~DF~   92 (606)
                      =+.|+||||||||||.|+|- .|. +...|++             |||-.-.+-++.|... ....+|.|||||||.-|+
T Consensus       274 VVTIMGHVDHGKTsLLD~iR-~t~-Va~~EaG-------------GITQhIGAy~V~~~~~-~~~~~ITFlDTPGHeAFt  337 (770)
T CHL00189        274 IVTILGHVDHGKTTLLDAIR-KTN-IAQKEAG-------------GITQKIGAYEVEVPYK-DQNQKIVFLDTPGHEAFS  337 (770)
T ss_pred             EEEEECCCCCCHHHHHHHHH-CCC-CCCCCCC-------------CCCCEECEEEEEECCC-CCCCEEEEECCCCHHHHH
T ss_conf             89985772577203788885-288-5134567-------------6555035299975157-889758995599468899


Q ss_pred             HHHHHHHHHCCEEEEEEECCCCCCHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCCHHHHHHHHHHHHHHH------HH
Q ss_conf             999999973026899998687886558999999997099679983267887532113388877555322321------00
Q gi|254780321|r   93 YEVSRSLSACEGSLLVVDATQGVEAQTLANVYQAIDNNHEIITVLNKADLPSADPDRVKKQIEETIGISTED------AL  166 (606)
Q Consensus        93 ~EV~r~l~a~dgaiLvVdA~~Gvq~QT~~~~~~A~~~~l~~I~viNKiD~~~A~~e~v~~ei~~~~g~~~~~------ii  166 (606)
                      ....|.-.++|-|||||+|.+||||||++....|...++|+|++|||||+|+|+|++|..|+.+. |+.+++      ++
T Consensus       338 ~MRaRGA~vTDIvILVVAADDGVmPQTiEAI~hakaA~VPiIVAINKiDkp~an~~rVk~eL~e~-gli~EewGGd~~~V  416 (770)
T CHL00189        338 SMRSRGANVTDIAILIVAADDGVKPQTIEAINHIQAANVPIIVAINKIDKENANIDRVKQELSKY-NLISEKWGGQTPMI  416 (770)
T ss_pred             HHHHCCCCCCCEEEEEEECCCCCCHHHHHHHHHHHHCCCCEEEEEECCCCCCCCHHHHHHHHHHC-CCCHHHCCCCEEEE
T ss_conf             99862786666799999657885672799999998769988999877458998857899999986-95522237955999


Q ss_pred             HHHHHCCCCCCHHHHHHHHHHHCCCCHHHHHCCCCCCCCCEEECCCCCEEEEEEECCCCCCCCCEEEEECCCCCC-CCCC
Q ss_conf             011100223200678776321000111122012331012101147572599998169873558458873355642-1012
Q gi|254780321|r  167 LVSAKTGEGIPLLLERIVQQLPSPTSPEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKY-QVER  245 (606)
Q Consensus       167 ~vSAktG~GV~~LLd~Iv~~iP~P~~~~~~~~Pl~alVfds~~D~~~G~I~~~RV~sG~lk~Gd~I~~~~~g~~~-~v~~  245 (606)
                      ++||++|.|++.|||+|.-...--.-..+++.|.++.|..+..|+.+|.++++-|.+|+|+.||-+..   |..| +|..
T Consensus       417 ~ISAktg~gId~LLE~IlL~AEvlELkAnp~~~A~GvVIES~ldkgrG~VATvLVQ~GTLkvGD~iVa---G~~~GKVRa  493 (770)
T CHL00189        417 PISALQGTNIDKLLEMILLLAEIENLQADPTQLAQGTILEAHLDKTKGPVATLLVQNGTLRIGDIIVA---GTSLGKIRG  493 (770)
T ss_pred             EEEECCCCCHHHHHHHHHHHHHHHHCCCCCCCCCEEEEEEEEECCCCCCEEEEEEECCEECCCCEEEE---CCCEEEEEE
T ss_conf             96616798879999999999878752368898614999997651686776899995484403999998---363447889


Q ss_pred             CCCCCCCEEEEHHCCCCCHHHHHHCCCCCCCCCCCCEECCCCCCCC-CC------------------CCC----CC-CCC
Q ss_conf             2233554124010124712332201100244445420004667853-23------------------645----52-222
Q gi|254780321|r  246 IGILTPKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTT-SA------------------LPG----FK-PIQ  301 (606)
Q Consensus       246 ig~~~~~~~~v~~l~aGdVG~ii~gik~l~~~~vGDTl~~~~~p~~-~~------------------Lp~----~~-~~~  301 (606)
                      +  +......++++.++... -|.|+.++-  ..||.+...++... ..                  +..    .. ...
T Consensus       494 M--~Dd~Gk~vkeA~PS~PV-eIlGl~~vP--~AGD~f~vv~sEk~Ak~ia~~r~~~~~~~~~~~~sl~~l~~~~~e~~~  568 (770)
T CHL00189        494 M--INSAGNKINEAGPSSPV-EIWGLSSVP--ATGEYFQVVNSEKEAKLKVIENPESNQKQTTSRITLDTPKTINSEDEK  568 (770)
T ss_pred             E--ECCCCCCCCCCCCCCCE-EEECCCCCC--CCCCEEEEECCHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHCCCC
T ss_conf             8--89999844554899868-987787898--779889993799999999999999999977521265559878632774


Q ss_pred             CEEEEEECCCCHHHHHHHHHHHHHHHHHCCCCCCC--------------CCCCCCCCCEEEEEECCHHHHHHHHHHHHHH
Q ss_conf             12664212677024578899998886411221112--------------5676000420289963767898889888664
Q gi|254780321|r  302 PVVFCGLFPVDATQFENLRTAINKLRLNDASFSFE--------------LENSTALGFGFRCGFLGLLHLEIIQERLERE  367 (606)
Q Consensus       302 P~v~~~i~p~~~~d~~~L~~aL~kL~~~D~sl~~e--------------~Ets~aLg~Gfr~gglG~LHLeVi~eRL~rE  367 (606)
                      +.+-.-+-.-..+..+.+.++|.+|..+...+.+-              ...|.|.-.||.+.    ..- -+....+++
T Consensus       569 k~LnlIIKADvqGSlEAI~~sL~kl~~~eV~v~II~sgVG~ITESDV~LA~aS~AiIIGFNVr----~~~-~ak~~Ae~~  643 (770)
T CHL00189        569 KQLNLIIKTDTQGSIEAILNSLSQIPQKKVQLNVLYSSPGEITETDVDLASTTNALIIAFNTN----LAP-GAKKAARKL  643 (770)
T ss_pred             EEEEEEEEECCCCCHHHHHHHHHHCCCCCEEEEEEEECCCCCCHHHHHHHHCCCCEEEEECCC----CCH-HHHHHHHHC
T ss_conf             076499991775309999999970898858999998321577663676765049889996279----897-899999975


Q ss_pred             CCCEEEEECCCCCEEEEEECCCEEECCCHHHCCCHHHHHHHHCCEEEEEEEECCCCCHHHHHHHHHHHHEEECCCCCC--
Q ss_conf             495069737823303353156454126966625867788862326999998083100038999886300142443368--
Q gi|254780321|r  368 FSLNLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEYLGSILKLCQERRGIQIDMSHLD--  445 (606)
Q Consensus       368 fg~ev~~t~P~V~Ykv~~~dG~~~~Vd~p~~~p~~~~i~~i~EPi~~~~I~~P~ey~G~Vm~~l~~RRG~~~~m~~~~--  445 (606)
                       |+++...  +|+|++.  |.-            ...+..+++|..+-.++=-.+- -.+.   .--+|.+-+.--.+  
T Consensus       644 -gV~Ir~y--~IIY~Li--Ddv------------k~~m~glL~P~~~E~~iG~AeV-r~vF---~isKg~IAGc~Vt~G~  702 (770)
T CHL00189        644 -NVDIREY--DVIYDLV--EDI------------EYSMEDLLDPEYDKVPIGEAEV-QTVF---SLAKSFVAGCRVTSGK  702 (770)
T ss_pred             -CCEEEEE--CCHHHHH--HHH------------HHHHHCCCCCEEEEEEEEEEEE-EEEE---ECCCCEEEEEEEEECE
T ss_conf             -9748991--6088899--999------------9998457997068999899999-9999---5289669899998178


Q ss_pred             ----CEE------EEEEEECHHHHHHHHHHHHHHHCCCE--EEEEEEECCCEECCEE
Q ss_conf             ----369------99999604333220468767635741--8889854354643667
Q gi|254780321|r  446 ----NRA------MIVYELPLNEVIFDFYDRLKSVSKGY--ASFDYNVIDYRDSDLV  490 (606)
Q Consensus       446 ----~~~------~i~~~vPl~Eli~~f~~~LkS~T~G~--as~~ye~~~Y~~~dlv  490 (606)
                          ..+      .+.|+=.++.| .-|-+..+....||  |..=-.|..++++|+.
T Consensus       703 I~r~~~vRViR~~~vI~eG~I~SL-KRfKddVkEV~~G~ECGI~l~~fnDik~GDiI  758 (770)
T CHL00189        703 ILKNAHIKVIRKNKLIFEGDINSL-KRVKEDVEEVQEGNECGIFIEEFQLWQSGDKI  758 (770)
T ss_pred             EECCCCEEEEECCEEEEEEEEHHH-HCCCCCCCHHCCCCCCEEECCCCCCCCCCCEE
T ss_conf             963992799769989998076775-00320202315994153770483437779899


No 52 
>cd01883 EF1_alpha Eukaryotic elongation factor 1 (EF1) alpha subfamily.  EF1 is responsible for the GTP-dependent binding of aminoacyl-tRNAs to the ribosomes.  EF1 is composed of four subunits: the alpha chain which binds GTP and aminoacyl-tRNAs, the gamma chain that probably plays a role in anchoring the complex to other cellular components and the beta and delta (or beta') chains.  This subfamily is the alpha subunit, and represents the counterpart of bacterial EF-Tu for the archaea (aEF1-alpha) and eukaryotes (eEF1-alpha).  eEF1-alpha interacts with the actin of the eukaryotic cytoskeleton and may thereby play a role in cellular transformation and apoptosis.  EF-Tu can have no such role in bacteria.  In humans, the isoform eEF1A2 is overexpressed in 2/3 of breast cancers and has been identified as a putative oncogene.  This subfamily also includes Hbs1, a G protein known to be important for efficient growth and protein synthesis under conditions of limiting translation initiation in
Probab=100.00  E-value=2.2e-44  Score=317.35  Aligned_cols=173  Identities=31%  Similarity=0.541  Sum_probs=146.3

Q ss_pred             EEEEECCCCCCHHHHHHHHHHHCCCCCCCCC-------C---------CEEECCCHHHHHHCCEEEEEEEEEEEECCCCC
Q ss_conf             7999801389877889999998298054444-------3---------11305867798719505232799997437884
Q gi|254780321|r   13 NFSIVAHIDHGKSTLADRFIQHCRGLTEREM-------S---------SQVLDNMDIERERGITIKAQTVRLNYTSTDAK   76 (606)
Q Consensus        13 N~~IiaHvDhGKTTL~d~lL~~tg~i~~~~~-------~---------~~vlD~~~~EreRGITIka~~~~~~~~~~~~~   76 (606)
                      ||+++||||||||||++|||+.+|.+.++..       .         ..+||++++||||||||......+     +|+
T Consensus         1 Ni~iiGHvD~GKSTL~g~lL~~~g~i~~~~~~k~~~~~~~~gk~s~~~a~~lD~~~~ErerGiTI~~~~~~f-----~~~   75 (219)
T cd01883           1 NLVVIGHVDAGKSTTTGHLLYLLGGVDKRTIEKYEKEAKEMGKGSFKYAWVLDTLKEERERGVTIDVGLAKF-----ETE   75 (219)
T ss_pred             CEEEEECCCCCHHHHHHHHHHHCCCCCHHHHHHHHHHHHHCCCCCCEEEEEECCCHHHHHCCCCEEEEEEEE-----EEC
T ss_conf             989996689989999999999859976889999999998549987505566138987985892588589999-----849


Q ss_pred             EEEEEEEECCCCCHHHHHHHHHHHHCCEEEEEEECCCC-------CCHHHHHHHHHHHHCCCC-EEEEECCCCCCCC---
Q ss_conf             38999961787300279999999730268999986878-------865589999999970996-7998326788753---
Q gi|254780321|r   77 DYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQG-------VEAQTLANVYQAIDNNHE-IITVLNKADLPSA---  145 (606)
Q Consensus        77 ~y~iNlIDTPGH~DF~~EV~r~l~a~dgaiLvVdA~~G-------vq~QT~~~~~~A~~~~l~-~I~viNKiD~~~A---  145 (606)
                      ++++||||||||.||..++.++++.+|.|||||||.+|       +++||++|+++|...|++ +|++|||||++.+   
T Consensus        76 ~~~~~iiDtPGH~df~~~mi~g~~~ad~ailvvda~~g~~e~g~~~~~QTreH~~l~~~lGik~iIVavNKMD~v~~~y~  155 (219)
T cd01883          76 KYRFTILDAPGHRDFVPNMITGASQADVAVLVVDARKGEFEAGFEKGGQTREHALLARTLGVKQLIVAVNKMDDVTVNWS  155 (219)
T ss_pred             CEEEEEEECCCCHHHHHHHHHHHHHCCEEEEEEECCCCCCCCCCCCCCHHHHHHHHHHHCCCCEEEEEEECCCCCCCCCC
T ss_conf             93699987897266788999877531668999985767510366777659999999998499748999987536886525


Q ss_pred             --CCCCHHHHHHHHH---HHHHHHH--HHHHHHCCCCC------------CHHHHHHHHHHHCCC
Q ss_conf             --2113388877555---3223210--00111002232------------006787763210001
Q gi|254780321|r  146 --DPDRVKKQIEETI---GISTEDA--LLVSAKTGEGI------------PLLLERIVQQLPSPT  191 (606)
Q Consensus       146 --~~e~v~~ei~~~~---g~~~~~i--i~vSAktG~GV------------~~LLd~Iv~~iP~P~  191 (606)
                        +++++.+++.+++   |+..+++  +|+||..|.||            ..||+++ +.+|+|.
T Consensus       156 ~~rf~~i~~~~~~~l~~~g~~~~~~~~IPiSa~~GdNi~~~s~~m~WY~GptLl~~L-d~~~~p~  219 (219)
T cd01883         156 EERYDEIKKELSPFLKKVGYNPKDVPFIPISGLTGDNLIEKSENMPWYKGPTLLEAL-DSLEPPE  219 (219)
T ss_pred             HHHHHHHHHHHHHHHHHCCCCCCCCEEEEEECCCCCCCCCCCCCCCCCCCCHHHHHH-HCCCCCC
T ss_conf             999999999999999982999566159993367663046678899898781699998-4789989


No 53 
>pfam00009 GTP_EFTU Elongation factor Tu GTP binding domain. This domain contains a P-loop motif, also found in several other families such as pfam00071, pfam00025 and pfam00063. Elongation factor Tu consists of three structural domains, this plus two C-terminal beta barrel domains.
Probab=100.00  E-value=5.2e-44  Score=314.96  Aligned_cols=176  Identities=42%  Similarity=0.586  Sum_probs=155.1

Q ss_pred             HHCEEEEEECCCCCCHHHHHHHHHHHCCCCCCCCCC--CEEECCCHHHHHHCCEEEEEEEEEEEECCCCCEEEEEEEECC
Q ss_conf             253179998013898778899999982980544443--113058677987195052327999974378843899996178
Q gi|254780321|r    9 SRIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMS--SQVLDNMDIERERGITIKAQTVRLNYTSTDAKDYQLNLIDTP   86 (606)
Q Consensus         9 ~~IRN~~IiaHvDhGKTTL~d~lL~~tg~i~~~~~~--~~vlD~~~~EreRGITIka~~~~~~~~~~~~~~y~iNlIDTP   86 (606)
                      ++||||||+||.+||||||+++||+.++.+.++...  ...+|+++.||||||||.+..+.+.     |+++++||||||
T Consensus         1 ~~~rnVaivG~~n~GKSTL~n~Ll~~~~~i~~~~~~~~~~~~d~~~~E~~rgiTi~~~~~~~~-----~~~~~i~~iDtP   75 (185)
T pfam00009         1 KRHRNIGIIGHVDHGKTTLTDALLYVTGAIDKRGEVKQEGELDRLKEERERGITIKIAAVSFE-----TKKRHINIIDTP   75 (185)
T ss_pred             CCCCEEEEECCCCCCHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCHHHHHCCEEEEEEEEEEE-----ECCCEEEEEECC
T ss_conf             996789999389944999999997154876546431003333655888857826987699996-----089368999899


Q ss_pred             CCCHHHHHHHHHHHHCCEEEEEEECCCCCCHHHHHHHHHHHHCCCCEEEEECCCCCC-CCCCCCHHHHHHHHH------H
Q ss_conf             730027999999973026899998687886558999999997099679983267887-532113388877555------3
Q gi|254780321|r   87 GHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQAIDNNHEIITVLNKADLP-SADPDRVKKQIEETI------G  159 (606)
Q Consensus        87 GH~DF~~EV~r~l~a~dgaiLvVdA~~Gvq~QT~~~~~~A~~~~l~~I~viNKiD~~-~A~~e~v~~ei~~~~------g  159 (606)
                      ||.||..++.++++.+|+|+|||||.+|+++||+.+|.++.+.++|+|+|+||||+. .++++++.+|+.+.+      +
T Consensus        76 Gh~~f~~~~~~~l~~aD~~vlVvda~~G~~~qt~~~~~~~~~~~~p~iv~vNKiD~v~~~~~~~~~~e~~~~ll~~~~~~  155 (185)
T pfam00009        76 GHVDFTKEMIRGAAQADGAILVVDAVEGVMPQTREHLLLAKQLGVPIIVFINKMDRVDDAELDEVVEEISRELLEKYGFG  155 (185)
T ss_pred             CCCCHHHHHHHHHHHCCCCEEEEECCCCCCCCCHHHHHHHHHHCCCEEEEEECCCCCCHHHHHHHHHHHHHHHHHHHHCC
T ss_conf             87143999999986465642999867685323099999999828987999977327776769999999999988873248


Q ss_pred             HHHHHHHHHHHHCCCCCCHHHHHHHHHHHC
Q ss_conf             223210001110022320067877632100
Q gi|254780321|r  160 ISTEDALLVSAKTGEGIPLLLERIVQQLPS  189 (606)
Q Consensus       160 ~~~~~ii~vSAktG~GV~~LLd~Iv~~iP~  189 (606)
                      .+...++|+||++|.|+++|+|+|..++|+
T Consensus       156 ~~~~pivpiSA~~G~gv~~Ll~~i~~~lP~  185 (185)
T pfam00009       156 GETIPVIPGSALTGEGIDTLLEALDLYLPS  185 (185)
T ss_pred             CCCCEEEEEECCCCCCHHHHHHHHHHHCCC
T ss_conf             998869996789997989999999977859


No 54 
>KOG0460 consensus
Probab=100.00  E-value=2.4e-44  Score=317.27  Aligned_cols=264  Identities=26%  Similarity=0.440  Sum_probs=205.4

Q ss_pred             EEEEEECCCCCCHHHHHHHHHHHCCCCCCCCC-----CCEEECCCHHHHHHCCEEEEEEEEEEEECCCCCEEEEEEEECC
Q ss_conf             17999801389877889999998298054444-----3113058677987195052327999974378843899996178
Q gi|254780321|r   12 RNFSIVAHIDHGKSTLADRFIQHCRGLTEREM-----SSQVLDNMDIERERGITIKAQTVRLNYTSTDAKDYQLNLIDTP   86 (606)
Q Consensus        12 RN~~IiaHvDhGKTTL~d~lL~~tg~i~~~~~-----~~~vlD~~~~EreRGITIka~~~~~~~~~~~~~~y~iNlIDTP   86 (606)
                      -|++-|||||||||||+-++-   ....+.+.     -++ .|.-++||.|||||  +++.+.|...+ +.|-  -+|||
T Consensus        55 vNVGTIGHVDHGKTTLTaAIT---kila~~g~A~~~kyde-ID~APEEkaRGITI--n~aHveYeTa~-RhYa--H~DCP  125 (449)
T KOG0460          55 VNVGTIGHVDHGKTTLTAAIT---KILAEKGGAKFKKYDE-IDKAPEEKARGITI--NAAHVEYETAK-RHYA--HTDCP  125 (449)
T ss_pred             CCCCCCCCCCCCCHHHHHHHH---HHHHHCCCCCCCCHHH-HHCCHHHHHCCCEE--EEEEEEEECCC-CCCC--CCCCC
T ss_conf             520330033577200899999---9997516501054766-53382665356167--64356642244-3001--47899


Q ss_pred             CCCHHHHHHHHHHHHCCEEEEEEECCCCCCHHHHHHHHHHHHCCCC-EEEEECCCCCC-CCC-CCCHHHHHHHH---HHH
Q ss_conf             7300279999999730268999986878865589999999970996-79983267887-532-11338887755---532
Q gi|254780321|r   87 GHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQAIDNNHE-IITVLNKADLP-SAD-PDRVKKQIEET---IGI  160 (606)
Q Consensus        87 GH~DF~~EV~r~l~a~dgaiLvVdA~~Gvq~QT~~~~~~A~~~~l~-~I~viNKiD~~-~A~-~e~v~~ei~~~---~g~  160 (606)
                      ||+||.--..-.-+-.|||||||+|++|+||||++|+.+|.+.|++ +++||||.|.. +++ .|-|.-|+.|+   +|+
T Consensus       126 GHADYIKNMItGaaqMDGaILVVaatDG~MPQTrEHlLLArQVGV~~ivvfiNKvD~V~d~e~leLVEmE~RElLse~gf  205 (449)
T KOG0460         126 GHADYIKNMITGAAQMDGAILVVAATDGPMPQTREHLLLARQVGVKHIVVFINKVDLVDDPEMLELVEMEIRELLSEFGF  205 (449)
T ss_pred             CHHHHHHHHHCCCCCCCCEEEEEECCCCCCCCHHHHHHHHHHCCCCEEEEEEECCCCCCCHHHHHHHHHHHHHHHHHCCC
T ss_conf             63889987532732367349999747898840688888898728764999971202468889999999999999997299


Q ss_pred             HHHH--HHHHHHHC---C----C---CCCHHHHHHHHHHHCCCCHHHHHCCCCCCCCCEEECCCCCEEEEEEECCCCCCC
Q ss_conf             2321--00011100---2----2---320067877632100011112201233101210114757259999816987355
Q gi|254780321|r  161 STED--ALLVSAKT---G----E---GIPLLLERIVQQLPSPTSPEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTK  228 (606)
Q Consensus       161 ~~~~--ii~vSAkt---G----~---GV~~LLd~Iv~~iP~P~~~~~~~~Pl~alVfds~~D~~~G~I~~~RV~sG~lk~  228 (606)
                      +.++  ++..||..   |    +   .|..|||++-+|+|-|.  ++.+.||-+.|-+.+.-+.||.|+.+|+..|+||+
T Consensus       206 ~Gd~~PvI~GSAL~ALeg~~peig~~aI~kLldavDsyip~P~--R~~~~pFl~pie~vfsI~GRGTVvtGrlERG~lKk  283 (449)
T KOG0460         206 DGDNTPVIRGSALCALEGRQPEIGLEAIEKLLDAVDSYIPTPE--RDLDKPFLLPIEDVFSIPGRGTVVTGRLERGVLKK  283 (449)
T ss_pred             CCCCCCEEECCHHHHHCCCCCCCCHHHHHHHHHHHHCCCCCCC--CCCCCCCEEEHHHEEEECCCCEEEEEEEEECCCCC
T ss_conf             9887876632012222278842057999999998751589852--13577740430024661588349987785022146


Q ss_pred             CCEEEEECCCCCCCCCCCCCCCCCEEEEHHCCCCC-HHHHHHCCCCCCCCCCCCEECCCCC
Q ss_conf             84588733556421012223355412401012471-2332201100244445420004667
Q gi|254780321|r  229 GQSIRLMGTNAKYQVERIGILTPKMIDIEALYPGE-IGVMIASIKEVSHTRVGDTITDDSS  288 (606)
Q Consensus       229 Gd~I~~~~~g~~~~v~~ig~~~~~~~~v~~l~aGd-VG~ii~gik~l~~~~vGDTl~~~~~  288 (606)
                      |+++-+...++..+..--| ....++.++++.||| +|.+..|+| .++++.|-.+|.+..
T Consensus       284 G~e~eivG~~~~lkttvtg-iemF~K~ld~a~AGDn~G~LlRGik-~~dvkRGmvl~~pGs  342 (449)
T KOG0460         284 GDEVEIVGHNKTLKTTVTG-IEMFRKSLDEAQAGDNLGALLRGIK-REDVKRGMVLAKPGS  342 (449)
T ss_pred             CCEEEEECCCCCEEEEEEH-HHHHHHHHHHCCCCCCEEHHHHCCC-HHHHHCCCEEECCCC
T ss_conf             8878985067640468626-9999877775015562016451477-878744528736886


No 55 
>PTZ00327 eukaryotic translation initiation factor 2 gamma subunit; Provisional
Probab=100.00  E-value=1.4e-42  Score=305.39  Aligned_cols=263  Identities=24%  Similarity=0.327  Sum_probs=188.8

Q ss_pred             CEEEEEECCCCCCHHHHHHHHHHHCCCCCCCCCCCEEECCCHHHHHHCCEEEEEEEEEE------------EECCCC---
Q ss_conf             31799980138987788999999829805444431130586779871950523279999------------743788---
Q gi|254780321|r   11 IRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVRLN------------YTSTDA---   75 (606)
Q Consensus        11 IRN~~IiaHvDhGKTTL~d~lL~~tg~i~~~~~~~~vlD~~~~EreRGITIka~~~~~~------------~~~~~~---   75 (606)
                      .=||+.|||||||||||+-+|   ||..+         |...+|++|||||+..-+...            |.....   
T Consensus        37 ~vNIGtiGHVDHGKTTLvkAL---Tgv~t---------~r~~eE~~RgiTI~LGya~~kiykc~~~~~p~~y~~~~s~~~  104 (460)
T PTZ00327         37 TINIGTIGHVAHGKSTVVKAL---SGVKT---------VRFHREKVRNITIKLGYANAKIYKCTKCPPPACYKSYPSSKP  104 (460)
T ss_pred             CEEEEEECCCCCCHHHHHHHH---HCCCH---------HHCHHHHHCCCEEEECCCCEEEECCCCCCCCCCEECCCCCCC
T ss_conf             218988746289899999998---67750---------106567875872120543301113656776310101466665


Q ss_pred             -------------CEEEEEEEECCCCCHHHHHHHHHHHHCCEEEEEEECCCCC-CHHHHHHHHHHHHCCCC-EEEEECCC
Q ss_conf             -------------4389999617873002799999997302689999868788-65589999999970996-79983267
Q gi|254780321|r   76 -------------KDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGV-EAQTLANVYQAIDNNHE-IITVLNKA  140 (606)
Q Consensus        76 -------------~~y~iNlIDTPGH~DF~~EV~r~l~a~dgaiLvVdA~~Gv-q~QT~~~~~~A~~~~l~-~I~viNKi  140 (606)
                                   -..++.+||+|||.||..-.....+..|+|||||+|.+|+ ||||++|+.++...|++ +|+|+||+
T Consensus       105 ~~~~c~~c~~~~t~~Rh~s~VDcPGH~~l~~nmi~Ga~~mD~aiLvvaa~eg~P~pQT~EHl~~~~~~gi~~~iv~~nK~  184 (460)
T PTZ00327        105 DNPQCPGCGHKMTLKRHVSFVDCPGHDILMATMLNGAAVMDAALLLIAANESCPQPQTSEHLAAVEIMKLKHIIILQNKI  184 (460)
T ss_pred             CCCCCCCCCCCCCCCEEEEEEECCCHHHHHHHHHHCHHHCCEEEEEEECCCCCCCCHHHHHHHHHHHHCCCEEEEEECCC
T ss_conf             55445555654312204899868987999999874763376799999868888764689999999972897199995354


Q ss_pred             CCCCC-CCCCHHHHHHHHHH---HHHHHHHHHHHHCCCCCCHHHHHHHHHHHCCCCHHHHHCCCCCCCCCEEECCC----
Q ss_conf             88753-21133888775553---22321000111002232006787763210001111220123310121011475----
Q gi|254780321|r  141 DLPSA-DPDRVKKQIEETIG---ISTEDALLVSAKTGEGIPLLLERIVQQLPSPTSPEGANAPLKALLIDSWYNSY----  212 (606)
Q Consensus       141 D~~~A-~~e~v~~ei~~~~g---~~~~~ii~vSAktG~GV~~LLd~Iv~~iP~P~~~~~~~~Pl~alVfds~~D~~----  212 (606)
                      |+..- +..+..+||.+++.   .+...++++||..+.|++.|+++|.+++|.|.  ++.+.||++.|-+|+--..    
T Consensus       185 DlV~~e~~~~~~~ei~~~l~~t~~~~~PIIpvSA~~~~nid~L~~~i~~~ip~P~--R~~~~~~~m~I~rsFdIngpg~~  262 (460)
T PTZ00327        185 DLIKEVQALDQYEEIRNFIDGTIAENAPIIPISAQLKYNIDVLLEYICTQIPIPK--RDLTSPPRMIVIRSFDVNKPGED  262 (460)
T ss_pred             CCCCHHHHHHHHHHHHHHHCCCCCCCCCEEECCHHHCCCHHHHHHHHHHHCCCCC--CCCCCCCEEEEEEEECCCCCCCC
T ss_conf             4558899999999999985257677999875654450587999999997589998--88899953748746715789866


Q ss_pred             ----CCEEEEEEECCCCCCCCCEEEEEC----C--CCCC--C--CCCCCCCCCCEEEEHHCCCCC-HHHHH---HCCCCC
Q ss_conf             ----725999981698735584588733----5--5642--1--012223355412401012471-23322---011002
Q gi|254780321|r  213 ----LGVMVLVRIINGQLTKGQSIRLMG----T--NAKY--Q--VERIGILTPKMIDIEALYPGE-IGVMI---ASIKEV  274 (606)
Q Consensus       213 ----~G~I~~~RV~sG~lk~Gd~I~~~~----~--g~~~--~--v~~ig~~~~~~~~v~~l~aGd-VG~ii---~gik~l  274 (606)
                          +|.|+.|+|.+|.++.||+|.+..    .  +.+.  +  .+++--+.....+++++.+|. +|.-+   .+++ -
T Consensus       263 ~~~lrGtVvtGti~~G~lkvGDeIEI~PG~~~~~~~~k~~~~pi~t~I~sl~~~~~~l~~a~pGGligiGT~Ldp~lt-r  341 (460)
T PTZ00327        263 IENLRGGVAGGSILQGVLKVGDEVEIRPGIVSKDSGGKFTCSPIRTRIVSLKAEQNELQYAVPGGLIGVGTTIDPTLT-R  341 (460)
T ss_pred             CCCCCCEEEEEEEEEEEEECCCEEEECCCEEEEECCCEEEEEEEEEEEEEEEECCCCHHHCCCCCEEEECCCCCCCCC-C
T ss_conf             567654599889988179369989982675324158659999999999988725852421256753653220146621-1


Q ss_pred             CCCCCCCEECCCCC
Q ss_conf             44445420004667
Q gi|254780321|r  275 SHTRVGDTITDDSS  288 (606)
Q Consensus       275 ~~~~vGDTl~~~~~  288 (606)
                      .|..+|..++.+..
T Consensus       342 ~D~l~GqVlgkPGs  355 (460)
T PTZ00327        342 ADRLVGQVLGEPGQ  355 (460)
T ss_pred             CCCCCCCEEECCCC
T ss_conf             31014677866997


No 56 
>PRK05306 infB translation initiation factor IF-2; Validated
Probab=100.00  E-value=1.3e-42  Score=305.65  Aligned_cols=427  Identities=26%  Similarity=0.359  Sum_probs=276.3

Q ss_pred             EEEEECCCCCCHHHHHHHHHHHCCCCCCCCCCCEEECCCHHHHHHCCEEEEEEEEEEEECCCCCEEEEEEEECCCCCHHH
Q ss_conf             79998013898778899999982980544443113058677987195052327999974378843899996178730027
Q gi|254780321|r   13 NFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVRLNYTSTDAKDYQLNLIDTPGHVDFT   92 (606)
Q Consensus        13 N~~IiaHvDhGKTTL~d~lL~~tg~i~~~~~~~~vlD~~~~EreRGITIka~~~~~~~~~~~~~~y~iNlIDTPGH~DF~   92 (606)
                      =+.|+||||||||||.|++- .|. +...+.+             |||-.-.+-++.+  .+  +..|.|||||||.-|+
T Consensus       343 vvt~mghvdhgkt~lld~~r-~~~-v~~~e~g-------------gitq~iga~~v~~--~~--~~~itf~dtpgh~af~  403 (839)
T PRK05306        343 VVTIMGHVDHGKTSLLDAIR-KTK-VAAGEAG-------------GITQHIGAYQVET--EN--GKKITFLDTPGHEAFT  403 (839)
T ss_pred             EEEEECCCCCCHHHHHHHHH-CCC-CCCCCCC-------------CCCCEEEEEEEEE--CC--CCEEEEECCCCHHHHH
T ss_conf             89885774677314899986-287-5355678-------------7552223499995--69--9879985588558899


Q ss_pred             HHHHHHHHHCCEEEEEEECCCCCCHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCCHHHHHHHHHHHHHHH------HH
Q ss_conf             999999973026899998687886558999999997099679983267887532113388877555322321------00
Q gi|254780321|r   93 YEVSRSLSACEGSLLVVDATQGVEAQTLANVYQAIDNNHEIITVLNKADLPSADPDRVKKQIEETIGISTED------AL  166 (606)
Q Consensus        93 ~EV~r~l~a~dgaiLvVdA~~Gvq~QT~~~~~~A~~~~l~~I~viNKiD~~~A~~e~v~~ei~~~~g~~~~~------ii  166 (606)
                      ....|.-.+.|-+||||.|.+||||||++....|...|+|+|++|||||+|+|||++|..|+.+ .|+.+++      .+
T Consensus       404 ~mr~rga~~tdi~ilvvaaddgv~pqt~eai~~~~~a~vp~ivaink~d~~~a~~~~v~~~l~~-~~~~~e~~gg~~~~v  482 (839)
T PRK05306        404 AMRARGAQVTDIVVLVVAADDGVMPQTIEAINHAKAAGVPIIVAINKIDKPGANPDRVKQELTE-YGLVPEEWGGDTIFV  482 (839)
T ss_pred             HHHHCCCCCCCEEEEEEECCCCCCHHHHHHHHHHHHCCCCEEEEEECCCCCCCCHHHHHHHHHH-CCCCHHHCCCCEEEE
T ss_conf             9986357654369999977777567789999999974998899974046788988999999998-498645428944899


Q ss_pred             HHHHHCCCCCCHHHHHHHHHHHCCCCHHHHHCCCCCCCCCEEECCCCCEEEEEEECCCCCCCCCEEEEECCCCCCCCCCC
Q ss_conf             01110022320067877632100011112201233101210114757259999816987355845887335564210122
Q gi|254780321|r  167 LVSAKTGEGIPLLLERIVQQLPSPTSPEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVERI  246 (606)
Q Consensus       167 ~vSAktG~GV~~LLd~Iv~~iP~P~~~~~~~~Pl~alVfds~~D~~~G~I~~~RV~sG~lk~Gd~I~~~~~g~~~~v~~i  246 (606)
                      ++||++|.||+.|||+|.-.-.--.-..+++.|-++.|..+..|..+|.++++-|.+|+|+.||-+..-.+-.  +|..+
T Consensus       483 ~~sa~~~~~~~~l~e~i~l~ae~~~l~a~~~~~a~g~vie~~~~~~~g~v~t~lv~~gtl~~gd~~v~g~~~g--~vr~m  560 (839)
T PRK05306        483 PVSAKTGEGIDELLEAILLQAEVLELKANPDRPARGVVIEAKLDKGRGPVATVLVQNGTLKVGDIVVAGTTYG--RVRAM  560 (839)
T ss_pred             EEEECCCCCHHHHHHHHHHHHHHHCCCCCCCCCEEEEEEEEEECCCCCCEEEEEEECCEECCCCEEEEECCCC--CCEEE
T ss_conf             8151578878999999998766520447999861799998775278750589998427132599899810205--51015


Q ss_pred             CCCCCCEEEEHHCCCCCHHHHHHCCCCCCCCCCCCEECCCCCCCC-C---------------------CCCC----CCCC
Q ss_conf             233554124010124712332201100244445420004667853-2---------------------3645----5222
Q gi|254780321|r  247 GILTPKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTT-S---------------------ALPG----FKPI  300 (606)
Q Consensus       247 g~~~~~~~~v~~l~aGdVG~ii~gik~l~~~~vGDTl~~~~~p~~-~---------------------~Lp~----~~~~  300 (606)
                        +......++++.++... -|.|+.++-  ..||.+.-.++... .                     .|..    ++.-
T Consensus       561 --~~~~g~~~~~a~Ps~pv-~i~G~~~~P--~aGd~~~~~~~e~~a~~~~~~r~~~~~~~~~~~~~~~~l~~~~~~~~~~  635 (839)
T PRK05306        561 --VDDNGKRVKEAGPSTPV-EILGLSGVP--QAGDEFVVVEDEKKAREIAEYRQEKAREKKLARKQRVSLENLFAQMKEG  635 (839)
T ss_pred             --ECCCCCCCCCCCCCCCE-EEECCCCCC--CCCCEEEECCCHHHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHCC
T ss_conf             --88999898714898777-960567899--8888778527889999999999999999987553114698898665226


Q ss_pred             -CCEEEEEECCCCHHHHHHHHHHHHHHHHHCCCCCCC--------------CCCCCCCCCEEEEEECCHHHHHHHHHHHH
Q ss_conf             -212664212677024578899998886411221112--------------56760004202899637678988898886
Q gi|254780321|r  301 -QPVVFCGLFPVDATQFENLRTAINKLRLNDASFSFE--------------LENSTALGFGFRCGFLGLLHLEIIQERLE  365 (606)
Q Consensus       301 -~P~v~~~i~p~~~~d~~~L~~aL~kL~~~D~sl~~e--------------~Ets~aLg~Gfr~gglG~LHLeVi~eRL~  365 (606)
                       ...+-.-+-.-..+..+.|..+|.+|.-++..+.+-              ..+|.|+-.||.+.      .+--..++-
T Consensus       636 ~~k~l~~iiK~Dv~Gs~eAi~~~l~~~~~~~v~~~ii~~~vG~itesDv~lA~as~a~iigFnv~------~~~~~~~~a  709 (839)
T PRK05306        636 EVKELNLILKADVQGSVEALSDSLEKLSTDEVKVRIIHSGVGAITESDVTLAAASNAIIIGFNVR------ADAKARKLA  709 (839)
T ss_pred             CCEEEEEEEECCCCCHHHHHHHHHHHCCCCCEEEEEEECCCCCCCHHHHHHHHHCCCEEEEECCC------CCHHHHHHH
T ss_conf             74278789852765439999999983688737899995167777687898898549889995388------898999999


Q ss_pred             HHCCCEEEEECCCCCEEEEEECCCEEECCCHHHCCCHHHHHHHHCCEEEEEEEEC----C----CCCHHHHHHHHHHHHE
Q ss_conf             6449506973782330335315645412696662586778886232699999808----3----1000389998863001
Q gi|254780321|r  366 REFSLNLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITP----N----EYLGSILKLCQERRGI  437 (606)
Q Consensus       366 rEfg~ev~~t~P~V~Ykv~~~dG~~~~Vd~p~~~p~~~~i~~i~EPi~~~~I~~P----~----ey~G~Vm~~l~~RRG~  437 (606)
                      +..|+++..-  +|+|++.  |--            ...+..+|+|...=.++=-    +    .-+|.|-+ |.-..|.
T Consensus       710 ~~~~v~i~~y--~iIY~~i--d~v------------~~~~~g~l~p~~~e~~~G~a~v~~~f~~~k~g~iag-c~v~~g~  772 (839)
T PRK05306        710 EQEGVDIRYY--SIIYDLI--DDV------------KAAMSGMLEPEYEEEIIGQAEVREVFKVSKVGTIAG-CMVTEGK  772 (839)
T ss_pred             HHCCCEEEEE--CHHHHHH--HHH------------HHHHHCCCCCCEEEEEEEEEEEEEEEECCCCCEEEE-EEEEECE
T ss_conf             9839818992--5688799--999------------999844899732789979999745797588736888-9987188


Q ss_pred             EECCCCCC-CE-EEEEEEECHHHHHHHHHHHHHHHCCCEE--EEEEEECCCEECCEE
Q ss_conf             42443368-36-9999996043332204687676357418--889854354643667
Q gi|254780321|r  438 QIDMSHLD-NR-AMIVYELPLNEVIFDFYDRLKSVSKGYA--SFDYNVIDYRDSDLV  490 (606)
Q Consensus       438 ~~~m~~~~-~~-~~i~~~vPl~Eli~~f~~~LkS~T~G~a--s~~ye~~~Y~~~dlv  490 (606)
                      +..-...- -| -.+.|+=.+.-| --|-|..+....||-  ..=-.|..++++|+.
T Consensus       773 i~~~~~~r~~r~~~~~~~g~~~sl-~~~k~~v~ev~~g~ecgi~~~~~~~~~~gd~i  828 (839)
T PRK05306        773 VKRNAKVRVLRDGVVIYEGELESL-KRFKDDVKEVRAGYECGIGLENYNDIKEGDII  828 (839)
T ss_pred             EECCCCEEEEECCEEEEEEEEHHH-HHHHHCCCHHCCCCCCEEEECCCCCCCCCCEE
T ss_conf             964992799879989996263664-11020312323894252673373577669889


No 57 
>COG0050 TufB GTPases - translation elongation factors [Translation, ribosomal structure and biogenesis]
Probab=100.00  E-value=2e-43  Score=311.04  Aligned_cols=265  Identities=25%  Similarity=0.410  Sum_probs=204.0

Q ss_pred             CEEEEEECCCCCCHHHHHHHHHHHCCCCCCCCCC-----CEEECCCHHHHHHCCEEEEEEEEEEEECCCCCEEEEEEEEC
Q ss_conf             3179998013898778899999982980544443-----11305867798719505232799997437884389999617
Q gi|254780321|r   11 IRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMS-----SQVLDNMDIERERGITIKAQTVRLNYTSTDAKDYQLNLIDT   85 (606)
Q Consensus        11 IRN~~IiaHvDhGKTTL~d~lL~~tg~i~~~~~~-----~~vlD~~~~EreRGITIka~~~~~~~~~~~~~~y~iNlIDT   85 (606)
                      -=|++.|||+|||||||+-++   |+...+....     ++ .|..++||||||||  ++..+.|...+ +  ....+||
T Consensus        12 hVNigtiGHvdHGKTTLtaAi---t~~la~~~~~~~~~y~~-id~aPeEk~rGITI--ntahveyet~~-r--hyahVDc   82 (394)
T COG0050          12 HVNVGTIGHVDHGKTTLTAAI---TTVLAKKGGAEAKAYDQ-IDNAPEEKARGITI--NTAHVEYETAN-R--HYAHVDC   82 (394)
T ss_pred             EEEEEEECCCCCCHHHHHHHH---HHHHHHHCCCCCCCHHH-HHCCCHHHHCCCEE--CCCEEEEECCC-C--EEEECCC
T ss_conf             147878614247635289999---99998632401033344-30482676457254--01005886388-1--4886168


Q ss_pred             CCCCHHHHHHHHHHHHCCEEEEEEECCCCCCHHHHHHHHHHHHCCCC-EEEEECCCCCCC-C-CCCCHHHHHHHHH---H
Q ss_conf             87300279999999730268999986878865589999999970996-799832678875-3-2113388877555---3
Q gi|254780321|r   86 PGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQAIDNNHE-IITVLNKADLPS-A-DPDRVKKQIEETI---G  159 (606)
Q Consensus        86 PGH~DF~~EV~r~l~a~dgaiLvVdA~~Gvq~QT~~~~~~A~~~~l~-~I~viNKiD~~~-A-~~e~v~~ei~~~~---g  159 (606)
                      |||+|+.--..-+-+-.|||||||+|++|+||||++|..+|.+.|.| +++|+||+|+.+ . ..|.|..|+.|++   |
T Consensus        83 PGHaDYvKNMItgAaqmDgAILVVsA~dGpmPqTrEHiLlarqvGvp~ivvflnK~Dmvdd~ellelVemEvreLLs~y~  162 (394)
T COG0050          83 PGHADYVKNMITGAAQMDGAILVVAATDGPMPQTREHILLARQVGVPYIVVFLNKVDMVDDEELLELVEMEVRELLSEYG  162 (394)
T ss_pred             CCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCHHHHHHHHHCCCCEEEEEEECCCCCCCHHHHHHHHHHHHHHHHHCC
T ss_conf             97489999876407753762899984789998605642012342885799997422366868999999999999999739


Q ss_pred             HHHHH--HHHHHHHCCC--------CCCHHHHHHHHHHHCCCCHHHHHCCCCCCCCCEEECCCCCEEEEEEECCCCCCCC
Q ss_conf             22321--0001110022--------3200678776321000111122012331012101147572599998169873558
Q gi|254780321|r  160 ISTED--ALLVSAKTGE--------GIPLLLERIVQQLPSPTSPEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKG  229 (606)
Q Consensus       160 ~~~~~--ii~vSAktG~--------GV~~LLd~Iv~~iP~P~~~~~~~~Pl~alVfds~~D~~~G~I~~~RV~sG~lk~G  229 (606)
                      ++.++  ++..||..-.        .|.+|||++-+|+|.|.  ++.+.||.|.|-|.+.-..+|.++++||..|+|+.|
T Consensus       163 f~gd~~Pii~gSal~ale~~~~~~~~i~eLm~avd~yip~Pe--r~~dkPflmpvEdvfsIsgrgtvvtGrVeRG~lkvg  240 (394)
T COG0050         163 FPGDDTPIIRGSALKALEGDAKWEAKIEELMDAVDSYIPTPE--RDIDKPFLMPVEDVFSISGRGTVVTGRVERGILKVG  240 (394)
T ss_pred             CCCCCCCEEECHHHHHHCCCCCHHHHHHHHHHHHHHCCCCCC--CCCCCCCCCCCEEEEEECCCEEEEEEEEEEEEECCC
T ss_conf             998776334112333103772167899999999985489998--655665201010068975751689878840124158


Q ss_pred             CEEEEECCCCCCCCCCCCCCCCCEEEEHHCCCCC-HHHHHHCCCCCCCCCCCCEECCCCC
Q ss_conf             4588733556421012223355412401012471-2332201100244445420004667
Q gi|254780321|r  230 QSIRLMGTNAKYQVERIGILTPKMIDIEALYPGE-IGVMIASIKEVSHTRVGDTITDDSS  288 (606)
Q Consensus       230 d~I~~~~~g~~~~v~~ig~~~~~~~~v~~l~aGd-VG~ii~gik~l~~~~vGDTl~~~~~  288 (606)
                      +.+.+..-+...+..--|+ .+.++..++..||| +|++..|++ -+++..|-.|+.+..
T Consensus       241 ~eveivG~~~~~kttvtgv-emfrk~ld~~~aGdnvg~llRg~~-r~~veRGqvLakpgs  298 (394)
T COG0050         241 EEVEIVGIKETQKTTVTGV-EMFRKLLDEGQAGDNVGVLLRGVK-REDVERGQVLAKPGS  298 (394)
T ss_pred             CEEEEECCCCCCEEEEEHH-HHHHHHHHCCCCCCCCCEEEEECC-CCCEECCEEECCCCC
T ss_conf             7799725645530488769-999988740466898526897211-133531207606886


No 58 
>cd04166 CysN_ATPS CysN_ATPS subfamily.  CysN, together with protein CysD, form the ATP sulfurylase (ATPS) complex in some bacteria and lower eukaryotes.  ATPS catalyzes the production of ATP sulfurylase (APS) and pyrophosphate (PPi) from ATP and sulfate.  CysD, which catalyzes ATP hydrolysis, is a member of the ATP pyrophosphatase (ATP PPase) family.  CysN hydrolysis of GTP is required for CysD hydrolysis of ATP; however, CysN hydrolysis of GTP is not dependent on CysD hydrolysis of ATP.  CysN is an example of lateral gene transfer followed by acquisition of new function.  In many organisms, an ATPS exists which is not GTP-dependent and shares no sequence or structural similarity to CysN.
Probab=100.00  E-value=9e-42  Score=299.90  Aligned_cols=160  Identities=26%  Similarity=0.393  Sum_probs=133.4

Q ss_pred             EEEEECCCCCCHHHHHHHHHHHCCCCCCCCC-------C---------CEEECCCHHHHHHCCEEEEEEEEEEEECCCCC
Q ss_conf             7999801389877889999998298054444-------3---------11305867798719505232799997437884
Q gi|254780321|r   13 NFSIVAHIDHGKSTLADRFIQHCRGLTEREM-------S---------SQVLDNMDIERERGITIKAQTVRLNYTSTDAK   76 (606)
Q Consensus        13 N~~IiaHvDhGKTTL~d~lL~~tg~i~~~~~-------~---------~~vlD~~~~EreRGITIka~~~~~~~~~~~~~   76 (606)
                      .|+++||||||||||++|||+.+|.+..+..       .         ..+||+++.||||||||......     +.++
T Consensus         1 ~~vv~GHVD~GKSTL~g~LL~~~g~i~~~~~~~~~~~~~~~~~~~~~~a~~lD~~~~ErerGiTId~~~~~-----f~~~   75 (208)
T cd04166           1 RFLTCGSVDDGKSTLIGRLLYDSKSIFEDQLAALESKSCGTGGEPLDLALLVDGLQAEREQGITIDVAYRY-----FSTP   75 (208)
T ss_pred             CEEEEECCCCCHHHHHHHHHHHCCCCCHHHHHHHHHHHHHCCCCCHHHHHHCCCCHHHHHCCCCEEEEEEE-----EEEC
T ss_conf             96999748898889999999982996789999999887541676300034346868788269794105899-----9819


Q ss_pred             EEEEEEEECCCCCHHHHHHHHHHHHCCEEEEEEECCCCCCHHHHHHHHHHHHCCCC-EEEEECCCCCCCCCC---CCHHH
Q ss_conf             38999961787300279999999730268999986878865589999999970996-799832678875321---13388
Q gi|254780321|r   77 DYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQAIDNNHE-IITVLNKADLPSADP---DRVKK  152 (606)
Q Consensus        77 ~y~iNlIDTPGH~DF~~EV~r~l~a~dgaiLvVdA~~Gvq~QT~~~~~~A~~~~l~-~I~viNKiD~~~A~~---e~v~~  152 (606)
                      +++++|||||||.||..++.++.+.+|+|||||||.+|+++||++|+++|...|++ +|++|||||+.+.+.   +++..
T Consensus        76 ~~~~~iiDtPGH~dfi~nmi~gas~aD~ailVVda~~G~~~QT~eh~~~~~~lgi~~iIv~vNKmD~v~~~e~~f~~i~~  155 (208)
T cd04166          76 KRKFIIADTPGHEQYTRNMVTGASTADLAILLVDARKGVLEQTRRHSYILSLLGIRHVVVAVNKMDLVDYSEEVFEEIVA  155 (208)
T ss_pred             CCEEEEEECCCCHHHHHHHHHHHHHCCEEEEEEECCCCCCHHHHHHHHHHHHCCCCEEEEEEECCCCCCCCHHHHHHHHH
T ss_conf             92699987896288999999998637747999975888727899999999974998399999885768999899999999


Q ss_pred             HHHHHH---HHHHHHHHHHHHHCCCCCC
Q ss_conf             877555---3223210001110022320
Q gi|254780321|r  153 QIEETI---GISTEDALLVSAKTGEGIP  177 (606)
Q Consensus       153 ei~~~~---g~~~~~ii~vSAktG~GV~  177 (606)
                      ++.+++   ++....++|+||.+|.||-
T Consensus       156 ~~~~~l~~~~~~~~~~IPiSa~~GdNi~  183 (208)
T cd04166         156 DYLAFAAKLGIEDITFIPISALDGDNVV  183 (208)
T ss_pred             HHHHHHHHCCCCCCEEEEEECCCCCCCC
T ss_conf             9999999749988719981267788878


No 59 
>cd01888 eIF2_gamma eIF2-gamma (gamma subunit of initiation factor 2).  eIF2 is a heterotrimeric translation initiation factor that consists of alpha, beta, and gamma subunits.  The GTP-bound gamma subunit also binds initiator methionyl-tRNA and delivers it to the 40S ribosomal subunit.  Following hydrolysis of GTP to GDP, eIF2:GDP is released from the ribosome.  The gamma subunit has no intrinsic GTPase activity, but is stimulated by the GTPase activating protein (GAP) eIF5, and GDP/GTP exchange is stimulated by the guanine nucleotide exchange factor (GEF) eIF2B.  eIF2B is a heteropentamer, and the epsilon chain binds eIF2.  Both eIF5 and eIF2B-epsilon are known to bind strongly to eIF2-beta, but have also been shown to bind directly to eIF2-gamma.  It is possible that eIF2-beta serves simply as a high-affinity docking site for eIF5 and eIF2B-epsilon, or that eIF2-beta serves a regulatory role.  eIF2-gamma is found only in eukaryotes and archaea.  It is closely related to SelB, the sel
Probab=100.00  E-value=4.1e-42  Score=302.20  Aligned_cols=167  Identities=28%  Similarity=0.359  Sum_probs=132.4

Q ss_pred             EEEEECCCCCCHHHHHHHHHHHCCCCCCCCCCCEEECCCHHHHHHCCEEEEEEEE--E----------EE--EC--CCC-
Q ss_conf             7999801389877889999998298054444311305867798719505232799--9----------97--43--788-
Q gi|254780321|r   13 NFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVR--L----------NY--TS--TDA-   75 (606)
Q Consensus        13 N~~IiaHvDhGKTTL~d~lL~~tg~i~~~~~~~~vlD~~~~EreRGITIka~~~~--~----------~~--~~--~~~-   75 (606)
                      ||+++||||||||||+++|   +|..         .|....|+||||||+.....  +          .|  ..  ... 
T Consensus         2 Ni~iiGHVDhGKSTLi~~L---~g~~---------~~~~~~e~er~it~klg~a~~~~~~~~~~~~~~~~~~~~~~~~~~   69 (203)
T cd01888           2 NIGTIGHVAHGKSTLVKAL---SGVW---------TVRFKEELERNITIKLGYANAKIYKCPNCGCPRPYCYRSKEDSPE   69 (203)
T ss_pred             EEEEEEEECCCHHHHHHHH---HCCC---------HHHHHHHHHCCCCHHHHHHHHHHHHCCCCCCCCCHHHHCCCCCCE
T ss_conf             6999988578799999997---0851---------244078886776031114566665111212231011110124421


Q ss_pred             -----------CEEEEEEEECCCCCHHHHHHHHHHHHCCEEEEEEECCCCC-CHHHHHHHHHHHHCCCC-EEEEECCCCC
Q ss_conf             -----------4389999617873002799999997302689999868788-65589999999970996-7998326788
Q gi|254780321|r   76 -----------KDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGV-EAQTLANVYQAIDNNHE-IITVLNKADL  142 (606)
Q Consensus        76 -----------~~y~iNlIDTPGH~DF~~EV~r~l~a~dgaiLvVdA~~Gv-q~QT~~~~~~A~~~~l~-~I~viNKiD~  142 (606)
                                 -.+++||||||||.||..++.++.+.||+|+|||||.+|+ |+||++|++++...|++ +|+++||||+
T Consensus        70 ~~~~~~~~~~~~~r~~tiiD~PGH~df~~nmi~Gas~aD~aiLvVdA~eG~~~~QT~eH~~l~~~lgv~~iIV~vNKmDl  149 (203)
T cd01888          70 CECPGCGGETKLVRHVSFVDCPGHEILMATMLSGAAVMDGALLLIAANEPCPQPQTSEHLAALEIMGLKHIIIVQNKIDL  149 (203)
T ss_pred             EEECCCCCCCCCEEEEEEEECCCHHHHHHHHHHHHHHCCEEEEEEECCCCCCHHHHHHHHHHHHHCCCCCEEEEEECCCC
T ss_conf             45314565431124799986898799999999766434766898643667750779999999998499863677507777


Q ss_pred             CCCCC-CCHHHHHHHHH---HHHHHHHHHHHHHCCCCCCHHHHHHHHHHHCCC
Q ss_conf             75321-13388877555---322321000111002232006787763210001
Q gi|254780321|r  143 PSADP-DRVKKQIEETI---GISTEDALLVSAKTGEGIPLLLERIVQQLPSPT  191 (606)
Q Consensus       143 ~~A~~-e~v~~ei~~~~---g~~~~~ii~vSAktG~GV~~LLd~Iv~~iP~P~  191 (606)
                      ...+. +...+|+.+++   +.....++|+||++|.||+.||++|++++|+|.
T Consensus       150 v~~~~~~~~~~ei~~~l~~~~~~~~~iIPiSA~~G~NI~~ll~~i~~~ip~P~  202 (203)
T cd01888         150 VKEEQALENYEQIKKFVKGTIAENAPIIPISAQLKYNIDVLLEYIVKKIPTPP  202 (203)
T ss_pred             CCHHHHHHHHHHHHHHHCCCCCCCCEEEEEECCCCCCHHHHHHHHHHHCCCCC
T ss_conf             88678999999999985521689985999147889799999999986782999


No 60 
>PRK04004 translation initiation factor IF-2; Validated
Probab=100.00  E-value=2.1e-39  Score=284.06  Aligned_cols=211  Identities=29%  Similarity=0.416  Sum_probs=160.5

Q ss_pred             EEEECCCCCCHHHHHHHHHHHCCCCCCCCCCCEEECCCHHHHHHCCEEEEEEEEEEEECC-------------CCCEEEE
Q ss_conf             999801389877889999998298054444311305867798719505232799997437-------------8843899
Q gi|254780321|r   14 FSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVRLNYTST-------------DAKDYQL   80 (606)
Q Consensus        14 ~~IiaHvDhGKTTL~d~lL~~tg~i~~~~~~~~vlD~~~~EreRGITIka~~~~~~~~~~-------------~~~~y~i   80 (606)
                      +||+||||||||||.|++- .|. +..++++             |||-.--+..+.+...             +.+---|
T Consensus         8 vtimGHVDhGKTsLLD~iR-~t~-V~~~EaG-------------GITQhIGA~~v~~~~~~~~~~~~~~~~~~~~~ipgl   72 (592)
T PRK04004          8 VVVLGHVDHGKTTLLDKIR-GTA-VAAKEAG-------------GITQHIGATEVPIDVIEKIAGPLVKRLPLKLKIPGL   72 (592)
T ss_pred             EEEECCCCCCHHHHHHHHH-CCC-CCCCCCC-------------CCCCEECEEEECCCCHHHHCCCCCCCCCCCCCCCCC
T ss_conf             9997873777636899986-287-7355577-------------623230659841231011034433443323456775


Q ss_pred             EEEECCCCCHHHHHHHHHHHHCCEEEEEEECCCCCCHHHHHHHHHHHHCCCCEEEEECCCCC-CCCCC------------
Q ss_conf             99617873002799999997302689999868788655899999999709967998326788-75321------------
Q gi|254780321|r   81 NLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQAIDNNHEIITVLNKADL-PSADP------------  147 (606)
Q Consensus        81 NlIDTPGH~DF~~EV~r~l~a~dgaiLvVdA~~Gvq~QT~~~~~~A~~~~l~~I~viNKiD~-~~A~~------------  147 (606)
                      .|||||||..|+.-.+|.-++||-|+|||||.+|+||||++.+.+|...+.|+|+++||||+ |++++            
T Consensus        73 lfiDTPGHeaFt~mR~RGa~vtDiaILVVa~~dGv~pQT~EaI~~~k~~~vP~IVAiNKiDr~~gw~~~~~~~~~~~~~~  152 (592)
T PRK04004         73 LFIDTPGHEAFSNLRKRGGALADIAILVVDINEGFQPQTIESLNILKSRKTPFVVAANKIDRIPGWKSVEGAPFLESFKK  152 (592)
T ss_pred             EEECCCCHHHHHHHHHHCCCCCCEEEEEEECCCCCCHHHHHHHHHHHHCCCCEEEEEECCCCCCCCCCCCCCCHHHHHHH
T ss_conf             57659965999999973674578899999778886762799999999759988999862235666776767411232231


Q ss_pred             --CCHHHHHHHH----------HHHHHH------------HHHHHHHHCCCCCCHHHHHHHHHHH---CCCCHHHHHCCC
Q ss_conf             --1338887755----------532232------------1000111002232006787763210---001111220123
Q gi|254780321|r  148 --DRVKKQIEET----------IGISTE------------DALLVSAKTGEGIPLLLERIVQQLP---SPTSPEGANAPL  200 (606)
Q Consensus       148 --e~v~~ei~~~----------~g~~~~------------~ii~vSAktG~GV~~LLd~Iv~~iP---~P~~~~~~~~Pl  200 (606)
                        +++.+++++.          .|+.++            .++|+||+||.||++||+.|+...-   .-.-..+++.|.
T Consensus       153 q~~~v~~~l~~~~~~vi~~l~e~G~~~e~~~~~~d~g~~v~~VpvSA~tGeGi~dLL~~i~~Laq~~l~~~Lka~~~~~a  232 (592)
T PRK04004        153 QSERVQAELEEKLYELIGELYELGFSADRFDRVSDFTKTVAIVPVSAKTGEGIPDLLMVLAGLAQRYLEEELKIEVEGPG  232 (592)
T ss_pred             CCHHHHHHHHHHHHHHHHHHHHCCCCHHHCCCCCCCCCCEEEEECCCCCCCCHHHHHHHHHHHHHHHHHHHHCCCCCCCC
T ss_conf             73889999988888888999872876322145434588148997820568998999999999999999985367999986


Q ss_pred             CCCCCCEEECCCCCEEEEEEECCCCCCCCCEEEEECCCC
Q ss_conf             310121011475725999981698735584588733556
Q gi|254780321|r  201 KALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNA  239 (606)
Q Consensus       201 ~alVfds~~D~~~G~I~~~RV~sG~lk~Gd~I~~~~~g~  239 (606)
                      ++.|..+-.|+.+|.++.+-|++|+|+.||.+.......
T Consensus       233 ~GtViEsk~dkG~G~vatVIv~~GtLk~GD~IV~g~~~G  271 (592)
T PRK04004        233 KGTVLEVKEERGLGTTLDVILYDGTLRKGDTIVVGGLDG  271 (592)
T ss_pred             CEEEEEEEECCCCCCEEEEEEECCEECCCCEEEEEECCC
T ss_conf             189999986079886179999768471699999951578


No 61 
>KOG0458 consensus
Probab=100.00  E-value=1.9e-38  Score=277.60  Aligned_cols=272  Identities=26%  Similarity=0.380  Sum_probs=217.6

Q ss_pred             CCHHHCEEEEEECCCCCCHHHHHHHHHHHCCCCCCCCCC----------------CEEECCCHHHHHHCCEEEEEEEEEE
Q ss_conf             985253179998013898778899999982980544443----------------1130586779871950523279999
Q gi|254780321|r    6 TPLSRIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMS----------------SQVLDNMDIERERGITIKAQTVRLN   69 (606)
Q Consensus         6 ~p~~~IRN~~IiaHvDhGKTTL~d~lL~~tg~i~~~~~~----------------~~vlD~~~~EreRGITIka~~~~~~   69 (606)
                      .+++.--|+.++||||+|||||..+|||..|.|+.|.|.                ..+||...+|||||+|.   .+...
T Consensus       172 ~~~k~~l~lvv~GhVdaGKSTLmG~lLydLg~i~~~~m~kl~~es~~~Gk~Sf~yawiLDeT~eERerGvTm---~v~~~  248 (603)
T KOG0458         172 SDPKDHLNLVVLGHVDAGKSTLMGHLLYDLGEISSRSMHKLERESKNLGKSSFAYAWILDETKEERERGVTM---DVKTT  248 (603)
T ss_pred             CCCCCCEEEEEEECCCCCHHHHHHHHHHHHCCCCHHHHHHHHHHHHHCCCCCEEEEEEECCCHHHHHCCEEE---EEEEE
T ss_conf             587661589997023454111023788873686578899999998752875302567743631245436367---75468


Q ss_pred             EECCCCCEEEEEEEECCCCCHHHHHHHHHHHHCCEEEEEEECCCC-------CCHHHHHHHHHHHHCCCC-EEEEECCCC
Q ss_conf             743788438999961787300279999999730268999986878-------865589999999970996-799832678
Q gi|254780321|r   70 YTSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQG-------VEAQTLANVYQAIDNNHE-IITVLNKAD  141 (606)
Q Consensus        70 ~~~~~~~~y~iNlIDTPGH~DF~~EV~r~l~a~dgaiLvVdA~~G-------vq~QT~~~~~~A~~~~l~-~I~viNKiD  141 (606)
                      |..  .+.+.+.|||+|||-||.-+.....+-+|.|+|||||+.|       .-.||++|.++....|+. +|++|||||
T Consensus       249 ~fe--s~~~~~tliDaPGhkdFi~nmi~g~sqaD~avLvvd~s~~~FE~gfd~~gQtrEha~llr~Lgi~qlivaiNKmD  326 (603)
T KOG0458         249 WFE--SKSKIVTLIDAPGHKDFIPNMISGASQADVAVLVVDASTGEFESGFDPGGQTREHALLLRSLGISQLIVAINKMD  326 (603)
T ss_pred             EEE--CCCEEEEEECCCCCCCCCHHHHCCCCCCCEEEEEEECCCCHHHHCCCCCCCHHHHHHHHHHCCCCEEEEEEECCC
T ss_conf             984--686169986078742355234336221566899998775433313487986589999998749525888863010


Q ss_pred             CCCCCCCC---HHHHHHHH----HHHHHH--HHHHHHHHCCCCC---------------CHHHHHHHHHHHCCCCHHHHH
Q ss_conf             87532113---38887755----532232--1000111002232---------------006787763210001111220
Q gi|254780321|r  142 LPSADPDR---VKKQIEET----IGISTE--DALLVSAKTGEGI---------------PLLLERIVQQLPSPTSPEGAN  197 (606)
Q Consensus       142 ~~~A~~e~---v~~ei~~~----~g~~~~--~ii~vSAktG~GV---------------~~LLd~Iv~~iP~P~~~~~~~  197 (606)
                      ..+++-++   +...+..+    +|+..+  ..+||||.+|.|+               ..||++|-. +-+|..  ..+
T Consensus       327 ~V~Wsq~RF~eIk~~l~~fL~~~~gf~es~v~FIPiSGl~GeNL~k~~~~~~l~~WY~Gp~LL~~id~-~~~p~~--~~~  403 (603)
T KOG0458         327 LVSWSQDRFEEIKNKLSSFLKESCGFKESSVKFIPISGLSGENLIKIEQENELSQWYKGPTLLSQIDS-FKIPER--PID  403 (603)
T ss_pred             CCCCCHHHHHHHHHHHHHHHHHHCCCCCCCCCEEECCCCCCCCCCCCCCCHHHHHHHCCCHHHHHHHH-CCCCCC--CCC
T ss_conf             12753889999999899999985285047765695546567762123341355665338808888861-368887--666


Q ss_pred             CCCCCCCCCEEECCCCCEEEEEEECCCCCCCCCEEEEECCCCCCCCCCCCCCCCCEEEEHHCCCCCHHHHHHCCC--CCC
Q ss_conf             123310121011475725999981698735584588733556421012223355412401012471233220110--024
Q gi|254780321|r  198 APLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVERIGILTPKMIDIEALYPGEIGVMIASIK--EVS  275 (606)
Q Consensus       198 ~Pl~alVfds~~D~~~G~I~~~RV~sG~lk~Gd~I~~~~~g~~~~v~~ig~~~~~~~~v~~l~aGdVG~ii~gik--~l~  275 (606)
                      .||++-|.|++-.+--|...+|||.+|.|..||+|+++.+.....|..+-   ....+...+.|||  +|..++.  .+.
T Consensus       404 kPl~ltIsdi~~~~~~~~~i~gkiesG~iq~gqkl~i~~s~e~~~vk~l~---~~~~~~~~a~AGD--~Vsl~L~~i~~n  478 (603)
T KOG0458         404 KPLRLTISDIYPLPSSGVSISGKIESGYIQPGQKLYIMTSREDATVKGLT---SNDEPKTWAVAGD--NVSLKLPGILPN  478 (603)
T ss_pred             CCEEEEHHHEEECCCCEEEEEEEEECCCCCCCCEEEEECCCCEEEEEEEE---CCCCCCEEEEECC--EEEEECCCCCHH
T ss_conf             77487830054358870689999721421359989983575307998554---3898621576177--899853765764


Q ss_pred             CCCCCCEEC-CCCCCC
Q ss_conf             444542000-466785
Q gi|254780321|r  276 HTRVGDTIT-DDSSPT  290 (606)
Q Consensus       276 ~~~vGDTl~-~~~~p~  290 (606)
                      .+++||++| .+..|.
T Consensus       479 ~v~~g~i~~~~~~~~i  494 (603)
T KOG0458         479 LVQVGDIADSGPQFPI  494 (603)
T ss_pred             HCCCCEEEECCCCCCC
T ss_conf             5355204522787543


No 62 
>KOG1145 consensus
Probab=100.00  E-value=1.8e-38  Score=277.70  Aligned_cols=247  Identities=28%  Similarity=0.406  Sum_probs=193.7

Q ss_pred             EEEEECCCCCCHHHHHHHHHHHCCCCCCCCCCCEEECCCHHHHHHCCEEEEEEEEEEEECCCCCEEEEEEEECCCCCHHH
Q ss_conf             79998013898778899999982980544443113058677987195052327999974378843899996178730027
Q gi|254780321|r   13 NFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVRLNYTSTDAKDYQLNLIDTPGHVDFT   92 (606)
Q Consensus        13 N~~IiaHvDhGKTTL~d~lL~~tg~i~~~~~~~~vlD~~~~EreRGITIka~~~~~~~~~~~~~~y~iNlIDTPGH~DF~   92 (606)
                      =+-|.||||||||||.|+|=  -..+...+.+             |||-.--+.++..  .+|+  .|.|+|||||+-|+
T Consensus       155 VVTiMGHVDHGKTTLLD~lR--ks~VAA~E~G-------------GITQhIGAF~V~~--p~G~--~iTFLDTPGHaAF~  215 (683)
T KOG1145         155 VVTIMGHVDHGKTTLLDALR--KSSVAAGEAG-------------GITQHIGAFTVTL--PSGK--SITFLDTPGHAAFS  215 (683)
T ss_pred             EEEEEECCCCCHHHHHHHHH--HCCEEHHHCC-------------CCCCEECEEEEEC--CCCC--EEEEECCCCHHHHH
T ss_conf             69986013577001998874--0722013237-------------7100002299963--8997--78875687478899


Q ss_pred             HHHHHHHHHCCEEEEEEECCCCCCHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCCHHHHHHHHHHHHHH------HHH
Q ss_conf             99999997302689999868788655899999999709967998326788753211338887755532232------100
Q gi|254780321|r   93 YEVSRSLSACEGSLLVVDATQGVEAQTLANVYQAIDNNHEIITVLNKADLPSADPDRVKKQIEETIGISTE------DAL  166 (606)
Q Consensus        93 ~EV~r~l~a~dgaiLvVdA~~Gvq~QT~~~~~~A~~~~l~~I~viNKiD~~~A~~e~v~~ei~~~~g~~~~------~ii  166 (606)
                      ....|.-++.|-++|||.|.+||||||.+....|...+.|+|+.|||||+|+|+|++++.|+.. .|+..+      +++
T Consensus       216 aMRaRGA~vtDIvVLVVAadDGVmpQT~EaIkhAk~A~VpiVvAinKiDkp~a~pekv~~eL~~-~gi~~E~~GGdVQvi  294 (683)
T KOG1145         216 AMRARGANVTDIVVLVVAADDGVMPQTLEAIKHAKSANVPIVVAINKIDKPGANPEKVKRELLS-QGIVVEDLGGDVQVI  294 (683)
T ss_pred             HHHHCCCCCCCEEEEEEECCCCCCHHHHHHHHHHHHCCCCEEEEEECCCCCCCCHHHHHHHHHH-CCCCHHHCCCCEEEE
T ss_conf             9986268644479999972677567689999988765997899984367899898999999987-693277707823699


Q ss_pred             HHHHHCCCCCCHHHHHHHHHHHCCCCHHHHHCCCCCCCCCEEECCCCCEEEEEEECCCCCCCCCEEEEECCCCC-CCCCC
Q ss_conf             01110022320067877632100011112201233101210114757259999816987355845887335564-21012
Q gi|254780321|r  167 LVSAKTGEGIPLLLERIVQQLPSPTSPEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAK-YQVER  245 (606)
Q Consensus       167 ~vSAktG~GV~~LLd~Iv~~iP~P~~~~~~~~Pl~alVfds~~D~~~G~I~~~RV~sG~lk~Gd~I~~~~~g~~-~~v~~  245 (606)
                      ++||++|.|++.|.++|+....--.-..+|++|+++.|..|..|+.+|.++++-|..|+|++|+-+..   |+. .++..
T Consensus       295 piSAl~g~nl~~L~eaill~Ae~mdLkA~p~g~~eg~VIES~vdkg~G~~aT~iVkrGTLkKG~vlV~---G~~w~KVr~  371 (683)
T KOG1145         295 PISALTGENLDLLEEAILLLAEVMDLKADPKGPAEGWVIESSVDKGRGPVATVIVKRGTLKKGSVLVA---GKSWCKVRA  371 (683)
T ss_pred             EEECCCCCCHHHHHHHHHHHHHHHHCCCCCCCCCEEEEEEEEECCCCCCEEEEEEECCCCCCCCEEEE---ECHHHHHHH
T ss_conf             86511479868999999999998641168899712899986413775642699995362315658997---021443344


Q ss_pred             CCCCCCCEEEEHHCCCCCHHHHHHCCCCCCCCCCCCEECCCC
Q ss_conf             223355412401012471233220110024444542000466
Q gi|254780321|r  246 IGILTPKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDS  287 (606)
Q Consensus       246 ig~~~~~~~~v~~l~aGdVG~ii~gik~l~~~~vGDTl~~~~  287 (606)
                        .|.-+.++++++.++.-- =|.|.+++-  ..||-+...+
T Consensus       372 --l~D~nGk~i~~A~Ps~pv-~V~GwkdlP--~aGD~vleVe  408 (683)
T KOG1145         372 --LFDHNGKPIDEATPSQPV-EVLGWKDLP--IAGDEVLEVE  408 (683)
T ss_pred             --HHHCCCCCCCCCCCCCCE-EEECCCCCC--CCCCEEEEEE
T ss_conf             --552379792214899834-764246799--8875489971


No 63 
>COG0532 InfB Translation initiation factor 2 (IF-2; GTPase) [Translation, ribosomal structure and biogenesis]
Probab=100.00  E-value=2e-38  Score=277.38  Aligned_cols=209  Identities=33%  Similarity=0.472  Sum_probs=173.7

Q ss_pred             EEEECCCCCCHHHHHHHHHHHCCCCCCCCCCCEEECCCHHHHHHCCEEEEEEEEEEEECCCCCEEEEEEEECCCCCHHHH
Q ss_conf             99980138987788999999829805444431130586779871950523279999743788438999961787300279
Q gi|254780321|r   14 FSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVRLNYTSTDAKDYQLNLIDTPGHVDFTY   93 (606)
Q Consensus        14 ~~IiaHvDhGKTTL~d~lL~~tg~i~~~~~~~~vlD~~~~EreRGITIka~~~~~~~~~~~~~~y~iNlIDTPGH~DF~~   93 (606)
                      ++|+||||||||||.|.+=  ...+..++.+             |||-.--+..+.+..  .+.-.|.|||||||.-|+.
T Consensus         8 VtimGHVDHGKTtLLD~IR--~t~Va~~EaG-------------GITQhIGA~~v~~~~--~~~~~itFiDTPGHeAFt~   70 (509)
T COG0532           8 VTIMGHVDHGKTTLLDKIR--KTNVAAGEAG-------------GITQHIGAYQVPLDV--IKIPGITFIDTPGHEAFTA   70 (509)
T ss_pred             EEEECCCCCCCCCHHHHHH--CCCCCCCCCC-------------CEEEEEEEEEEEECC--CCCCEEEEECCCCHHHHHH
T ss_conf             9996743588420166674--1764356678-------------500174349998646--8865289974895788887


Q ss_pred             HHHHHHHHCCEEEEEEECCCCCCHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCCHHHHHHHHHHHHHHH------HHH
Q ss_conf             99999973026899998687886558999999997099679983267887532113388877555322321------000
Q gi|254780321|r   94 EVSRSLSACEGSLLVVDATQGVEAQTLANVYQAIDNNHEIITVLNKADLPSADPDRVKKQIEETIGISTED------ALL  167 (606)
Q Consensus        94 EV~r~l~a~dgaiLvVdA~~Gvq~QT~~~~~~A~~~~l~~I~viNKiD~~~A~~e~v~~ei~~~~g~~~~~------ii~  167 (606)
                      -..|.-++||-|+|||+|.+|+||||++-...|+..+.|+|+++||||+|.++|+++..|+.+. |+.+++      +++
T Consensus        71 mRaRGa~vtDIaILVVa~dDGv~pQTiEAI~hak~a~vP~iVAiNKiDk~~~np~~v~~el~~~-gl~~E~~gg~v~~Vp  149 (509)
T COG0532          71 MRARGASVTDIAILVVAADDGVMPQTIEAINHAKAAGVPIVVAINKIDKPEANPDKVKQELQEY-GLVPEEWGGDVIFVP  149 (509)
T ss_pred             HHHCCCCCCCEEEEEEECCCCCCHHHHHHHHHHHHCCCCEEEEEECCCCCCCCHHHHHHHHHHC-CCCHHHCCCCEEEEE
T ss_conf             8755775445799999756785661799999998779998999854327998878999988777-988766188149997


Q ss_pred             HHHHCCCCCCHHHHHHHHHHHCCCCHHHHHCCCCCCCCCEEECCCCCEEEEEEECCCCCCCCCEEEEECCCCC
Q ss_conf             1110022320067877632100011112201233101210114757259999816987355845887335564
Q gi|254780321|r  168 VSAKTGEGIPLLLERIVQQLPSPTSPEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAK  240 (606)
Q Consensus       168 vSAktG~GV~~LLd~Iv~~iP~P~~~~~~~~Pl~alVfds~~D~~~G~I~~~RV~sG~lk~Gd~I~~~~~g~~  240 (606)
                      +||++|+|+++||++|.-.----....+++.|.++.|..+--|..+|.++.+-|++|+|+.||.|........
T Consensus       150 vSA~tg~Gi~eLL~~ill~aev~elka~~~~~a~gtviE~~~dkG~G~vatviv~~GtL~~GD~iv~g~~~g~  222 (509)
T COG0532         150 VSAKTGEGIDELLELILLLAEVLELKANPEGPARGTVIEVKLDKGLGPVATVIVQDGTLKKGDIIVAGGEYGR  222 (509)
T ss_pred             EECCCCCCHHHHHHHHHHHHHHHHHHCCCCCCCEEEEEEEEECCCCCCEEEEEEECCEEECCCEEEECCCCCC
T ss_conf             4324787979999999988899864428898724999999862688752899996484744999998378773


No 64 
>COG3276 SelB Selenocysteine-specific translation elongation factor [Translation, ribosomal structure and biogenesis]
Probab=100.00  E-value=7.4e-38  Score=273.62  Aligned_cols=251  Identities=28%  Similarity=0.412  Sum_probs=209.5

Q ss_pred             EEEEECCCCCCHHHHHHHHHHHCCCCCCCCCCCEEECCCHHHHHHCCEEEEEEEEEEEECCCCCEEEEEEEECCCCCHHH
Q ss_conf             79998013898778899999982980544443113058677987195052327999974378843899996178730027
Q gi|254780321|r   13 NFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVRLNYTSTDAKDYQLNLIDTPGHVDFT   92 (606)
Q Consensus        13 N~~IiaHvDhGKTTL~d~lL~~tg~i~~~~~~~~vlD~~~~EreRGITIka~~~~~~~~~~~~~~y~iNlIDTPGH~DF~   92 (606)
                      +|+..||||||||||..++   ||..         .|..++|++|||||     .+.|.+.+-.+|.+.|||+|||.||.
T Consensus         2 ii~t~GhidHgkT~L~~al---tg~~---------~d~l~EekKRG~Ti-----Dlg~~y~~~~d~~~~fIDvpgh~~~i   64 (447)
T COG3276           2 IIGTAGHIDHGKTTLLKAL---TGGV---------TDRLPEEKKRGITI-----DLGFYYRKLEDGVMGFIDVPGHPDFI   64 (447)
T ss_pred             EEEEEEEEECCCHHHHHHH---CCCC---------CCCCHHHHHCCCEE-----EEEEEECCCCCCCEEEEECCCCHHHH
T ss_conf             6997400201430223330---2553---------32054566158468-----42057325777736886189847889


Q ss_pred             HHHHHHHHHCCEEEEEEECCCCCCHHHHHHHHHHHHCCCC-EEEEECCCCCCC-CCCCCHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             9999999730268999986878865589999999970996-799832678875-32113388877555322321000111
Q gi|254780321|r   93 YEVSRSLSACEGSLLVVDATQGVEAQTLANVYQAIDNNHE-IITVLNKADLPS-ADPDRVKKQIEETIGISTEDALLVSA  170 (606)
Q Consensus        93 ~EV~r~l~a~dgaiLvVdA~~Gvq~QT~~~~~~A~~~~l~-~I~viNKiD~~~-A~~e~v~~ei~~~~g~~~~~ii~vSA  170 (606)
                      .-...++...|.|+|||+|.+|+++||.+|+......|++ .|+|++|+|+.+ ++.+.+.++|...+.+....++++||
T Consensus        65 ~~miag~~~~d~alLvV~~deGl~~qtgEhL~iLdllgi~~giivltk~D~~d~~r~e~~i~~Il~~l~l~~~~i~~~s~  144 (447)
T COG3276          65 SNLLAGLGGIDYALLVVAADEGLMAQTGEHLLILDLLGIKNGIIVLTKADRVDEARIEQKIKQILADLSLANAKIFKTSA  144 (447)
T ss_pred             HHHHHHHCCCCEEEEEEECCCCCCHHHHHHHHHHHHCCCCCEEEEEECCCCCCHHHHHHHHHHHHHHCCCCCCCCCCCCC
T ss_conf             99985405774589998475576643688999998619873289996223446788999999998650200032301101


Q ss_pred             HCCCCCCHHHHHHHHHHHCCCCHHHHHCCCCCCCCCEEEC-CCCCEEEEEEECCCCCCCCCEEEEECCCCCCCCCCCCCC
Q ss_conf             0022320067877632100011112201233101210114-757259999816987355845887335564210122233
Q gi|254780321|r  171 KTGEGIPLLLERIVQQLPSPTSPEGANAPLKALLIDSWYN-SYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVERIGIL  249 (606)
Q Consensus       171 ktG~GV~~LLd~Iv~~iP~P~~~~~~~~Pl~alVfds~~D-~~~G~I~~~RV~sG~lk~Gd~I~~~~~g~~~~v~~ig~~  249 (606)
                      ++|.||++|=+.|.+..-.+  ..+.+.||+..| |..|. ...|.|++|.++||+++.||++++.+.|+..+|..+.. 
T Consensus       145 ~~g~Gi~~Lk~~l~~L~~~~--e~d~~~~fri~I-DraFtVKGvGTVVtGtv~sG~V~v~D~L~l~p~~k~v~VRsIq~-  220 (447)
T COG3276         145 KTGRGIEELKNELIDLLEEI--ERDEQKPFRIAI-DRAFTVKGVGTVVTGTVLSGEVKVGDKLYLSPINKEVRVRSIQA-  220 (447)
T ss_pred             CCCCCHHHHHHHHHHHHHHH--HHCCCCCEEEEE-EEEEEECCCCEEEEEEEEEEEEEECCEEEEECCCCEEEEEEEEE-
T ss_conf             25787799999998752005--540478659997-55799513317998678643588788899905897689986320-


Q ss_pred             CCCEEEEHHCCCCC-HHHHHHCCCCCCCCCCCCEECCCC
Q ss_conf             55412401012471-233220110024444542000466
Q gi|254780321|r  250 TPKMIDIEALYPGE-IGVMIASIKEVSHTRVGDTITDDS  287 (606)
Q Consensus       250 ~~~~~~v~~l~aGd-VG~ii~gik~l~~~~vGDTl~~~~  287 (606)
                        +.++++++.||+ ||....|+ ..+++.-||.|.+++
T Consensus       221 --~d~d~~~a~AG~RVglaL~~v-~~eei~RG~~L~~~~  256 (447)
T COG3276         221 --HDVDVEEAKAGQRVGLALKGV-EKEEIERGDWLLKPE  256 (447)
T ss_pred             --CCCCHHHCCCCCEEEEECCCC-CHHHHHCCCEECCCC
T ss_conf             --686455501225145423788-778851122751577


No 65 
>COG2895 CysN GTPases - Sulfate adenylate transferase subunit 1 [Inorganic ion transport and metabolism]
Probab=100.00  E-value=3.8e-37  Score=268.84  Aligned_cols=290  Identities=23%  Similarity=0.343  Sum_probs=212.6

Q ss_pred             CEEEEEECCCCCCHHHHHHHHHHHCCCCCCC-------CC---CC--------EEECCCHHHHHHCCEEEEEEEEEEEEC
Q ss_conf             3179998013898778899999982980544-------44---31--------130586779871950523279999743
Q gi|254780321|r   11 IRNFSIVAHIDHGKSTLADRFIQHCRGLTER-------EM---SS--------QVLDNMDIERERGITIKAQTVRLNYTS   72 (606)
Q Consensus        11 IRN~~IiaHvDhGKTTL~d~lL~~tg~i~~~-------~~---~~--------~vlD~~~~EreRGITIka~~~~~~~~~   72 (606)
                      .-+|.-.||||+|||||..||||.|..+-+.       ++   +.        -++|.++.|||.||||   .+...|+.
T Consensus         6 lLRfiTcGSVDDGKSTLIGRLL~Dtk~i~eDQla~l~~dS~~~~t~g~~~D~ALLvDGL~AEREQGITI---DVAYRyFs   82 (431)
T COG2895           6 LLRFITCGSVDDGKSTLIGRLLYDTKAIYEDQLASLERDSKRKGTQGEKIDLALLVDGLEAEREQGITI---DVAYRYFS   82 (431)
T ss_pred             CEEEEEECCCCCCCHHHHHHHHHCCHHHHHHHHHHHHCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCEE---EEEEEECC
T ss_conf             136897535368602324465531011057799987521312367787545256332568888649659---98764103


Q ss_pred             CCCCEEEEEEEECCCCCHHHHHHHHHHHHCCEEEEEEECCCCCCHHHHHHHHHHHHCCCC-EEEEECCCCCCCCCCCCHH
Q ss_conf             788438999961787300279999999730268999986878865589999999970996-7998326788753211338
Q gi|254780321|r   73 TDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQAIDNNHE-IITVLNKADLPSADPDRVK  151 (606)
Q Consensus        73 ~~~~~y~iNlIDTPGH~DF~~EV~r~l~a~dgaiLvVdA~~Gvq~QT~~~~~~A~~~~l~-~I~viNKiD~~~A~~e~v~  151 (606)
                      .+.++  +=+.|||||.-|.--.--.-+-||.|+|+|||.+|++.||+.|.+.+...|++ +++.+||||+.+-+-+ +.
T Consensus        83 T~KRk--FIiADTPGHeQYTRNMaTGASTadlAIlLVDAR~Gvl~QTrRHs~I~sLLGIrhvvvAVNKmDLvdy~e~-~F  159 (431)
T COG2895          83 TEKRK--FIIADTPGHEQYTRNMATGASTADLAILLVDARKGVLEQTRRHSFIASLLGIRHVVVAVNKMDLVDYSEE-VF  159 (431)
T ss_pred             CCCCE--EEEECCCCHHHHHHHHHCCCCCCCEEEEEEECCHHHHHHHHHHHHHHHHHCCCEEEEEEEEECCCCCCHH-HH
T ss_conf             66630--8984599679876422236230037999996422167776778999997287679999741012356789-99


Q ss_pred             HHHH-------HHHHHHHHHHHHHHHHCCCCC------------CHHHHHHHHHHHCCCCHHHHHCCCCCCCCCEE--EC
Q ss_conf             8877-------555322321000111002232------------00678776321000111122012331012101--14
Q gi|254780321|r  152 KQIE-------ETIGISTEDALLVSAKTGEGI------------PLLLERIVQQLPSPTSPEGANAPLKALLIDSW--YN  210 (606)
Q Consensus       152 ~ei~-------~~~g~~~~~ii~vSAktG~GV------------~~LLd~Iv~~iP~P~~~~~~~~Pl~alVfds~--~D  210 (606)
                      ++|.       .-+|+.....+|+||..|.||            ..||+. .+.+..-.  .....|||..|-...  -+
T Consensus       160 ~~I~~dy~~fa~~L~~~~~~~IPiSAl~GDNV~~~s~~mpWY~GptLLe~-LE~v~i~~--~~~~~~~RfPVQ~V~Rp~~  236 (431)
T COG2895         160 EAIVADYLAFAAQLGLKDVRFIPISALLGDNVVSKSENMPWYKGPTLLEI-LETVEIAD--DRSAKAFRFPVQYVNRPNL  236 (431)
T ss_pred             HHHHHHHHHHHHHCCCCCCEEEECHHHCCCCCCCCCCCCCCCCCCCHHHH-HHHCCCCC--CCCCCCEEECEEEECCCCC
T ss_conf             99999999999976998524774323048753346567886468509999-74122345--5436650102288617897


Q ss_pred             CCCCEEEEEEECCCCCCCCCEEEEECCCCCCCCCCCCCCCCCEEEEHHCCCCCHHHHHHCCCCCCCCCCCCEECCCCCCC
Q ss_conf             75725999981698735584588733556421012223355412401012471233220110024444542000466785
Q gi|254780321|r  211 SYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVERIGILTPKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPT  290 (606)
Q Consensus       211 ~~~G~I~~~RV~sG~lk~Gd~I~~~~~g~~~~v~~ig~~~~~~~~v~~l~aGdVG~ii~gik~l~~~~vGDTl~~~~~p~  290 (606)
                      .|||-  -|+|.||++++||+|.+.++|++.+|.+|-.+.   -+.+++.||+.  +...+.+--++..||.|+..+.+.
T Consensus       237 dfRGy--aGtiasG~v~~Gd~vvvlPsG~~s~V~~Ivt~d---g~~~~A~aG~a--Vtl~L~deidisRGd~i~~~~~~~  309 (431)
T COG2895         237 DFRGY--AGTIASGSVKVGDEVVVLPSGKTSRVKRIVTFD---GELAQASAGEA--VTLVLADEIDISRGDLIVAADAPP  309 (431)
T ss_pred             CCCCC--CEEEECCCEECCCEEEECCCCCEEEEEEEECCC---CCHHHCCCCCE--EEEEECCEEECCCCCEEECCCCCC
T ss_conf             62100--304403514059748994589703579996468---71654168842--899980002002573787068985


Q ss_pred             CCCCCCCCCCCCEEEEEECCCCHHHHHHH
Q ss_conf             32364552222126642126770245788
Q gi|254780321|r  291 TSALPGFKPIQPVVFCGLFPVDATQFENL  319 (606)
Q Consensus       291 ~~~Lp~~~~~~P~v~~~i~p~~~~d~~~L  319 (606)
                         .+.-++..-+|+|+-.|..++.--.|
T Consensus       310 ---~~~~~f~A~vvWm~~~pl~pGr~Y~l  335 (431)
T COG2895         310 ---AVADAFDADVVWMDEEPLLPGRSYDL  335 (431)
T ss_pred             ---CHHHHCCEEEEEECCCCCCCCCEEEE
T ss_conf             ---52232160699843777788846888


No 66 
>TIGR02034 CysN sulfate adenylyltransferase, large subunit; InterPro: IPR011779    Metabolic assimilation of sulphur from inorganic sulphate, requires sulphate activation by coupling to a nucleoside, for the production of high-energy nucleoside phosphosulphates. This pathway appears to be similar in all prokaryotic organisms. Activation is first achieved through sulphation of sulphate with ATP by sulphate adenylyltransferase (ATP sulphurylase) to produce 5'-phosphosulphate (APS), coupled by GTP hydrolysis. Subsequently, APS is phosphorylated by an APS kinase to produce 3'-phosphoadenosine-5'-phosphosulphate (PAPS) . In Escherichia coli, ATP sulphurylase is a heterodimer composed of two subunits encoded by cysD and cysN, with APS kinase encoded by cysC. These genes are located in a unidirectionally transcribed gene cluster, and have been shown to be required for the synthesis of sulphur-containing amino acids . Homologous to this E. coli activation pathway are nodPQH gene products found among members of the Rhizobiaceae family. These gene products have been shown to exhibit ATP sulphurase and APS kinase activity, yet are involved in Nod factor sulphation, and sulphation of other macromolecules . With members of the Rhizobiaceae family, nodQ often appears as a fusion of cysN (large subunit of ATP sulphurase) and cysC (APS kinase) , .; GO: 0016772 transferase activity transferring phosphorus-containing groups.
Probab=100.00  E-value=1e-37  Score=272.68  Aligned_cols=286  Identities=24%  Similarity=0.366  Sum_probs=209.1

Q ss_pred             EEEECCCCCCHHHHHHHHHHHCCCCCCC-------CC---CC--------EEECCCHHHHHHCCEEEEEEEEEEEECCCC
Q ss_conf             9998013898778899999982980544-------44---31--------130586779871950523279999743788
Q gi|254780321|r   14 FSIVAHIDHGKSTLADRFIQHCRGLTER-------EM---SS--------QVLDNMDIERERGITIKAQTVRLNYTSTDA   75 (606)
Q Consensus        14 ~~IiaHvDhGKTTL~d~lL~~tg~i~~~-------~~---~~--------~vlD~~~~EreRGITIka~~~~~~~~~~~~   75 (606)
                      |+-.|=||-|||||..|||+.|+.|.+-       ++   +.        =++|.++-|||.||||   -|+..|+.++.
T Consensus         3 flTCGSVDDGKSTLIGRLLhDtK~i~eDQL~~l~~DS~~~G~~G~~iD~ALLVDGL~AEREQGITI---DVAYRYFsT~K   79 (411)
T TIGR02034         3 FLTCGSVDDGKSTLIGRLLHDTKQIYEDQLAALERDSKKHGTQGEEIDLALLVDGLQAEREQGITI---DVAYRYFSTDK   79 (411)
T ss_pred             EEECCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHHHHHHHHHCCCEE---EEEECCCCCCC
T ss_conf             352054458731022222555521689999998852255347887652341330677443248612---13313257787


Q ss_pred             CEEEEEEEECCCCCHHHHHHHHHHHHCCEEEEEEECCCCCCHHHHHHHHHHHHCCCC-EEEEECCCCCCCCCCCCHHHHH
Q ss_conf             438999961787300279999999730268999986878865589999999970996-7998326788753211338887
Q gi|254780321|r   76 KDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQAIDNNHE-IITVLNKADLPSADPDRVKKQI  154 (606)
Q Consensus        76 ~~y~iNlIDTPGH~DF~~EV~r~l~a~dgaiLvVdA~~Gvq~QT~~~~~~A~~~~l~-~I~viNKiD~~~A~~e~v~~ei  154 (606)
                      ++|.  +=|||||.=++=-.--.-+-||-|||+|||.+|+..||+.|.+.|-.+|++ +|++||||||.+-+ ++|-++|
T Consensus        80 RkFI--vADTPGHEQYTRNMATGAST~dlAvlLvDAR~Gvl~QTRRHs~i~sLLGIrh~VlAVNKmDLvdyd-~~vF~~I  156 (411)
T TIGR02034        80 RKFI--VADTPGHEQYTRNMATGASTADLAVLLVDARKGVLEQTRRHSYIASLLGIRHVVLAVNKMDLVDYD-EEVFENI  156 (411)
T ss_pred             CCEE--EECCCCCCCCCCCCCHHCCCCCEEEEEEEHHHHHHHHHHHHHHHHHHHCCCEEEEEEECCCCCCCC-HHHHHHH
T ss_conf             6178--840855941544300001311246655421021345677999998860453899999701114765-7889999


Q ss_pred             HH-------HH-HHHHHHHHHHHHHCCCCCC-H------------HHHHHHHHHHCCCCHHHHHCCCCCCCCCEE--EC-
Q ss_conf             75-------55-3223210001110022320-0------------678776321000111122012331012101--14-
Q gi|254780321|r  155 EE-------TI-GISTEDALLVSAKTGEGIP-L------------LLERIVQQLPSPTSPEGANAPLKALLIDSW--YN-  210 (606)
Q Consensus       155 ~~-------~~-g~~~~~ii~vSAktG~GV~-~------------LLd~Iv~~iP~P~~~~~~~~Pl~alVfds~--~D-  210 (606)
                      ++       -+ |+..-.+||.||+.|.||- .            ||+. .|.+.--.+ .-.+.|||.+|--..  .- 
T Consensus       157 ~~~y~~fa~~L~g~~~~~~iP~SAL~GdNv~y~~S~~MpWY~GPtLle~-LEtv~~~~G-~~~~~~lRfPVQyVnRPn~t  234 (411)
T TIGR02034       157 KKDYLAFAEQLAGVRDVTFIPLSALKGDNVVYSRSESMPWYSGPTLLEH-LETVEVERG-DAQDLPLRFPVQYVNRPNLT  234 (411)
T ss_pred             HHHHHHHHHHCCCCCEEEEEEEECCCCCCEEECCCCCCCCCCCCCHHHH-CCCCCCCCC-CCCCCCCEEEEEEEECCCCC
T ss_conf             9999999986389834799873313687402256678887578806530-040000367-42247872004565268886


Q ss_pred             CCCCEEEEEEECCCCCCCCCEEEEECCCCCCCCCCCCCCCCCEEEEHHCCCCCHHHHHHCCCCCCCCCCCCEECCCCCCC
Q ss_conf             75725999981698735584588733556421012223355412401012471233220110024444542000466785
Q gi|254780321|r  211 SYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVERIGILTPKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPT  290 (606)
Q Consensus       211 ~~~G~I~~~RV~sG~lk~Gd~I~~~~~g~~~~v~~ig~~~~~~~~v~~l~aGdVG~ii~gik~l~~~~vGDTl~~~~~p~  290 (606)
                      .|||=  -|-|.||++++||+|++.++|.+.+|.+|-.|.+   ++++|.|||  +|+..+++-=|+.-||-|...+.+ 
T Consensus       235 dFRGy--aGt~asG~v~~Gd~v~vlPSG~~srV~rIVt~dg---~l~~A~aG~--AvTL~L~~eiDisRGDll~~~D~~-  306 (411)
T TIGR02034       235 DFRGY--AGTIASGSVKVGDEVVVLPSGRSSRVARIVTFDG---DLEQAVAGQ--AVTLVLDDEIDISRGDLLAAADSA-  306 (411)
T ss_pred             CCCCH--HHHEECCEECCCCEEEEEECCCEEEEEEEEECCC---CHHHCCCCC--EEEEEEECEEEEECCHHHHCCCCC-
T ss_conf             66522--2310225534598899962796443558870465---330066875--389986000433200221224677-


Q ss_pred             CCCCCCCCCCCCEEEEEECCCCHHHHH
Q ss_conf             323645522221266421267702457
Q gi|254780321|r  291 TSALPGFKPIQPVVFCGLFPVDATQFE  317 (606)
Q Consensus       291 ~~~Lp~~~~~~P~v~~~i~p~~~~d~~  317 (606)
                        |-+.-++.--.|+|.=.|..++.--
T Consensus       307 --p~~~~~F~a~lVWm~~~~l~PG~~Y  331 (411)
T TIGR02034       307 --PEVADQFAATLVWMADEPLLPGRSY  331 (411)
T ss_pred             --CCCCHHHEEEEEEECCCCCCCCCEE
T ss_conf             --8701200125662011345889537


No 67 
>TIGR00485 EF-Tu translation elongation factor Tu; InterPro: IPR004541   Translation elongation factors are responsible for two main processes during protein synthesis on the ribosome , , . EF1A (or EF-Tu) is responsible for the selection and binding of the cognate aminoacyl-tRNA to the A-site (acceptor site) of the ribosome. EF2 (or EF-G) is responsible for the translocation of the peptidyl-tRNA from the A-site to the P-site (peptidyl-tRNA site) of the ribosome, thereby freeing the A-site for the next aminoacyl-tRNA to bind. Elongation factors are responsible for achieving accuracy of translation and both EF1A and EF2 are remarkably conserved throughout evolution.   EF1A (also known as EF-1alpha or EF-Tu) is a G-protein. It forms a ternary complex of EF1A-GTP-aminoacyltRNA. The binding of aminoacyl-tRNA stimulates GTP hydrolysis by EF1A, causing a conformational change in EF1A that causes EF1A-GDP to detach from the ribosome, leaving the aminoacyl-tRNA attached at the A-site. Only the cognate aminoacyl-tRNA can induce the required conformational change in EF1A through its tight anticodon-codon binding , . EF1A-GDP is returned to its active state, EF1A-GTP, through the action of another elongation factor, EF1B (also known as EF-Ts or EF-1beta/gamma/delta).   This entry represents EF1A (or EF-Tu) proteins found primarily in bacteria, mitochondria and chloroplasts. Eukaryotic and archaeal EF1A (IPR004539 from INTERPRO) are excluded from this entry. When bound to GTP, EF-Tu can form a complex with any (correctly) aminoacylated tRNA except those for initiation and for selenocysteine, in which case EF-Tu is replaced by other factors .   More information about these proteins can be found at Protein of the Month: Elongation Factors .; GO: 0003746 translation elongation factor activity, 0005525 GTP binding, 0006414 translational elongation, 0005622 intracellular.
Probab=100.00  E-value=4.8e-36  Score=261.45  Aligned_cols=270  Identities=23%  Similarity=0.376  Sum_probs=205.6

Q ss_pred             HCEEEEEECCCCCCHHHHHHHHHHHCCCCCCCCC-CCEEECCCHHHHHHCCEEEEEEEEEEEECCCCCEEEEEEEECCCC
Q ss_conf             5317999801389877889999998298054444-311305867798719505232799997437884389999617873
Q gi|254780321|r   10 RIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREM-SSQVLDNMDIERERGITIKAQTVRLNYTSTDAKDYQLNLIDTPGH   88 (606)
Q Consensus        10 ~IRN~~IiaHvDhGKTTL~d~lL~~tg~i~~~~~-~~~vlD~~~~EreRGITIka~~~~~~~~~~~~~~y~iNlIDTPGH   88 (606)
                      .--|++.|||+|||||||+-++-.....-..... .-.-.|..|+|++|||||  ++..+.|... .+.|  .-+|||||
T Consensus        11 ~h~n~GtiGhvdhGkttl~aa~~~~l~~~~~~~~~~y~~id~aPee~~rGiti--~~~~vey~~~-~rhy--ahvdCPGh   85 (394)
T TIGR00485        11 PHVNIGTIGHVDHGKTTLTAAITTVLAKEGKAAAKKYDEIDKAPEEKARGITI--NTAHVEYETE-KRHY--AHVDCPGH   85 (394)
T ss_pred             CEEEEEEEEECCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHCCEEE--EEEEEEECCC-CCCE--EEECCCCH
T ss_conf             70333012100155057899999998751003567677652372113345156--5335542146-7515--76318862


Q ss_pred             CHHHHHHHHHHHHCCEEEEEEECCCCCCHHHHHHHHHHHHCCCC-EEEEECCCCCCCCC--CCCHHHHHHHHH---HHHH
Q ss_conf             00279999999730268999986878865589999999970996-79983267887532--113388877555---3223
Q gi|254780321|r   89 VDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQAIDNNHE-IITVLNKADLPSAD--PDRVKKQIEETI---GIST  162 (606)
Q Consensus        89 ~DF~~EV~r~l~a~dgaiLvVdA~~Gvq~QT~~~~~~A~~~~l~-~I~viNKiD~~~A~--~e~v~~ei~~~~---g~~~  162 (606)
                      +||.-.....-+-.|||+|||+|.+|++|||++|..+|.+.|+| +++|+||.|..+.+  .+-|..|+.+++   +++.
T Consensus        86 adyvknmitGaaqmdGailvv~~~d~~mPqt~ehill~~~vGvP~~vvflnk~d~~~~~el~~lv~~e~~~ll~~~~f~G  165 (394)
T TIGR00485        86 ADYVKNMITGAAQMDGAILVVSAADGPMPQTREHILLARQVGVPKIVVFLNKVDMVDDEELLELVELEVRELLSEYDFPG  165 (394)
T ss_pred             HHHHHHHHHHHHHCCCEEEEEECCCCCCCCCHHHEEEECCCCCCEEEEEEECCCCCCHHHHHHHHHHHHHHHHHHCCCCC
T ss_conf             67888764101111760799952788887411210010026876578764023322427899999999999987407898


Q ss_pred             HH--HHHHHHHCCC--------CCCHHHHHHHHHHHCCCCHHHHHCCCCCCCCCEEECCCCCEEEEEEECCCCCCCCCEE
Q ss_conf             21--0001110022--------3200678776321000111122012331012101147572599998169873558458
Q gi|254780321|r  163 ED--ALLVSAKTGE--------GIPLLLERIVQQLPSPTSPEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSI  232 (606)
Q Consensus       163 ~~--ii~vSAktG~--------GV~~LLd~Iv~~iP~P~~~~~~~~Pl~alVfds~~D~~~G~I~~~RV~sG~lk~Gd~I  232 (606)
                      ++  ++..||....        -|.+|++.+-+++|.|.  +..+.||-+.|-|.+.-..||.++.+||..|.++.|++|
T Consensus       166 ~~~Pi~~Gsal~al~~~~~~~~~~~~l~~~vd~~i~~P~--r~~~~~fl~~~ed~~~i~GrGtv~tGr~e~G~~~v~~~v  243 (394)
T TIGR00485       166 DDVPIVRGSALKALEGDAEWEEKILELMEAVDEYIPTPE--REVDKPFLLPIEDVFSITGRGTVVTGRVERGVVKVGEEV  243 (394)
T ss_pred             CCCCEEECHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCC--HHHCCCEEEEEEEEEEEECCCEEEEEEEEECEEEECCEE
T ss_conf             652256114565420036799999999999986506751--131441145531046750463478502430447644647


Q ss_pred             EEECCCCCCCCCCCCCCCCCEEEEHHCCCCC-HHHHHHCCCCCCCCCCCCEECCCCC
Q ss_conf             8733556421012223355412401012471-2332201100244445420004667
Q gi|254780321|r  233 RLMGTNAKYQVERIGILTPKMIDIEALYPGE-IGVMIASIKEVSHTRVGDTITDDSS  288 (606)
Q Consensus       233 ~~~~~g~~~~v~~ig~~~~~~~~v~~l~aGd-VG~ii~gik~l~~~~vGDTl~~~~~  288 (606)
                      .++.-....+..-.|+ .+.++..++..||| +|.+..|++ -.++..|..|+.+..
T Consensus       244 ~~~G~~~~~~~~vtGv-emf~k~l~~~~aG~n~G~llrG~~-~~~~~rG~v~~~P~~  298 (394)
T TIGR00485       244 EIVGLKDTKKTTVTGV-EMFRKELDEGEAGDNVGLLLRGIK-KEEIERGMVLAKPGS  298 (394)
T ss_pred             EEEEEECCCCEEEHHH-HHHHHHHHCCCCCCCEEEEEECCC-HHHCCCCEEEECCCC
T ss_conf             9987402454022147-888887411335542010110453-121015637843763


No 68 
>cd04171 SelB SelB subfamily.  SelB is an elongation factor needed for the co-translational incorporation of selenocysteine.  Selenocysteine is coded by a UGA stop codon in combination with a specific downstream mRNA hairpin.  In bacteria, the C-terminal part of SelB recognizes this hairpin, while the N-terminal part binds GTP and tRNA in analogy with elongation factor Tu (EF-Tu).  It specifically recognizes the selenocysteine charged tRNAsec, which has a UCA anticodon, in an EF-Tu like manner. This allows insertion of selenocysteine at in-frame UGA stop codons.  In E. coli SelB binds GTP, selenocysteyl-tRNAsec, and a stem-loop structure immediately downstream of the UGA codon (the SECIS sequence).  The absence of active SelB prevents the participation of selenocysteyl-tRNAsec in translation.  Archaeal and animal mechanisms of selenocysteine incorporation are more complex.  Although the SECIS elements have different secondary structures and conserved elements between archaea and eukaryo
Probab=100.00  E-value=2.1e-34  Score=250.42  Aligned_cols=156  Identities=33%  Similarity=0.395  Sum_probs=131.2

Q ss_pred             EEEECCCCCCHHHHHHHHHHHCCCCCCCCCCCEEECCCHHHHHHCCEEEEEEEEEEEECCCCCEEEEEEEECCCCCHHHH
Q ss_conf             99980138987788999999829805444431130586779871950523279999743788438999961787300279
Q gi|254780321|r   14 FSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVRLNYTSTDAKDYQLNLIDTPGHVDFTY   93 (606)
Q Consensus        14 ~~IiaHvDhGKTTL~d~lL~~tg~i~~~~~~~~vlD~~~~EreRGITIka~~~~~~~~~~~~~~y~iNlIDTPGH~DF~~   93 (606)
                      +||+||+|||||||.++|   +|.         -.|.++.|++|||||......+.|.    .++.++|||||||.+|..
T Consensus         3 VaivG~~n~GKSTL~n~L---~g~---------~~d~~~~e~~~giTi~~~~~~~~~~----~~~~i~~iDtPGh~~~~~   66 (164)
T cd04171           3 IGTAGHIDHGKTTLIKAL---TGI---------ETDRLPEEKKRGITIDLGFAYLDLP----SGKRLGFIDVPGHEKFIK   66 (164)
T ss_pred             EEEECCCCCCHHHHHHHH---HCC---------CCCCCHHHHCCCEEEEEEEEEEECC----CCCEEEEEECCCHHHHHH
T ss_conf             999926887299999998---496---------4663333334863798546878648----998999994878799999


Q ss_pred             HHHHHHHHCCEEEEEEECCCCCCHHHHHHHHHHHHCCCC-EEEEECCCCCCCCC-CCCHHHHHHHHH---HHHHHHHHHH
Q ss_conf             999999730268999986878865589999999970996-79983267887532-113388877555---3223210001
Q gi|254780321|r   94 EVSRSLSACEGSLLVVDATQGVEAQTLANVYQAIDNNHE-IITVLNKADLPSAD-PDRVKKQIEETI---GISTEDALLV  168 (606)
Q Consensus        94 EV~r~l~a~dgaiLvVdA~~Gvq~QT~~~~~~A~~~~l~-~I~viNKiD~~~A~-~e~v~~ei~~~~---g~~~~~ii~v  168 (606)
                      ++.+++..+|.|+|||||.+|+++||++++..+...+++ +|+|+||||+...+ .+.+.+|+++.+   ++....++++
T Consensus        67 ~~~~~~~~aD~~llVvda~~g~~~q~~e~~~~~~~~~i~~~ivvlNK~D~v~~~~~~~~~~~i~~~l~~~~~~~~pii~i  146 (164)
T cd04171          67 NMLAGAGGIDLVLLVVAADEGIMPQTREHLEILELLGIKRGLVVLTKADLVDEDWLELVEEEIRELLAGTFLADAPIFPV  146 (164)
T ss_pred             HHHHHHHHCCEEEEEEECCCCCCHHHHHHHHHHHHCCCCCEEEEEECCCCCCHHHHHHHHHHHHHHHHHCCCCCCEEEEE
T ss_conf             99998742672589986177888889999999987388727873463425797899999999999997439999829994


Q ss_pred             HHHCCCCCCHHHHHHHH
Q ss_conf             11002232006787763
Q gi|254780321|r  169 SAKTGEGIPLLLERIVQ  185 (606)
Q Consensus       169 SAktG~GV~~LLd~Iv~  185 (606)
                      ||++|.||++|+++|.+
T Consensus       147 SA~tG~Gi~eL~~~I~e  163 (164)
T cd04171         147 SAVTGEGIEELKEYLDE  163 (164)
T ss_pred             ECCCCCCHHHHHHHHHH
T ss_conf             69898299999999984


No 69 
>cd01887 IF2_eIF5B IF2/eIF5B (initiation factors 2/ eukaryotic initiation factor 5B) subfamily.  IF2/eIF5B contribute to ribosomal subunit joining and function as GTPases that are maximally activated by the presence of both ribosomal subunits.  As seen in other GTPases, IF2/IF5B undergoes conformational changes between its GTP- and GDP-bound states.  Eukaryotic IF2/eIF5Bs possess three characteristic segments, including a divergent N-terminal region followed by conserved central and C-terminal segments.  This core region is conserved among all known eukaryotic and archaeal IF2/eIF5Bs and eubacterial IF2s.
Probab=100.00  E-value=1.3e-32  Score=238.37  Aligned_cols=157  Identities=36%  Similarity=0.448  Sum_probs=128.6

Q ss_pred             EEEEECCCCCCHHHHHHHHHHHCCCCCCCCCCCEEECCCHHHHHHCCEEEEEEEEEEEECCCCCEEEEEEEECCCCCHHH
Q ss_conf             79998013898778899999982980544443113058677987195052327999974378843899996178730027
Q gi|254780321|r   13 NFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVRLNYTSTDAKDYQLNLIDTPGHVDFT   92 (606)
Q Consensus        13 N~~IiaHvDhGKTTL~d~lL~~tg~i~~~~~~~~vlD~~~~EreRGITIka~~~~~~~~~~~~~~y~iNlIDTPGH~DF~   92 (606)
                      -+||+||+|||||||.++|.   |.  +..          .+..+|+|..-......+.  .+..+.++|||||||.+|+
T Consensus         2 ~VaivG~~n~GKSTL~n~L~---~~--~~~----------~~~~~g~T~~i~~~~~~~~--~~~~~~i~~iDTPGh~~f~   64 (168)
T cd01887           2 VVTVMGHVDHGKTTLLDKIR---KT--NVA----------AGEAGGITQHIGAFEVPAE--VLKIPGITFIDTPGHEAFT   64 (168)
T ss_pred             EEEEEECCCCCHHHHHHHHH---CC--CCC----------EEECCCCEEEECEEEEEEE--ECCCCEEEEEECCCCHHHH
T ss_conf             89999489985989999985---86--750----------4516981687153999988--2588718999899816779


Q ss_pred             HHHHHHHHHCCEEEEEEECCCCCCHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCCHHHHHHHHHHH------HHHHHH
Q ss_conf             99999997302689999868788655899999999709967998326788753211338887755532------232100
Q gi|254780321|r   93 YEVSRSLSACEGSLLVVDATQGVEAQTLANVYQAIDNNHEIITVLNKADLPSADPDRVKKQIEETIGI------STEDAL  166 (606)
Q Consensus        93 ~EV~r~l~a~dgaiLvVdA~~Gvq~QT~~~~~~A~~~~l~~I~viNKiD~~~A~~e~v~~ei~~~~g~------~~~~ii  166 (606)
                      ...+|+++.+|.++|||||.+|+++||++++..+.+.++|+|+|+||||+++++++++..++.++...      ...+++
T Consensus        65 ~~~~~~~~~aD~~ilvvda~~g~~~~~~~~~~~l~~~~~p~ivviNKiD~~~~~~~~v~~~l~~~~~~~~~~~~~~~~iI  144 (168)
T cd01887          65 NMRARGASLTDIAILVVAADDGVMPQTIEAIKLAKAANVPFIVALNKIDKPNANPERVKNELSELGLQGEDEWGGDVQIV  144 (168)
T ss_pred             HHHHHHHHHCCEEEEEEECCCCCCHHHHHHHHHHHHCCCCEEEEEECCCCCCCCHHHHHHHHHHHHCCCHHHCCCCCEEE
T ss_conf             99999986268899998646675458999999998769978999989308987989999999997545245528987599


Q ss_pred             HHHHHCCCCCCHHHHHHHHH
Q ss_conf             01110022320067877632
Q gi|254780321|r  167 LVSAKTGEGIPLLLERIVQQ  186 (606)
Q Consensus       167 ~vSAktG~GV~~LLd~Iv~~  186 (606)
                      |+||++|.|+++|+++|+..
T Consensus       145 pvSA~tG~gi~~L~~~i~~~  164 (168)
T cd01887         145 PTSAKTGEGIDDLLEAILLL  164 (168)
T ss_pred             EEECCCCCCHHHHHHHHHHH
T ss_conf             99899998999999999999


No 70 
>COG5257 GCD11 Translation initiation factor 2, gamma subunit (eIF-2gamma; GTPase) [Translation, ribosomal structure and biogenesis]
Probab=100.00  E-value=2.9e-32  Score=236.05  Aligned_cols=238  Identities=27%  Similarity=0.362  Sum_probs=170.0

Q ss_pred             HCEEEEEECCCCCCHHHHHHHHHHHCCCCCCCCCCCEEECCCHHHHHHCCEEEEEEEEEEEEC-----------------
Q ss_conf             531799980138987788999999829805444431130586779871950523279999743-----------------
Q gi|254780321|r   10 RIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVRLNYTS-----------------   72 (606)
Q Consensus        10 ~IRN~~IiaHvDhGKTTL~d~lL~~tg~i~~~~~~~~vlD~~~~EreRGITIka~~~~~~~~~-----------------   72 (606)
                      -=-||+.+||||||||||+-+|   ||..+         |...+|-+||||||.--+......                 
T Consensus         9 p~vNIG~vGHVdHGKtTlv~Al---sGvwT---------~~hseElkRgitIkLGYAd~~i~kC~~c~~~~~y~~~~~C~   76 (415)
T COG5257           9 PEVNIGMVGHVDHGKTTLTKAL---SGVWT---------DRHSEELKRGITIKLGYADAKIYKCPECYRPECYTTEPKCP   76 (415)
T ss_pred             CCEEEEEEEECCCCHHHHEEHH---HCEEE---------ECHHHHHHCCCEEEECCCCCCEEECCCCCCCCCCCCCCCCC
T ss_conf             6147623420146624110033---13343---------02068875684798402557457577778876623478777


Q ss_pred             -CC--CC-EEEEEEEECCCCCHHHHHHHHHHHHCCEEEEEEECCCC-CCHHHHHHHHHHHHCCCC-EEEEECCCCCCCCC
Q ss_conf             -78--84-38999961787300279999999730268999986878-865589999999970996-79983267887532
Q gi|254780321|r   73 -TD--AK-DYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQG-VEAQTLANVYQAIDNNHE-IITVLNKADLPSAD  146 (606)
Q Consensus        73 -~~--~~-~y~iNlIDTPGH~DF~~EV~r~l~a~dgaiLvVdA~~G-vq~QT~~~~~~A~~~~l~-~I~viNKiD~~~A~  146 (606)
                       ++  .+ .-++.|+|+|||.-...-.-..-+..|||||||+|.+- +||||++|+....-.|++ +|++-||||+.+  
T Consensus        77 ~cg~~~~l~R~VSfVDaPGHe~LMATMLsGAAlMDgAlLvIaANEpcPQPQT~EHl~AleIigik~iiIvQNKIDlV~--  154 (415)
T COG5257          77 NCGAETELVRRVSFVDAPGHETLMATMLSGAALMDGALLVIAANEPCPQPQTREHLMALEIIGIKNIIIVQNKIDLVS--  154 (415)
T ss_pred             CCCCCCCEEEEEEEEECCCHHHHHHHHHCCHHHHCCEEEEEECCCCCCCCCHHHHHHHHHHHCCCEEEEEECCCCEEC--
T ss_conf             789973079999974079669999988602344215389995389898973187788776626533999952301115--


Q ss_pred             CCCH---HHHHHHHH-H--HHHHHHHHHHHHCCCCCCHHHHHHHHHHHCCCCHHHHHCCCCCCCCCEE--------ECCC
Q ss_conf             1133---88877555-3--2232100011100223200678776321000111122012331012101--------1475
Q gi|254780321|r  147 PDRV---KKQIEETI-G--ISTEDALLVSAKTGEGIPLLLERIVQQLPSPTSPEGANAPLKALLIDSW--------YNSY  212 (606)
Q Consensus       147 ~e~v---~~ei~~~~-g--~~~~~ii~vSAktG~GV~~LLd~Iv~~iP~P~~~~~~~~Pl~alVfds~--------~D~~  212 (606)
                      .|+.   .+||.+++ |  .+...++|+||..+.||+.|+++|.+++|.|.  ++.++|.+|+|..|+        .+.-
T Consensus       155 ~E~AlE~y~qIk~FvkGt~Ae~aPIIPiSA~~~~NIDal~e~i~~~IptP~--rd~~~~p~m~v~RSFDVNkPGt~~~~L  232 (415)
T COG5257         155 RERALENYEQIKEFVKGTVAENAPIIPISAQHKANIDALIEAIEKYIPTPE--RDLDKPPRMYVARSFDVNKPGTPPEEL  232 (415)
T ss_pred             HHHHHHHHHHHHHHHCCCCCCCCCEEEEHHHHCCCHHHHHHHHHHHCCCCC--CCCCCCCEEEEEEECCCCCCCCCHHHC
T ss_conf             999888799999986263347995443256430587999999998689986--678999669998640358998997772


Q ss_pred             CCEEEEEEECCCCCCCCCEEEEECC-----CCCCC----CCCCCCCCCCEEEEHHCCCCC
Q ss_conf             7259999816987355845887335-----56421----012223355412401012471
Q gi|254780321|r  213 LGVMVLVRIINGQLTKGQSIRLMGT-----NAKYQ----VERIGILTPKMIDIEALYPGE  263 (606)
Q Consensus       213 ~G~I~~~RV~sG~lk~Gd~I~~~~~-----g~~~~----v~~ig~~~~~~~~v~~l~aGd  263 (606)
                      +|-|.=+.+.+|.++.||+|.+-+-     +.+..    .+++--+......++++.+|-
T Consensus       233 ~GGViGGsl~~G~l~vGDEIEIrPGi~v~k~~k~~~~pi~T~i~Sl~ag~~~~~ea~PGG  292 (415)
T COG5257         233 KGGVIGGSLVQGVLRVGDEIEIRPGIVVEKGGKTVWEPITTEIVSLQAGGEDVEEARPGG  292 (415)
T ss_pred             CCCEECCEEEEEEEECCCEEEECCCEEEECCCCEEEEEEEEEEEEEEECCEEEEECCCCC
T ss_conf             474322202553685387578548817603992477871389999973776643126883


No 71 
>KOG0459 consensus
Probab=99.97  E-value=2.4e-31  Score=229.86  Aligned_cols=272  Identities=23%  Similarity=0.377  Sum_probs=205.8

Q ss_pred             CHHHCEEEEEECCCCCCHHHHHHHHHHHCCCCCCCCC-------C---------CEEECCCHHHHHHCCEEEEEEEEEEE
Q ss_conf             8525317999801389877889999998298054444-------3---------11305867798719505232799997
Q gi|254780321|r    7 PLSRIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREM-------S---------SQVLDNMDIERERGITIKAQTVRLNY   70 (606)
Q Consensus         7 p~~~IRN~~IiaHvDhGKTTL~d~lL~~tg~i~~~~~-------~---------~~vlD~~~~EreRGITIka~~~~~~~   70 (606)
                      |++.--|+..+||||+||||+-..+|+++|.+++|..       .         ...||++++||++|-|+-   +...|
T Consensus        75 ~pk~hvn~vfighVdagkstigg~il~ltg~Vd~Rt~ekyereake~~rEswylsW~ldtn~EeR~kgKtvE---vGrA~  151 (501)
T KOG0459          75 YPKEHVNAVFIGHVDAGKSTIGGNILFLTGMVDKRTLEKYEREAKEKNRESWYLSWALDTNGEERDKGKTVE---VGRAY  151 (501)
T ss_pred             CCCCCCEEEEEEEEECCCCCCCCEEEEEEEEECHHHHHHHHHHHHHHCCCCCEEEEEECCCHHHHHCCCEEE---EEEEE
T ss_conf             877874489999996440126873678986543778999999987613332248999737601210265054---12578


Q ss_pred             ECCCCCEEEEEEEECCCCCHHHHHHHHHHHHCCEEEEEEECCCCC-----C--HHHHHHHHHHHHCCCC-EEEEECCCCC
Q ss_conf             437884389999617873002799999997302689999868788-----6--5589999999970996-7998326788
Q gi|254780321|r   71 TSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGV-----E--AQTLANVYQAIDNNHE-IITVLNKADL  142 (606)
Q Consensus        71 ~~~~~~~y~iNlIDTPGH~DF~~EV~r~l~a~dgaiLvVdA~~Gv-----q--~QT~~~~~~A~~~~l~-~I~viNKiD~  142 (606)
                      ...  ..-+++++|+|||.-|.-+.....+-+|-++||++|..|-     +  -||+.|..+|..++++ .|++|||||-
T Consensus       152 FEt--e~~~ftiLDApGHk~fv~nmI~GasqAD~~vLvisar~gefetgFerGgQTREha~Lakt~gv~~lVv~vNKMdd  229 (501)
T KOG0459         152 FET--ENKRFTILDAPGHKSFVPNMIGGASQADLAVLVISARKGEFETGFEKGGQTREHAMLAKTAGVKHLIVLINKMDD  229 (501)
T ss_pred             EEE--CCEEEEEECCCCCCCCCHHHCCCCCHHHHHHHHHHHHHCHHHCCCCCCCCHHHHHHHHHHHCCCEEEEEEEECCC
T ss_conf             871--343677631676555560003661111233201132001121031036630578999886233257999995058


Q ss_pred             CCCCCC-----CHHHHHHHHH---HH---HHHHHHHHHHHCCCCCCHHHHHHH------------HHHHCCCCHHHHHCC
Q ss_conf             753211-----3388877555---32---232100011100223200678776------------321000111122012
Q gi|254780321|r  143 PSADPD-----RVKKQIEETI---GI---STEDALLVSAKTGEGIPLLLERIV------------QQLPSPTSPEGANAP  199 (606)
Q Consensus       143 ~~A~~e-----~v~~ei~~~~---g~---~~~~ii~vSAktG~GV~~LLd~Iv------------~~iP~P~~~~~~~~P  199 (606)
                      |..++.     ++.+.+..++   |+   .+--.+|+|+.+|.++.+..+.++            +.+|.+  .+..|+|
T Consensus       230 PtvnWs~eRy~E~~~k~~~fLr~~g~n~~~d~~f~p~sg~tG~~~k~~~~s~cpwy~gp~fl~~ld~l~~~--~R~~~GP  307 (501)
T KOG0459         230 PTVNWSNERYEECKEKLQPFLRKLGFNPKPDKHFVPVSGLTGANVKDRTDSVCPWYKGPIFLEYLDELPHL--ERILNGP  307 (501)
T ss_pred             CCCCCCHHHHHHHHHHHHHHHHHHCCCCCCCCEEEECCCCCCCCHHHCCCCCCCCCCCCCCCEEHHCCCCC--CCCCCCC
T ss_conf             86673056689999999999998444689984142024645555534466658842177555002026765--5468987


Q ss_pred             CCCCCCCEEECCCCCEEEEEEECCCCCCCCCEEEEECCCCCCCCCCCCCCCCCEEEEHHCCCCCH-HHHHHCCCCCCCCC
Q ss_conf             33101210114757259999816987355845887335564210122233554124010124712-33220110024444
Q gi|254780321|r  200 LKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVERIGILTPKMIDIEALYPGEI-GVMIASIKEVSHTR  278 (606)
Q Consensus       200 l~alVfds~~D~~~G~I~~~RV~sG~lk~Gd~I~~~~~g~~~~v~~ig~~~~~~~~v~~l~aGdV-G~ii~gik~l~~~~  278 (606)
                      |++.|.+-+-|  .|.|.+++|.||++++||++.+|+.+..-+|..  ++. +..+++.+.+||. -.-+.|| .-.++.
T Consensus       308 ~~~pI~~Kykd--mGTvv~GKvEsGsi~kg~~lvvMPnk~~veV~~--I~~-dd~E~~~~~pGenvk~rlkgi-eeedi~  381 (501)
T KOG0459         308 IRCPVANKYKD--MGTVVGGKVESGSIKKGQQLVVMPNKTNVEVLG--IYS-DDVETDRVAPGENVKLRLKGI-EEEDIS  381 (501)
T ss_pred             EEEEHHHHCCC--CCEEEEEEECCCCEECCCEEEECCCCCCEEEEE--EEC-CCCEEEECCCCCCEEEEECCC-CHHHCC
T ss_conf             78552562055--652788786026030598479725886257898--751-652010015885158996453-354246


Q ss_pred             CCCEECCCCCCCC
Q ss_conf             5420004667853
Q gi|254780321|r  279 VGDTITDDSSPTT  291 (606)
Q Consensus       279 vGDTl~~~~~p~~  291 (606)
                      .|=.||++++|..
T Consensus       382 ~GfiL~~~~n~~~  394 (501)
T KOG0459         382 PGFILCSPNNPCK  394 (501)
T ss_pred             CCEEEECCCCCCC
T ss_conf             7348706898555


No 72 
>KOG0461 consensus
Probab=99.96  E-value=4.5e-29  Score=214.66  Aligned_cols=250  Identities=22%  Similarity=0.323  Sum_probs=189.4

Q ss_pred             CHHHCEEEEEECCCCCCHHHHHHHHHHHCCCCCCCCCCCEEECCCHHHHHHCCEEEEEEEEEE----EECCCCCEEEEEE
Q ss_conf             852531799980138987788999999829805444431130586779871950523279999----7437884389999
Q gi|254780321|r    7 PLSRIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVRLN----YTSTDAKDYQLNL   82 (606)
Q Consensus         7 p~~~IRN~~IiaHvDhGKTTL~d~lL~~tg~i~~~~~~~~vlD~~~~EreRGITIka~~~~~~----~~~~~~~~y~iNl   82 (606)
                      |+.| -|++|+||||+|||||+-+|-....+ .       .-|..+.-+|||||....-..+.    -.-..++..++.|
T Consensus         4 ~p~n-~N~GiLGHvDSGKTtLarals~~~ST-a-------AFDk~pqS~eRgiTLDLGFS~~~v~~parLpq~e~lq~tl   74 (522)
T KOG0461           4 PPSN-LNLGILGHVDSGKTTLARALSELGST-A-------AFDKHPQSTERGITLDLGFSTMTVLSPARLPQGEQLQFTL   74 (522)
T ss_pred             CCCE-EEEEEEEECCCCHHHHHHHHHHHCCH-H-------HHCCCCCCCCCCEEEEECCEEEECCCCCCCCCCCCCEEEE
T ss_conf             9720-24435740257648999999863140-3-------3224875310462674122044135723378766412699


Q ss_pred             EECCCCCHHHHHHHHHHHHCCEEEEEEECCCCCCHHHHHHHHHHHHCCCCEEEEECCCCCCC-----CCCCCHHHHHH--
Q ss_conf             61787300279999999730268999986878865589999999970996799832678875-----32113388877--
Q gi|254780321|r   83 IDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQAIDNNHEIITVLNKADLPS-----ADPDRVKKQIE--  155 (606)
Q Consensus        83 IDTPGH~DF~~EV~r~l~a~dgaiLvVdA~~Gvq~QT~~~~~~A~~~~l~~I~viNKiD~~~-----A~~e~v~~ei~--  155 (606)
                      ||||||+...--+..+-...|-++||||+..|.|+||-+++-++...--+.++||||+|.-.     +..++....+.  
T Consensus        75 vDCPGHasLIRtiiggaqiiDlm~lviDv~kG~QtQtAEcLiig~~~c~klvvvinkid~lpE~qr~ski~k~~kk~~Kt  154 (522)
T KOG0461          75 VDCPGHASLIRTIIGGAQIIDLMILVIDVQKGKQTQTAECLIIGELLCKKLVVVINKIDVLPENQRASKIEKSAKKVRKT  154 (522)
T ss_pred             EECCCHHHHHHHHHCCHHHHEEEEEEEEHHCCCCCCCCHHHHHHHHHCCCEEEEEEECCCCCCHHHHHHHHHHHHHHHHH
T ss_conf             71797088999997101200134678861017666521454437664462699995012265302456789999999977


Q ss_pred             -HHHHHHH-HHHHHHHHHCC----CCCCHHHHHHHHHHHCCCCHHHHHCCCCCCCCCEEECCCCCEEEEEEECCCCCCCC
Q ss_conf             -5553223-21000111002----23200678776321000111122012331012101147572599998169873558
Q gi|254780321|r  156 -ETIGIST-EDALLVSAKTG----EGIPLLLERIVQQLPSPTSPEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKG  229 (606)
Q Consensus       156 -~~~g~~~-~~ii~vSAktG----~GV~~LLd~Iv~~iP~P~~~~~~~~Pl~alVfds~~D~~~G~I~~~RV~sG~lk~G  229 (606)
                       +..+++. ..|+++||+.|    .++.+|.+++-+.+-.|+  +|+++||-|.|=..+.-...|.|.++.|.+|+++.|
T Consensus       155 Le~t~f~g~~PI~~vsa~~G~~~~~~i~eL~e~l~s~if~P~--Rd~~gpflm~vDHCF~IKGQGTV~TGTvl~G~~~ln  232 (522)
T KOG0461         155 LESTGFDGNSPIVEVSAADGYFKEEMIQELKEALESRIFEPK--RDEEGPFLMAVDHCFAIKGQGTVLTGTVLRGVLRLN  232 (522)
T ss_pred             HHHCCCCCCCCEEEEECCCCCCCHHHHHHHHHHHHHHHCCCC--CCCCCCEEEEEEEEEEECCCCEEEEEEEEEEEEECC
T ss_conf             874576888852676437875406678999999997624777--688887589864257862671588634787689628


Q ss_pred             CEEEEECCCCCCCCCCCCCCCCCEEEEHHCCCCC-HHHHHHC
Q ss_conf             4588733556421012223355412401012471-2332201
Q gi|254780321|r  230 QSIRLMGTNAKYQVERIGILTPKMIDIEALYPGE-IGVMIAS  270 (606)
Q Consensus       230 d~I~~~~~g~~~~v~~ig~~~~~~~~v~~l~aGd-VG~ii~g  270 (606)
                      +.|.+..-+.+.+|+.+.   +.+.++..+.+|| +|+.++.
T Consensus       233 ~~iE~PAL~e~rkVKslq---mf~~~vtsa~~GdR~g~cVtq  271 (522)
T KOG0461         233 TEIEFPALNEKRKVKSLQ---MFKQRVTSAAAGDRAGFCVTQ  271 (522)
T ss_pred             CEEEECCCCHHHHHHHHH---HHHHHHHHHHCCCCEEEEEEC
T ss_conf             688504333144444699---875120023215622434001


No 73 
>cd04165 GTPBP1_like GTPBP1-like.  Mammalian GTP binding protein 1 (GTPBP1), GTPBP2, and nematode homologs AGP-1 and CGP-1 are GTPases whose specific functions remain unknown.  In mouse, GTPBP1 is expressed in macrophages, in smooth muscle cells of various tissues and in some neurons of the cerebral cortex; GTPBP2 tissue distribution appears to overlap that of GTPBP1.  In human leukemia and macrophage cell lines, expression of both GTPBP1 and GTPBP2 is enhanced by interferon-gamma (IFN-gamma).  The chromosomal location of both genes has been identified in humans, with GTPBP1 located in chromosome 22q12-13.1 and GTPBP2 located in chromosome 6p21-12.  Human glioblastoma multiforme (GBM), a highly-malignant astrocytic glioma and the most common cancer in the central nervous system, has been linked to chromosomal deletions and a translocation on chromosome 6.  The GBM translocation results in a fusion of GTPBP2 and PTPRZ1, a protein involved in oligodendrocyte differentiation, recovery, and
Probab=99.95  E-value=7.8e-28  Score=206.35  Aligned_cols=174  Identities=26%  Similarity=0.297  Sum_probs=124.9

Q ss_pred             EEEECCCCCCHHHHHHHHHHHCCCCCCC-CCCCEEECCCHHHHHHCCEEEEEEEEEEEE-------------------CC
Q ss_conf             9998013898778899999982980544-443113058677987195052327999974-------------------37
Q gi|254780321|r   14 FSIVAHIDHGKSTLADRFIQHCRGLTER-EMSSQVLDNMDIERERGITIKAQTVRLNYT-------------------ST   73 (606)
Q Consensus        14 ~~IiaHvDhGKTTL~d~lL~~tg~i~~~-~~~~~vlD~~~~EreRGITIka~~~~~~~~-------------------~~   73 (606)
                      ++++||||||||||..+|.  +|.++.. +..-+.+.....|.|+|+|..-..--+.|.                   .+
T Consensus         2 v~v~GhVD~GKSTL~G~Lt--~g~lDdGrg~ar~~~~rh~hE~~~G~Tssi~~~~lgf~~~g~~~~~~~~~~~~~~~~~~   79 (224)
T cd04165           2 VAVVGNVDAGKSTLLGVLT--QGELDNGRGKARLNLFRHKHEVESGRTSSVSNEILGFDSDGEVVNYPDNHLSESDIEIC   79 (224)
T ss_pred             EEEEECCCCCHHHHHHHHH--CCCCCCCCHHHHHHHHHHHHHHHHCCCCCHHHHHHHHCCCCCEECCCCCCCCCCCEEEE
T ss_conf             8999485884889999985--67742221067778776189997265441156554010145320213476544220121


Q ss_pred             CCCEEEEEEEECCCCCHHHHHHHHHHHH--CCEEEEEEECCCCCCHHHHHHHHHHHHCCCCEEEEECCCCCCCC-CCCCH
Q ss_conf             8843899996178730027999999973--02689999868788655899999999709967998326788753-21133
Q gi|254780321|r   74 DAKDYQLNLIDTPGHVDFTYEVSRSLSA--CEGSLLVVDATQGVEAQTLANVYQAIDNNHEIITVLNKADLPSA-DPDRV  150 (606)
Q Consensus        74 ~~~~y~iNlIDTPGH~DF~~EV~r~l~a--~dgaiLvVdA~~Gvq~QT~~~~~~A~~~~l~~I~viNKiD~~~A-~~e~v  150 (606)
                      ......+.|||+|||.+|.--..+.+.+  .|.|+|||+|.+|+++||++|+.++...++|+++||||||+... ..+++
T Consensus        80 ~~~~k~it~iD~pGH~~y~kt~i~G~~~~~~d~~~LvV~A~~G~~~~T~ehl~l~~~l~ip~~vvitKiDl~~~~~l~~~  159 (224)
T cd04165          80 EKSSKLVTFIDLAGHERYLKTTLFGLTGYAPDYAMLVVAANAGIIGMTKEHLGLALALNIPVFVVVTKIDLAPANILQET  159 (224)
T ss_pred             CCCCCEEEEEECCCHHHHHHHHHHHHHCCCCCEEEEEEECCCCCHHHHHHHHHHHHHHCCCEEEEEECCCCCCHHHHHHH
T ss_conf             36786799997887399999999876355689899993178897799999999999839998999989776898999999


Q ss_pred             HHHHHHHHH-----------------------HHHHH---HHHHHHHCCCCCCHHHHHHHHHHHCC
Q ss_conf             888775553-----------------------22321---00011100223200678776321000
Q gi|254780321|r  151 KKQIEETIG-----------------------ISTED---ALLVSAKTGEGIPLLLERIVQQLPSP  190 (606)
Q Consensus       151 ~~ei~~~~g-----------------------~~~~~---ii~vSAktG~GV~~LLd~Iv~~iP~P  190 (606)
                      ..+|..++.                       ++...   ++.+|+.+|.|++.|... ...+|++
T Consensus       160 ~~~i~~~lk~p~~~k~p~~v~~~~d~~~~a~~~~~~~ivPIf~vS~VtG~Gi~~L~~f-L~~LP~r  224 (224)
T cd04165         160 LKDLKRILKVPGVRKLPVPVKSDDDVVLAASNFSSERIVPIFQVSNVTGEGLDLLHAF-LNLLPLR  224 (224)
T ss_pred             HHHHHHHHCCCCCCCCCEECCCHHHHHHHHHCCCCCCCCCEEEEECCCCCCHHHHHHH-HHHCCCC
T ss_conf             9999999704475568702168588999986488677746799765898799999999-9876999


No 74 
>COG5258 GTPBP1 GTPase [General function prediction only]
Probab=99.95  E-value=3.3e-27  Score=202.12  Aligned_cols=277  Identities=23%  Similarity=0.334  Sum_probs=208.3

Q ss_pred             CCCCCHHHCEEEEEECCCCCCHHHHHHHHHHHCCCCCCCCCCC-EEECCCHHHHHHCCEEEEEEEEEEEECCC-------
Q ss_conf             8899852531799980138987788999999829805444431-13058677987195052327999974378-------
Q gi|254780321|r    3 KKPTPLSRIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSS-QVLDNMDIERERGITIKAQTVRLNYTSTD-------   74 (606)
Q Consensus         3 ~~~~p~~~IRN~~IiaHvDhGKTTL~d~lL~~tg~i~~~~~~~-~vlD~~~~EreRGITIka~~~~~~~~~~~-------   74 (606)
                      ++.+++++| |++..||||||||||+..|.  ||..++.+... .++|-..-|-|||-|-   .+++...+++       
T Consensus       110 ~~~~~~~hv-~Vg~aGhVdhGKSTlvG~Lv--tG~~DDG~G~tR~~ldv~kHEverGlsa---~iS~~v~Gf~dgk~~rl  183 (527)
T COG5258         110 KTEEAPEHV-LVGVAGHVDHGKSTLVGVLV--TGRLDDGDGATRSYLDVQKHEVERGLSA---DISLRVYGFDDGKVVRL  183 (527)
T ss_pred             CCCCCCCEE-EEEEECCCCCCCCEEEEEEE--ECCCCCCCCCHHHHHHHHHHHHHHCCCC---CEEEEEEEECCCCEEEE
T ss_conf             125799638-99974244578635987898--4577788840211345416777616532---22699997249926760


Q ss_pred             --------------CCEEEEEEEECCCCCHHHHHHHHHHH--HCCEEEEEEECCCCCCHHHHHHHHHHHHCCCCEEEEEC
Q ss_conf             --------------84389999617873002799999997--30268999986878865589999999970996799832
Q gi|254780321|r   75 --------------AKDYQLNLIDTPGHVDFTYEVSRSLS--ACEGSLLVVDATQGVEAQTLANVYQAIDNNHEIITVLN  138 (606)
Q Consensus        75 --------------~~~y~iNlIDTPGH~DF~~EV~r~l~--a~dgaiLvVdA~~Gvq~QT~~~~~~A~~~~l~~I~viN  138 (606)
                                    .-|-.+.|+||-||.-+---..|.|-  -.|=.+|+|.|.+|++--|++|+-.|+..++|+|++++
T Consensus       184 knPld~aE~~~vv~~aDklVsfVDtvGHEpwLrTtirGL~gqk~dYglLvVaAddG~~~~tkEHLgi~~a~~lPviVvvT  263 (527)
T COG5258         184 KNPLDEAEKAAVVKRADKLVSFVDTVGHEPWLRTTIRGLLGQKVDYGLLVVAADDGVTKMTKEHLGIALAMELPVIVVVT  263 (527)
T ss_pred             CCCCCHHHHHHHHHHCCCEEEEEECCCCCHHHHHHHHHHHCCCCCEEEEEEECCCCCCHHHHHHHHHHHHHCCCEEEEEE
T ss_conf             58520777767665203089998537862789988888732666627999981677303306765656461697799999


Q ss_pred             CCCC-CCCCCCCHHHHHHHHHHH---------------------HHH----HHHHHHHHCCCCCCHHHHHHHHHHHCCCC
Q ss_conf             6788-753211338887755532---------------------232----10001110022320067877632100011
Q gi|254780321|r  139 KADL-PSADPDRVKKQIEETIGI---------------------STE----DALLVSAKTGEGIPLLLERIVQQLPSPTS  192 (606)
Q Consensus       139 KiD~-~~A~~e~v~~ei~~~~g~---------------------~~~----~ii~vSAktG~GV~~LLd~Iv~~iP~P~~  192 (606)
                      |+|+ |+.++..+.++|..++-.                     ...    .++++|+-||.|.+ ||+.+..++|.-. 
T Consensus       264 K~D~~~ddr~~~v~~ei~~~Lk~v~Rip~~vk~~~d~v~aa~a~k~~~~vvPi~~tSsVTg~Gld-lL~e~f~~Lp~rr-  341 (527)
T COG5258         264 KIDMVPDDRFQGVVEEISALLKRVGRIPLIVKDTDDVVLAAKAMKAGRGVVPIFYTSSVTGEGLD-LLDEFFLLLPKRR-  341 (527)
T ss_pred             ECCCCCHHHHHHHHHHHHHHHHHHCCCCEEEECCCHHHHHHHHHHCCCCEEEEEEEECCCCCCHH-HHHHHHHHCCCCC-
T ss_conf             52568278899999999999997434653550553267765433237825779998224575389-9999997498500-


Q ss_pred             HHHHHCCCCCCCCCEEECCCCCEEEEEEECCCCCCCCCEEEEEC-CCCCCCCCCCCCCCCCEEEEHHCCCCCHHHHHHCC
Q ss_conf             11220123310121011475725999981698735584588733-55642101222335541240101247123322011
Q gi|254780321|r  193 PEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMG-TNAKYQVERIGILTPKMIDIEALYPGEIGVMIASI  271 (606)
Q Consensus       193 ~~~~~~Pl~alVfds~~D~~~G~I~~~RV~sG~lk~Gd~I~~~~-~g~~~~v~~ig~~~~~~~~v~~l~aGdVG~ii~gi  271 (606)
                      .-+..+||.|+|-+.+.-..+|.++.+.|.+|.+..||++++-+ ...+++-..+....++...++++.||+|  +-..+
T Consensus       342 ~~~d~g~flmYId~iYsVtGVGtVvsGsV~~G~l~~gd~vllGP~~~G~fr~v~vkSIemh~~rvdsa~aG~i--ig~Al  419 (527)
T COG5258         342 RWDDEGPFLMYIDKIYSVTGVGTVVSGSVKSGILHVGDTVLLGPFKDGKFREVVVKSIEMHHYRVDSAKAGSI--IGIAL  419 (527)
T ss_pred             CCCCCCCEEEEEEEEEEEEEEEEEEEEEEEEEEECCCCEEEECCCCCCCEEEEEEEEEEEEEEEECCCCCCCE--EEEEE
T ss_conf             2477897289987567774257898613776166059879974578995799999999976677032357758--99996


Q ss_pred             CCCCC--CCCCCEECCCCCC
Q ss_conf             00244--4454200046678
Q gi|254780321|r  272 KEVSH--TRVGDTITDDSSP  289 (606)
Q Consensus       272 k~l~~--~~vGDTl~~~~~p  289 (606)
                      ++...  ++-|-.|.....|
T Consensus       420 ~gv~~e~lerGMVl~~~~~p  439 (527)
T COG5258         420 KGVEKEELERGMVLSAGADP  439 (527)
T ss_pred             CCCCHHHHHCCEEECCCCCC
T ss_conf             26687787345175279996


No 75 
>cd03709 lepA_C lepA_C: This family represents the C-terminal region of LepA, a GTP-binding protein localized in the cytoplasmic membrane.   LepA is ubiquitous in Bacteria and Eukaryota (e.g. Saccharomyces cerevisiae GUF1p), but is missing from Archaea. LepA exhibits significant homology to elongation factors (EFs) Tu and G. The function(s) of the proteins in this family are unknown. The N-terminal domain of LepA is homologous to a domain of similar size found in initiation factor 2 (IF2), and in EF-Tu and EF-G (factors required for translation in Escherichia coli). Two types of phylogenetic tree, rooted by other GTP-binding proteins, suggest that eukaryotic homologs (including S. cerevisiae GUF1) originated within the bacterial LepA family. LepA has never been observed in archaea, and eukaryl LepA is organellar. LepA is therefore a true bacterial GTPase, found only in the bacterial lineage.
Probab=99.94  E-value=3.6e-27  Score=201.91  Aligned_cols=79  Identities=66%  Similarity=1.227  Sum_probs=77.2

Q ss_pred             CCEEEEEEEECCCCCHHHHHHHHHHHHEEECCCCCC-CEEEEEEEECHHHHHHHHHHHHHHHCCCEEEEEEEECCCEECC
Q ss_conf             326999998083100038999886300142443368-3699999960433322046876763574188898543546436
Q gi|254780321|r  410 EPWIQVTIITPNEYLGSILKLCQERRGIQIDMSHLD-NRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDYRDSD  488 (606)
Q Consensus       410 EPi~~~~I~~P~ey~G~Vm~~l~~RRG~~~~m~~~~-~~~~i~~~vPl~Eli~~f~~~LkS~T~G~as~~ye~~~Y~~~d  488 (606)
                      |||++++|++|+||+|+||++|++|||++.+|++.+ +++++.|++||+||++||+|+|||+|+|||||+|||++|+|||
T Consensus         1 EPi~~~~I~~P~ey~G~V~~ll~~rRG~~~~~~~~~~~~~~i~~~vPlaE~~~~f~~~LkS~T~G~as~~~e~~~y~~ad   80 (80)
T cd03709           1 EPFVKATIITPSEYLGAIMELCQERRGVQKDMEYLDANRVMLTYELPLAEIVYDFFDKLKSISKGYASLDYELIGYRESD   80 (80)
T ss_pred             CCEEEEEEECCHHHHHHHHHHHHHHHCEEECCEECCCCEEEEEEECCHHHHHHHHHHHHHHHCCCEEEEEEEECCCCCCC
T ss_conf             98699999685898999999999842577254654898799999944799765477876643566299998744623588


No 76 
>TIGR00487 IF-2 translation initiation factor IF-2; InterPro: IPR000178 Initiation factor 2 (IF-2) (gene infB)  is one of the three factors required for the initiation of protein biosynthesis in bacteria. IF-2 promotes the GTP-dependent binding of the initiator tRNA to the small subunit of the ribosome. IF-2 is a protein of about 70 to 95 Kd which contains a central GTP-binding domain flanked by a highly variable N-terminal domain and a more conserved C-terminal domain. Bacterial IF-2 is structurally and functionally related to eukaryotic mitochondrial IF-2 (IF-2(mt))  as well as to algal and plants chloroplast IF-2 (IF-2(chl)). Both IF-2(mt) and IF-2(chl) are encoded by nuclear genes and are produced as precursor proteins with a transit peptide. An exception are red algae where IF-2(chl) is encoded by the plastid genome .; GO: 0003743 translation initiation factor activity, 0005525 GTP binding, 0006413 translational initiation, 0005622 intracellular.
Probab=99.93  E-value=3.3e-25  Score=188.70  Aligned_cols=207  Identities=32%  Similarity=0.468  Sum_probs=166.5

Q ss_pred             EEEEEECCCCCCHHHHHHHHHHHCCCCCCCCCCCEEECCCHHHHHHCCEEEEEEEEEEEECCCCCEEEEEEEECCCCCHH
Q ss_conf             17999801389877889999998298054444311305867798719505232799997437884389999617873002
Q gi|254780321|r   12 RNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVRLNYTSTDAKDYQLNLIDTPGHVDF   91 (606)
Q Consensus        12 RN~~IiaHvDhGKTTL~d~lL~~tg~i~~~~~~~~vlD~~~~EreRGITIka~~~~~~~~~~~~~~y~iNlIDTPGH~DF   91 (606)
                      --+.|.||+|||||+|.|.+-. +. +...+.+             |||-....-.+.+.  +++. .+.++|||||.-|
T Consensus        91 p~~~~~gh~dhg~~~ll~~~~~-~~-~~~~~~g-------------g~~~~~g~y~~~~~--~~~~-~~~f~d~pgh~~f  152 (594)
T TIGR00487        91 PVVTIMGHVDHGKTSLLDSIRK-TK-VAAGEAG-------------GITQHIGAYHVEKE--DGKK-WITFLDTPGHEAF  152 (594)
T ss_pred             CEEEEEECCCCCCHHHHHHHHH-CC-CCCCCCC-------------CCHHHCCEEEEEEC--CCCE-EEEEECCCCHHHH
T ss_conf             6368851235540345655541-00-0011136-------------52010130456642--8843-7998407753677


Q ss_pred             HHHHHHHHHHCCEEEEEEECCCCCCHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCCHHHHHHHHHHHHHHH------H
Q ss_conf             7999999973026899998687886558999999997099679983267887532113388877555322321------0
Q gi|254780321|r   92 TYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQAIDNNHEIITVLNKADLPSADPDRVKKQIEETIGISTED------A  165 (606)
Q Consensus        92 ~~EV~r~l~a~dgaiLvVdA~~Gvq~QT~~~~~~A~~~~l~~I~viNKiD~~~A~~e~v~~ei~~~~g~~~~~------i  165 (606)
                      ..-..|...+.|-++|++.|.+|+++||...+..|...+.|+++++||+|+|.++|+++..++.+. |+.+++      .
T Consensus       153 ~~~~~~g~~~~d~~~~~~~~~dg~~~~~~~~~~h~~~~~~p~~~~~n~~d~p~~~pd~~~~~~~~~-g~~~~~wgg~~~~  231 (594)
T TIGR00487       153 TLMRARGAKVTDIVVLVVAADDGVKPQTIEAISHAKAANVPLIVAVNKIDKPEANPDRVKQELSEY-GLVPEDWGGDTIF  231 (594)
T ss_pred             HHHHHCCCCEEEEEEEEEECCCCCCHHHHHHHHHHHHCCCCEEEEEECCCCCCCCHHHHHHHHHHC-CCCCHHCCCCEEE
T ss_conf             877633761001579998415564235688765333307736998612467667877899998751-7750112783468


Q ss_pred             HHHHHHCCCCCCHHHHHHHHHHHCCCCHHHHHCCCCCCCCCEEECCCCCEEEEEEECCCCCCCCCEEEEECC
Q ss_conf             001110022320067877632100011112201233101210114757259999816987355845887335
Q gi|254780321|r  166 LLVSAKTGEGIPLLLERIVQQLPSPTSPEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGT  237 (606)
Q Consensus       166 i~vSAktG~GV~~LLd~Iv~~iP~P~~~~~~~~Pl~alVfds~~D~~~G~I~~~RV~sG~lk~Gd~I~~~~~  237 (606)
                      +++||++|.|+++|+|.|.-.-.......+++...++.+.+...|..+|.++.+-+.+|+++.||.+..-..
T Consensus       232 ~~~~~~~g~g~~~l~~~~l~~~~~~~~~~~~~~~~~g~~~~~~~~~g~g~~~~~~~~~g~l~~gd~~~~g~~  303 (594)
T TIGR00487       232 VPVSALTGDGIDELLDAILLQSEVEELKANPNGQASGTVLEAELDKGRGPVATVLVQSGTLRVGDSVVLGAA  303 (594)
T ss_pred             EEEECCCCCCHHHHHHHHHHHHHHHHHHCCCCCCCCCEEEEEECCCCCCCEEEEEEECCCEECCCEEEEECC
T ss_conf             862001367657888888876434443203232222025641001365632456661472011641352032


No 77 
>TIGR00491 aIF-2 translation initiation factor aIF-2; InterPro: IPR004544 Initiation factor 2 (IF-2) is one of the three factors required for the initiation of protein biosynthesis in bacteria. IF-2 promotes the GTP-dependent binding of the initiator tRNA to the small subunit of the ribosome. IF-2 is a protein of about 70 to 95 Kd which contains a central GTP-binding domain flanked by a highly variable N-terminal domain and a more conserved C-terminal domain. Some members of this family undergo protein self splicing that involves a post-translational excision of the intein followed by peptide ligation.; GO: 0003743 translation initiation factor activity, 0005525 GTP binding, 0006413 translational initiation, 0005622 intracellular.
Probab=99.92  E-value=1.1e-24  Score=185.26  Aligned_cols=310  Identities=28%  Similarity=0.381  Sum_probs=188.2

Q ss_pred             EEECCCCCCHHHHHHHHHHHCCCCCCCCCCCEEECCCHHHHHHCCEE--EEEEEEEEE----ECCCCCEEE-------EE
Q ss_conf             99801389877889999998298054444311305867798719505--232799997----437884389-------99
Q gi|254780321|r   15 SIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITI--KAQTVRLNY----TSTDAKDYQ-------LN   81 (606)
Q Consensus        15 ~IiaHvDhGKTTL~d~lL~~tg~i~~~~~~~~vlD~~~~EreRGITI--ka~~~~~~~----~~~~~~~y~-------iN   81 (606)
                      +|+-|    .|||.|++= .| .+..||++             |||-  -|+-+.+..    ...=||.+.       +=
T Consensus       558 Givvh----nTTLLDkIR-ks-~Vv~kEAG-------------giTQhiGAsevP~dVI~~ic~Dl~K~f~i~~~iPGLL  618 (1145)
T TIGR00491       558 GIVVH----NTTLLDKIR-KS-AVVKKEAG-------------GITQHIGASEVPLDVIKKICGDLLKKFKIKLKIPGLL  618 (1145)
T ss_pred             CEEEE----CCCCCCCCC-CC-CEEEECCC-------------CCCEECCCEECCHHHHHHHCHHHHHCEEEEEECCEEE
T ss_conf             64785----143310003-34-01324778-------------8401006665466898651321211402578658015


Q ss_pred             EEECCCCCHHHHHHHHHHHHCCEEEEEEECCCCCCHHHHHHHHHHHHCCCCEEEEECCCCCC-CCCCC------------
Q ss_conf             96178730027999999973026899998687886558999999997099679983267887-53211------------
Q gi|254780321|r   82 LIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQAIDNNHEIITVLNKADLP-SADPD------------  148 (606)
Q Consensus        82 lIDTPGH~DF~~EV~r~l~a~dgaiLvVdA~~Gvq~QT~~~~~~A~~~~l~~I~viNKiD~~-~A~~e------------  148 (606)
                      +||||||.-|+.=..|.-+.+|-||||||-.+|.+|||.+.+..-.....|.|++-|||||- +++..            
T Consensus       619 fIDTPGHeaFt~LRkRGGAlADlAILvVDInEGfkpQT~EA~~ILr~~ktPFvVAANKIDrI~GW~~~e~~~fl~~~~kq  698 (1145)
T TIGR00491       619 FIDTPGHEAFTNLRKRGGALADLAILVVDINEGFKPQTEEALNILRSFKTPFVVAANKIDRIPGWKSHEGRPFLESYEKQ  698 (1145)
T ss_pred             EEECCCCHHHHCCCCCCCHHHHHHEEEEEECCCCCHHHHHHHHHHHCCCCCEEEEECCCCCCCCCCCCCCCHHHHHHHHC
T ss_conf             86078623442201001036301101341026984034899999612898728950330558896454885166665411


Q ss_pred             --CHHHH----HHHH--------HHHHHHH------------HHHHHHHCCCCCCHHHHHHHHH----HHCCCCHHHHHC
Q ss_conf             --33888----7755--------5322321------------0001110022320067877632----100011112201
Q gi|254780321|r  149 --RVKKQ----IEET--------IGISTED------------ALLVSAKTGEGIPLLLERIVQQ----LPSPTSPEGANA  198 (606)
Q Consensus       149 --~v~~e----i~~~--------~g~~~~~------------ii~vSAktG~GV~~LLd~Iv~~----iP~P~~~~~~~~  198 (606)
                        .+.+.    +.++        -||+++-            ++|+||.||+||.+||-.++-.    +-. +-.-..++
T Consensus       699 ~~~~~~~l~~~~y~lv~~kPL~e~GF~AerFdRv~Dft~tVaviPvSA~tGEGIpelL~~l~GLAQ~YL~~-~Lkl~~eG  777 (1145)
T TIGR00491       699 EQRVKQNLDKKVYNLVIKKPLAEEGFEAERFDRVRDFTRTVAVIPVSAVTGEGIPELLLILAGLAQKYLEE-KLKLEVEG  777 (1145)
T ss_pred             CHHHHHHHHHHHHHHHHCCCHHHCCCCCCCCCCEECEEEEEEEEEEECCCCCCHHHHHHHHHHHHHHHHHH-HCCEEECC
T ss_conf             16788668877898873022112588712255200001136898866567897489999998888899885-26742227


Q ss_pred             CCCCCCCCEEECCCCCEEEEEEECCCCCCCCCEEEEECCCCCCCCCCCC-CCCCC-----EEEEHHCCCCCHHHHHHCCC
Q ss_conf             2331012101147572599998169873558458873355642101222-33554-----12401012471233220110
Q gi|254780321|r  199 PLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVERIG-ILTPK-----MIDIEALYPGEIGVMIASIK  272 (606)
Q Consensus       199 Pl~alVfds~~D~~~G~I~~~RV~sG~lk~Gd~I~~~~~g~~~~v~~ig-~~~~~-----~~~v~~l~aGdVG~ii~gik  272 (606)
                      |-++-|.-.==...+|.-+=.=+|+|.||+||.|.++..+.. -+++|- ++.|.     +.+.+....=|.-+..+|++
T Consensus       778 ~AkGtiLEVKEe~GLG~T~DaviYdGilk~~D~iv~~~~d~v-ivT~vkAlLkP~Pl~emr~~~~~~~~~~ev~AAag~k  856 (1145)
T TIGR00491       778 PAKGTILEVKEEKGLGVTIDAVIYDGILKKGDIIVLAGKDDV-IVTRVKALLKPRPLEEMREERKKFKKVDEVVAAAGVK  856 (1145)
T ss_pred             CCCEEEEEEEEECCCCCEEEEEEECCEECCCCEEEEECCCCC-EEEEEEEECCCCCHHHHHHHHHHCCCCCEEEECCEEE
T ss_conf             865158987850689716999995577120788998138980-5766786348888368751043047521577320358


Q ss_pred             CCCCCCCCCEECCCCCCCCCCCCCCCCCCCEEEEEECCCCHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCEEEEEEC
Q ss_conf             02444454200046678532364552222126642126770245788999988864112211125676000420289963
Q gi|254780321|r  273 EVSHTRVGDTITDDSSPTTSALPGFKPIQPVVFCGLFPVDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFL  352 (606)
Q Consensus       273 ~l~~~~vGDTl~~~~~p~~~~Lp~~~~~~P~v~~~i~p~~~~d~~~L~~aL~kL~~~D~sl~~e~Ets~aLg~Gfr~ggl  352 (606)
                       +- +.-=|++          +.|    .|. |. +  ++..+-++.++...+..++   ..++.  +++.|.=..-=-|
T Consensus       857 -v~-A~~~~~~----------~Ag----~P~-y~-v--~~~~~iek~~e~v~~E~e~---i~i~~--d~~yGvvvKADtL  911 (1145)
T TIGR00491       857 -VA-APELDKV----------LAG----SPI-YV-V--VSEEEIEKVKEEVLKEVEE---IKIET--DEEYGVVVKADTL  911 (1145)
T ss_pred             -EC-CCCHHHH----------HCC----CCE-EE-E--ECCCHHHHHHHHHHHHHHH---HHHCC--CCCCEEEEEECCC
T ss_conf             -72-7761045----------457----734-89-5--1782278999999876775---54213--6511179985585


Q ss_pred             CHHHHHHHHHHHHHHCCCEEE
Q ss_conf             767898889888664495069
Q gi|254780321|r  353 GLLHLEIIQERLEREFSLNLI  373 (606)
Q Consensus       353 G~LHLeVi~eRL~rEfg~ev~  373 (606)
                      |-  ||=+..-||++ |+.+-
T Consensus       912 GS--LEA~v~~Lr~~-~vpIk  929 (1145)
T TIGR00491       912 GS--LEALVNELRKE-GVPIK  929 (1145)
T ss_pred             HH--HHHHHHHHHHC-CCCEE
T ss_conf             11--89999999857-89676


No 78 
>cd03699 lepA_II lepA_II: This subfamily represents the domain II of LepA, a GTP-binding protein localized in the cytoplasmic membrane. The N-terminal domain of LepA shares regions of homology to translation factors. In terms of interaction with the ribosome, EF-G, EF-Tu and IF2 have all been demonstrated to interact at overlapping sites on the ribosome. Chemical protection studies demonstrate that they all include the universally conserved alpha-sarcin loop as part of their binding site. These data indicate that LepA may bind to this location on the ribosome as well.  LepA has never been observed in archaea, and eukaryl LepA is organellar. LepA is therefore a true bacterial GTPase, found only in the bacterial lineage.
Probab=99.92  E-value=8.1e-26  Score=192.82  Aligned_cols=86  Identities=50%  Similarity=0.916  Sum_probs=84.4

Q ss_pred             CCCCCCCEEECCCCCEEEEEEECCCCCCCCCEEEEECCCCCCCCCCCCCCCCCEEEEHHCCCCCHHHHHHCCCCCCCCCC
Q ss_conf             33101210114757259999816987355845887335564210122233554124010124712332201100244445
Q gi|254780321|r  200 LKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVERIGILTPKMIDIEALYPGEIGVMIASIKEVSHTRV  279 (606)
Q Consensus       200 l~alVfds~~D~~~G~I~~~RV~sG~lk~Gd~I~~~~~g~~~~v~~ig~~~~~~~~v~~l~aGdVG~ii~gik~l~~~~v  279 (606)
                      |||||||||||+|+|+|+++||++|+|++||+|.++++++++++.++|+|+|++.++++|.||||||++||+|+++++++
T Consensus         1 LrALifDS~yD~y~Gvv~~vRV~~G~lk~gd~i~~~~t~~~~~v~evG~~~P~~~~~~~L~aGeVGyii~gik~~~d~~v   80 (86)
T cd03699           1 LRALIFDSWYDPYRGVIALVRVFDGTLKKGDKIRFMSTGKEYEVEEVGIFRPEMTPTDELSAGQVGYIIAGIKTVKDARV   80 (86)
T ss_pred             CEEEEEEEEECCCCCEEEEEEEECCEECCCCEEEHHHCCCCCEEEEEEECCCCCCCCCEECCCCCCEEEECCCCCCCCCC
T ss_conf             90899986722788789999997999917985223348996385598871799763884947840489973420155734


Q ss_pred             CCEECC
Q ss_conf             420004
Q gi|254780321|r  280 GDTITD  285 (606)
Q Consensus       280 GDTl~~  285 (606)
                      |||||.
T Consensus        81 GDTitl   86 (86)
T cd03699          81 GDTITL   86 (86)
T ss_pred             CCEEEC
T ss_conf             478759


No 79 
>KOG1144 consensus
Probab=99.91  E-value=3.3e-23  Score=175.28  Aligned_cols=235  Identities=30%  Similarity=0.420  Sum_probs=153.6

Q ss_pred             HHCEE--EEEECCCCCCHHHHHHHHHHHCCCCCCCCCC---CEE-ECCCHHH--HHHCCEEEEEEEEEEEECCCCCEEEE
Q ss_conf             25317--9998013898778899999982980544443---113-0586779--87195052327999974378843899
Q gi|254780321|r    9 SRIRN--FSIVAHIDHGKSTLADRFIQHCRGLTEREMS---SQV-LDNMDIE--RERGITIKAQTVRLNYTSTDAKDYQL   80 (606)
Q Consensus         9 ~~IRN--~~IiaHvDhGKTTL~d~lL~~tg~i~~~~~~---~~v-lD~~~~E--reRGITIka~~~~~~~~~~~~~~y~i   80 (606)
                      ++.|.  .||+||||.|||-|.|.+- .|+. ...+.+   .|+ --+.+.|  +||---++ +.....     .+---+
T Consensus       471 ~~lRSPIcCilGHVDTGKTKlld~ir-~tNV-qegeaggitqqIgAt~fp~~ni~e~tk~~~-~~~K~~-----~kvPg~  542 (1064)
T KOG1144         471 ENLRSPICCILGHVDTGKTKLLDKIR-GTNV-QEGEAGGITQQIGATYFPAENIREKTKELK-KDAKKR-----LKVPGL  542 (1064)
T ss_pred             HHCCCCEEEEEECCCCCCHHHHHHHH-CCCC-CCCCCCCEEEECCCCCCCHHHHHHHHHHHH-HHHHHH-----CCCCEE
T ss_conf             32368637897111266057888762-0553-224456600000541152677899999987-502331-----378704


Q ss_pred             EEEECCCCCHHHHHHHHHHHHCCEEEEEEECCCCCCHHHHHHHHHHHHCCCCEEEEECCCCC-------CCCCCCCH---
Q ss_conf             99617873002799999997302689999868788655899999999709967998326788-------75321133---
Q gi|254780321|r   81 NLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQAIDNNHEIITVLNKADL-------PSADPDRV---  150 (606)
Q Consensus        81 NlIDTPGH~DF~~EV~r~l~a~dgaiLvVdA~~Gvq~QT~~~~~~A~~~~l~~I~viNKiD~-------~~A~~e~v---  150 (606)
                      -+||||||.-|+.=.+|..+-||-||||||-..|++|||++.+.+...++-|.|+.+|||||       |++++-..   
T Consensus       543 lvIdtpghEsFtnlRsrgsslC~~aIlvvdImhGlepqtiESi~lLR~rktpFivALNKiDRLYgwk~~p~~~i~~~lkk  622 (1064)
T KOG1144         543 LVIDTPGHESFTNLRSRGSSLCDLAILVVDIMHGLEPQTIESINLLRMRKTPFIVALNKIDRLYGWKSCPNAPIVEALKK  622 (1064)
T ss_pred             EEECCCCCHHHHHHHHCCCCCCCEEEEEEEHHCCCCCCHHHHHHHHHHCCCCEEEEEHHHHHHCCCCCCCCCHHHHHHHH
T ss_conf             89658872555556650433455377785311167742067899887548975986101344404424898319999987


Q ss_pred             -----HHHHHHHH----------HHHH---------H---HHHHHHHHCCCCCCHHHHHHHHHHHCCCCHH-HHHCCCCC
Q ss_conf             -----88877555----------3223---------2---1000111002232006787763210001111-22012331
Q gi|254780321|r  151 -----KKQIEETI----------GIST---------E---DALLVSAKTGEGIPLLLERIVQQLPSPTSPE-GANAPLKA  202 (606)
Q Consensus       151 -----~~ei~~~~----------g~~~---------~---~ii~vSAktG~GV~~LLd~Iv~~iP~P~~~~-~~~~Pl~a  202 (606)
                           ..+..+.+          |+..         .   -++|+||-+|.||..||-.+++..----+.. .--..+++
T Consensus       623 Q~k~v~~EF~~R~~~ii~efaEQgLN~~LyykNk~~~~~vsiVPTSA~sGeGipdLl~llv~ltQk~m~~kl~y~~ev~c  702 (1064)
T KOG1144         623 QKKDVQNEFKERLNNIIVEFAEQGLNAELYYKNKEMGETVSIVPTSAISGEGIPDLLLLLVQLTQKTMVEKLAYVDEVQC  702 (1064)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHCCCCHHHEEECCCCCCEEEEEECCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHEEE
T ss_conf             44789999999999999999971104434231467465588621221367880789999999999999987742401004


Q ss_pred             CCCCEEECCCCCEEEEEEECCCCCCCCCEEEEECCCCCCCCCCC-CCCCCC
Q ss_conf             01210114757259999816987355845887335564210122-233554
Q gi|254780321|r  203 LLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVERI-GILTPK  252 (606)
Q Consensus       203 lVfds~~D~~~G~I~~~RV~sG~lk~Gd~I~~~~~g~~~~v~~i-g~~~~~  252 (606)
                      -|...-.-+..|...-+-+.+|.|+.||+|.++..+.- -|+.| ..+.|+
T Consensus       703 TVlEVKvieG~GtTIDViLvNG~L~eGD~IvvcG~~Gp-IvTtIRaLLtP~  752 (1064)
T KOG1144         703 TVLEVKVIEGHGTTIDVILVNGELHEGDQIVVCGLQGP-IVTTIRALLTPQ  752 (1064)
T ss_pred             EEEEEEEECCCCCEEEEEEECCEECCCCEEEECCCCCC-HHHHHHHHCCCC
T ss_conf             78998752377716899987565526987998279986-168889763886


No 80 
>KOG0466 consensus
Probab=99.89  E-value=1.5e-23  Score=177.62  Aligned_cols=253  Identities=25%  Similarity=0.363  Sum_probs=170.6

Q ss_pred             CEEEEEECCCCCCHHHHHHHHHHHCCCCCCCCCCCEEECCCHHHHHHCCEEEEE--EEEEE------------EECCC--
Q ss_conf             317999801389877889999998298054444311305867798719505232--79999------------74378--
Q gi|254780321|r   11 IRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQ--TVRLN------------YTSTD--   74 (606)
Q Consensus        11 IRN~~IiaHvDhGKTTL~d~lL~~tg~i~~~~~~~~vlD~~~~EreRGITIka~--~~~~~------------~~~~~--   74 (606)
                      --||+-||||.|||||++-++   +|.-+-|         ..-|-||.||||..  ++.+.            |.++.  
T Consensus        38 TiNIGTIGHVAHGKSTvVkAi---SGv~Tvr---------FK~ELERNITIKLGYANAKIYkc~~~kCprP~cy~s~gS~  105 (466)
T KOG0466          38 TINIGTIGHVAHGKSTVVKAI---SGVHTVR---------FKNELERNITIKLGYANAKIYKCDDPKCPRPGCYRSFGSS  105 (466)
T ss_pred             EEEECCEECCCCCCCEEEEEE---CCCEEEE---------EHHHHHCCEEEEECCCCCEEEECCCCCCCCCCHHHCCCCC
T ss_conf             443021110025740244540---4614887---------1334421526885135445785589889996630204789


Q ss_pred             ------------CCEE----EEEEEECCCCCHHHHHHHHHHHHCCEEEEEEECCCC-CCHHHHHHHHHHHHCCCC-EEEE
Q ss_conf             ------------8438----999961787300279999999730268999986878-865589999999970996-7998
Q gi|254780321|r   75 ------------AKDY----QLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQG-VEAQTLANVYQAIDNNHE-IITV  136 (606)
Q Consensus        75 ------------~~~y----~iNlIDTPGH~DF~~EV~r~l~a~dgaiLvVdA~~G-vq~QT~~~~~~A~~~~l~-~I~v  136 (606)
                                  ..++    ...|+|+|||-=...-.-..-++.|+|+|+|.|.+- +||||-+|+....-+.|+ +|+.
T Consensus       106 k~d~~~c~~~g~~~~~klvRHVSfVDCPGHDiLMaTMLnGaAvmDaalLlIA~NEsCPQPQTsEHLaaveiM~Lkhiiil  185 (466)
T KOG0466         106 KEDRPPCDRPGCEGKMKLVRHVSFVDCPGHDILMATMLNGAAVMDAALLLIAGNESCPQPQTSEHLAAVEIMKLKHIIIL  185 (466)
T ss_pred             CCCCCCCCCCCCCCCEEEEEEEEECCCCCHHHHHHHHHCCHHHHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHHCEEEEE
T ss_conf             99999865689987458999877514796188998874326775433410104888989850667888778631418998


Q ss_pred             ECCCCCCCCCCCCHHHH---HHHHH-H--HHHHHHHHHHHHCCCCCCHHHHHHHHHHHCCCCHHHHHCCCCCCCCCEE--
Q ss_conf             32678875321133888---77555-3--2232100011100223200678776321000111122012331012101--
Q gi|254780321|r  137 LNKADLPSADPDRVKKQ---IEETI-G--ISTEDALLVSAKTGEGIPLLLERIVQQLPSPTSPEGANAPLKALLIDSW--  208 (606)
Q Consensus       137 iNKiD~~~A~~e~v~~e---i~~~~-g--~~~~~ii~vSAktG~GV~~LLd~Iv~~iP~P~~~~~~~~Pl~alVfds~--  208 (606)
                      -||+|+...  ++..+|   |..++ +  .+...++|+||.-..||+.++|.|++++|-|.  +|-..|-++.|+.|+  
T Consensus       186 QNKiDli~e--~~A~eq~e~I~kFi~~t~ae~aPiiPisAQlkyNId~v~eyivkkIPvPv--Rdf~s~prlIVIRSFDV  261 (466)
T KOG0466         186 QNKIDLIKE--SQALEQHEQIQKFIQGTVAEGAPIIPISAQLKYNIDVVCEYIVKKIPVPV--RDFTSPPRLIVIRSFDV  261 (466)
T ss_pred             ECHHHHHHH--HHHHHHHHHHHHHHHCCCCCCCCEEEEHHHHCCCHHHHHHHHHHCCCCCC--CCCCCCCCEEEEEEECC
T ss_conf             212335437--78898899999997456557995210136433676799999986189882--01478972899986236


Q ss_pred             ------ECCCCCEEEEEEECCCCCCCCCEEEEECCCC-------CCCCC----CCCCCCCCEEEEHHCCCCC-HHHHHHC
Q ss_conf             ------1475725999981698735584588733556-------42101----2223355412401012471-2332201
Q gi|254780321|r  209 ------YNSYLGVMVLVRIINGQLTKGQSIRLMGTNA-------KYQVE----RIGILTPKMIDIEALYPGE-IGVMIAS  270 (606)
Q Consensus       209 ------~D~~~G~I~~~RV~sG~lk~Gd~I~~~~~g~-------~~~v~----~ig~~~~~~~~v~~l~aGd-VG~ii~g  270 (606)
                            +|.-.|-++-+.+..|.|+.||.|.+-+ |-       ..+..    ++-.+..++.+...+.+|- ||     
T Consensus       262 NkPG~ev~~lkGgvaggsil~Gvlkvg~~IEiRP-Giv~kd~~g~~~C~Pi~SrI~sL~AE~n~L~~AvPGGLIG-----  335 (466)
T KOG0466         262 NKPGSEVDDLKGGVAGGSILKGVLKVGQEIEIRP-GIVTKDENGNIKCRPIFSRIVSLFAEQNDLQFAVPGGLIG-----  335 (466)
T ss_pred             CCCCCHHHCCCCCCCCCHHHHHHHHCCCEEEECC-CEEEECCCCCEEEEEHHHHHHHHHHHHCCCEEECCCCEEE-----
T ss_conf             8998412214574203055432420485888627-6155558996787567887788875323502425885564-----


Q ss_pred             CCCCCCCCCCCEECCCCCC
Q ss_conf             1002444454200046678
Q gi|254780321|r  271 IKEVSHTRVGDTITDDSSP  289 (606)
Q Consensus       271 ik~l~~~~vGDTl~~~~~p  289 (606)
                      +    .+.+--|||.++.-
T Consensus       336 V----GT~~DPtlcraDrl  350 (466)
T KOG0466         336 V----GTKMDPTLCRADRL  350 (466)
T ss_pred             E----CCCCCCCHHHHHHH
T ss_conf             1----25328540026678


No 81 
>cd03710 BipA_TypA_C BipA_TypA_C: a C-terminal portion of BipA or TypA having homology to the C terminal domains of the elongation factors EF-G and EF-2. A member of the ribosome binding GTPase superfamily, BipA is widely distributed in bacteria and plants.  BipA is a highly conserved protein with global regulatory properties in Escherichia coli. BipA is phosphorylated on a tyrosine residue under some cellular conditions. Mutants show altered regulation of some pathways. BipA functions as a translation factor that is required specifically for the expression of the transcriptional modulator Fis.  BipA binds to ribosomes at a site that coincides with that of EF-G and has a GTPase activity that is sensitive to high GDP:GTP ratios and, is stimulated  by 70S ribosomes programmed with mRNA and aminoacylated tRNAs. The growth rate-dependent induction of BipA allows the efficient expression of Fis, thereby modulating a range of downstream processes, including DNA metabolism and type III secreti
Probab=99.86  E-value=8e-22  Score=165.97  Aligned_cols=77  Identities=22%  Similarity=0.413  Sum_probs=74.5

Q ss_pred             CCEEEEEEEECCCCCHHHHHHHHHHHHEEECCCCCC-CEEEEEEEECHHHHHHHHHHHHHHHCCCEEEEEEEECCCEEC
Q ss_conf             326999998083100038999886300142443368-369999996043332204687676357418889854354643
Q gi|254780321|r  410 EPWIQVTIITPNEYLGSILKLCQERRGIQIDMSHLD-NRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDYRDS  487 (606)
Q Consensus       410 EPi~~~~I~~P~ey~G~Vm~~l~~RRG~~~~m~~~~-~~~~i~~~vPl~Eli~~f~~~LkS~T~G~as~~ye~~~Y~~~  487 (606)
                      |||++++|.+|+||+|+||++|++|||++.+|++.+ +++.++|++|++|| +||+++|+|+|+|+|+|+|+|++|+|-
T Consensus         1 EP~~~~~I~~P~e~~G~V~~~l~~Rrg~i~~~~~~~~~~~~l~~~iP~r~l-~Gf~~~Lrs~T~G~a~~~~~f~~Y~P~   78 (79)
T cd03710           1 EPIEELTIDVPEEYSGAVIEKLGKRKGEMVDMEPDGNGRTRLEFKIPSRGL-IGFRSEFLTDTRGTGIMNHVFDGYEPY   78 (79)
T ss_pred             CCEEEEEEEECHHHHHHHHHHHHHCCEEEECCEECCCCEEEEEEECCHHHH-HCCHHHHHHHCCCEEEEEEEECCEECC
T ss_conf             985999999467886899987873880997348469963999998897887-251787564367759999995562338


No 82 
>cd04097 mtEFG1_C mtEFG1_C: C-terminus of mitochondrial Elongation factor G1 (mtEFG1)-like proteins found in eukaryotes.  Eukaryotic cells harbor 2 protein synthesis systems: one localized in the cytoplasm, the other in the mitochondria. Most factors regulating mitochondrial protein synthesis are encoded by nuclear genes, translated in the cytoplasm, and then transported to the mitochondria. The eukaryotic system of elongation factor (EF) components is more complex than that in prokaryotes, with both cytoplasmic and mitochondrial elongation factors and multiple isoforms being expressed in certain species.  Eukaryotic EF-2 operates in the cytosolic protein synthesis machinery of eukaryotes, EF-Gs in protein synthesis in bacteria.  Eukaryotic mtEFG1 proteins show significant homology to bacterial EF-Gs.  Mutants in yeast mtEFG1 have impaired mitochondrial protein synthesis, respiratory defects and a tendency to lose mitochondrial DNA. There are two forms of mtEFG present in mammals (desig
Probab=99.83  E-value=9.8e-21  Score=158.67  Aligned_cols=77  Identities=26%  Similarity=0.578  Sum_probs=75.0

Q ss_pred             CCEEEEEEEECCCCCHHHHHHHHHHHHEEECCCCCCCEEEEEEEECHHHHHHHHHHHHHHHCCCEEEEEEEECCCEEC
Q ss_conf             326999998083100038999886300142443368369999996043332204687676357418889854354643
Q gi|254780321|r  410 EPWIQVTIITPNEYLGSILKLCQERRGIQIDMSHLDNRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDYRDS  487 (606)
Q Consensus       410 EPi~~~~I~~P~ey~G~Vm~~l~~RRG~~~~m~~~~~~~~i~~~vPl~Eli~~f~~~LkS~T~G~as~~ye~~~Y~~~  487 (606)
                      |||++++|.+|+||+|+||++|++|||++.+|+..++++.|++++|++|| +||.++|+|+|+|+|+|+++|+||+|.
T Consensus         1 EPi~~v~I~vP~e~~G~V~~~l~~RRG~i~~~~~~~~~~~i~a~vP~~el-~gy~~~Lrs~T~G~g~~s~~f~~y~~v   77 (78)
T cd04097           1 EPIMKVEVTAPTEFQGNVIGLLNKRKGTIVDTDTGEDEFTLEAEVPLNDM-FGYSTELRSMTQGKGEFSMEFSRYAPV   77 (78)
T ss_pred             CCEEEEEEECCHHHHHHHHHHHHHCCCEEECCCCCCCEEEEEEEECHHHH-HCCHHHHHHHCCCEEEEEEEECCCCCC
T ss_conf             98699999762798789999987768787772035995999999487886-142898786657818999982454449


No 83 
>smart00838 EFG_C Elongation factor G C-terminus. This domain includes the carboxyl terminal regions of Elongation factor G, elongation factor 2 and some tetracycline resistance proteins and adopt a ferredoxin-like fold.
Probab=99.83  E-value=1.2e-20  Score=158.15  Aligned_cols=79  Identities=28%  Similarity=0.548  Sum_probs=76.3

Q ss_pred             HHCCEEEEEEEECCCCCHHHHHHHHHHHHEEECCCCCCCEEEEEEEECHHHHHHHHHHHHHHHCCCEEEEEEEECCCEEC
Q ss_conf             62326999998083100038999886300142443368369999996043332204687676357418889854354643
Q gi|254780321|r  408 LREPWIQVTIITPNEYLGSILKLCQERRGIQIDMSHLDNRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDYRDS  487 (606)
Q Consensus       408 i~EPi~~~~I~~P~ey~G~Vm~~l~~RRG~~~~m~~~~~~~~i~~~vPl~Eli~~f~~~LkS~T~G~as~~ye~~~Y~~~  487 (606)
                      ++|||++++|.+|++|+|+||++|++|||++.+|++.++..+|.|.+|++|+ +||+++|||+|+|+|+|+++|+||++.
T Consensus         1 LLEPi~~~~I~~P~~~~G~V~~~l~~RRG~i~~~~~~~~~~~i~a~vP~~e~-~gf~~~Lrs~T~G~g~~~~~f~~ye~v   79 (85)
T smart00838        1 LLEPIMKVEVTVPEEYMGDVIGDLNSRRGKIEGMEQRGGAQVIKAKVPLSEM-FGYATDLRSATQGRATWSMEFSHYEEV   79 (85)
T ss_pred             CCCCEEEEEEEECHHHHHHHHHHHHHCCCEEEEEEECCCEEEEEEEEEHHHH-HHHHHHHHHHCCCCEEEEEEECCCCCC
T ss_conf             9787699999978899999999988658289705745990999999877887-549999996488938999997568409


No 84 
>cd01895 EngA2 EngA2 subfamily.  This CD represents the second GTPase domain of EngA and its orthologs, which are composed of two adjacent GTPase domains.  Since the sequences of the two domains are more similar to each other than to other GTPases, it is likely that an ancient gene duplication, rather than a fusion of evolutionarily distinct GTPases, gave rise to this family.  Although the exact function of these proteins has not been elucidated, studies have revealed that the E. coli EngA homolog, Der, and Neisseria gonorrhoeae EngA are essential for cell viability. A recent report suggests that E. coli Der functions in ribosome assembly and stability.
Probab=99.83  E-value=2.3e-19  Score=149.46  Aligned_cols=154  Identities=29%  Similarity=0.439  Sum_probs=110.1

Q ss_pred             EEEEECCCCCCHHHHHHHHHHHCCCCCCCCCCCEEECCCHHHHHHCCEEEEEEEEEEEECCCCCEEEEEEEECCCC----
Q ss_conf             7999801389877889999998298054444311305867798719505232799997437884389999617873----
Q gi|254780321|r   13 NFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVRLNYTSTDAKDYQLNLIDTPGH----   88 (606)
Q Consensus        13 N~~IiaHvDhGKTTL~d~lL~~tg~i~~~~~~~~vlD~~~~EreRGITIka~~~~~~~~~~~~~~y~iNlIDTPGH----   88 (606)
                      ++||+|+..+|||||..+|+   |.  ++..   +      ....|.|.......+.     +++..+.|+||||-    
T Consensus         4 ~V~ivG~pN~GKSTL~N~l~---g~--~~~~---v------s~~pgtTr~~~~~~~~-----~~~~~~~~vDtpGi~~~~   64 (174)
T cd01895           4 RIAIIGRPNVGKSSLVNALL---GE--ERVI---V------SDIAGTTRDSIDVPFE-----YDGKKYTLIDTAGIRRKG   64 (174)
T ss_pred             EEEEECCCCCCHHHHHHHHH---CC--CCEE---E------CCCCCCEEECCEEEEE-----ECCEEEEEEECCCCCCCC
T ss_conf             99999899998999999983---89--8444---3------4999915733289999-----999889998578842134


Q ss_pred             -----CHHHHHHHHH---HHHCCEEEEEEECCCCCCHHHHHHHHHHHHCCCCEEEEECCCCCCCCC---CCCHHHHHHHH
Q ss_conf             -----0027999999---973026899998687886558999999997099679983267887532---11338887755
Q gi|254780321|r   89 -----VDFTYEVSRS---LSACEGSLLVVDATQGVEAQTLANVYQAIDNNHEIITVLNKADLPSAD---PDRVKKQIEET  157 (606)
Q Consensus        89 -----~DF~~EV~r~---l~a~dgaiLvVdA~~Gvq~QT~~~~~~A~~~~l~~I~viNKiD~~~A~---~e~v~~ei~~~  157 (606)
                           .++ ..+.++   +.-||-+++|+||.+|++.|....+....+.+.|+++|+||+|+...+   .++..+++++.
T Consensus        65 ~~~~~~e~-~~~~~~~~~i~~~dvil~viDa~~~~~~~d~~i~~~l~~~~~p~iiv~NK~Dli~~~~~~~~~~~~~~~~~  143 (174)
T cd01895          65 KVEEGIEK-YSVLRTLKAIERADVVLLVIDATEGITEQDLRIAGLILEEGKALVIVVNKWDLVEKDSKTMKEFKKEIRRK  143 (174)
T ss_pred             CCCCHHHH-HHHHHHHHHHHHCCCEEEEEECCCCCCHHHHHHHHHHHHCCCCEEEEEECEECCCCCHHHHHHHHHHHHHH
T ss_conf             42106889-99999999998428658997589899889999999999859986999856752676477899999999987


Q ss_pred             HH-HHHHHHHHHHHHCCCCCCHHHHHHHHH
Q ss_conf             53-223210001110022320067877632
Q gi|254780321|r  158 IG-ISTEDALLVSAKTGEGIPLLLERIVQQ  186 (606)
Q Consensus       158 ~g-~~~~~ii~vSAktG~GV~~LLd~Iv~~  186 (606)
                      +. +...+++++||++|.|+++|+++|.+.
T Consensus       144 ~~~~~~~~ii~iSA~~g~Gi~~L~~~I~ei  173 (174)
T cd01895         144 LPFLDYAPIVFISALTGQGVDKLFDAIDEV  173 (174)
T ss_pred             HCCCCCCCEEEEECCCCCCHHHHHHHHHHH
T ss_conf             341689928999744798999999999986


No 85 
>cd03713 EFG_mtEFG_C EFG_mtEFG_C: domains similar to the C-terminal domain of the bacterial translational elongation factor (EF) EF-G.  Included in this group is the C-terminus of mitochondrial Elongation factor G1 (mtEFG1) and G2 (mtEFG2) proteins. Eukaryotic cells harbor 2 protein synthesis systems: one localized in the cytoplasm, the other in the mitochondria. Most factors regulating mitochondrial protein synthesis are encoded by nuclear genes, translated in the cytoplasm, and then transported to the mitochondria. The eukaryotic system of elongation factor (EF) components is more complex than that in prokaryotes, with both cytoplasmic and mitochondrial elongation factors and multiple isoforms being expressed in certain species. During the process of peptide synthesis and tRNA site changes, the ribosome is moved along the mRNA a distance equal to one codon with the addition of each amino acid. In bacteria this translocation step is catalyzed by EF-G_GTP, which is hydrolyzed to provide
Probab=99.81  E-value=7.3e-20  Score=152.83  Aligned_cols=77  Identities=29%  Similarity=0.566  Sum_probs=75.0

Q ss_pred             CCEEEEEEEECCCCCHHHHHHHHHHHHEEECCCCCCCEEEEEEEECHHHHHHHHHHHHHHHCCCEEEEEEEECCCEEC
Q ss_conf             326999998083100038999886300142443368369999996043332204687676357418889854354643
Q gi|254780321|r  410 EPWIQVTIITPNEYLGSILKLCQERRGIQIDMSHLDNRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDYRDS  487 (606)
Q Consensus       410 EPi~~~~I~~P~ey~G~Vm~~l~~RRG~~~~m~~~~~~~~i~~~vPl~Eli~~f~~~LkS~T~G~as~~ye~~~Y~~~  487 (606)
                      |||++++|.+|++|+|+||++|++|||++.+|+..++++.|++++|++|+ +||+++|||+|+|+|+|+|+|+||++.
T Consensus         1 EP~~~~~I~~p~e~~g~v~~~l~~rrg~i~~~~~~~~~~~i~~~iP~~e~-~gf~~~Lrs~T~G~a~~~~~f~~y~~~   77 (78)
T cd03713           1 EPIMKVEVTVPEEYMGDVIGDLSSRRGQILGTESRGGWKVIKAEVPLAEM-FGYSTDLRSLTQGRGSFTMEFSHYEEV   77 (78)
T ss_pred             CCEEEEEEEECHHHHHHHHHHHHHCCCCEECCEECCCEEEEEEECCHHHH-HCHHHHHHHHCCCCEEEEEEECCCCCC
T ss_conf             99799999978899999999998706822530335880999999086887-478999887588918999883443008


No 86 
>cd03711 Tet_C Tet_C: C-terminus of ribosomal protection proteins Tet(M) and Tet(O). This domain has homology to the C terminal domains of the elongation factors EF-G and EF-2. Tet(M) and Tet(O) catalyze the release of tetracycline (Tc) from the ribosome in a GTP-dependent manner thereby mediating Tc resistance.  Tcs are broad-spectrum antibiotics.  Typical Tcs bind to the ribosome and inhibit the elongation phase of protein synthesis, by inhibiting the  occupation of site A by aminoacyl-tRNA.
Probab=99.80  E-value=1.9e-19  Score=150.11  Aligned_cols=77  Identities=17%  Similarity=0.289  Sum_probs=75.0

Q ss_pred             CCEEEEEEEECCCCCHHHHHHHHHHHHEEECCCCCCCEEEEEEEECHHHHHHHHHHHHHHHCCCEEEEEEEECCCEEC
Q ss_conf             326999998083100038999886300142443368369999996043332204687676357418889854354643
Q gi|254780321|r  410 EPWIQVTIITPNEYLGSILKLCQERRGIQIDMSHLDNRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDYRDS  487 (606)
Q Consensus       410 EPi~~~~I~~P~ey~G~Vm~~l~~RRG~~~~m~~~~~~~~i~~~vPl~Eli~~f~~~LkS~T~G~as~~ye~~~Y~~~  487 (606)
                      |||++++|.+|++|+|+||++|++|||++.+++..+++++|++++|++|+ +||.++|+|+|+|+|+|+++|+||+|.
T Consensus         1 EPi~~~~i~vP~e~~G~v~~~L~~rrg~i~~~~~~~~~~~i~~~~P~ae~-~~y~~~Lrs~T~G~g~~~~~f~~Y~Pc   77 (78)
T cd03711           1 EPYLRFELEVPQDALGRAMSDLAKMGATFEDPQIKGDEVTLEGTIPVATS-QDYQSELPSYTHGEGVLETEFKGYRPC   77 (78)
T ss_pred             CCEEEEEEECCHHHHHHHHHHHHHCCCEEECCEECCCEEEEEEEECHHHH-HHHHHHHHHHCCCEEEEEEEECCEECC
T ss_conf             98499999825898999999998769887680883996999999877886-318897175488859999897973378


No 87 
>pfam00679 EFG_C Elongation factor G C-terminus. This domain includes the carboxyl terminal regions of Elongation factor G, elongation factor 2 and some tetracycline resistance proteins and adopt a ferredoxin-like fold.
Probab=99.80  E-value=1.1e-19  Score=151.54  Aligned_cols=82  Identities=34%  Similarity=0.574  Sum_probs=77.4

Q ss_pred             HHCCEEEEEEEECCCCCHHHHHHHHHHHHEEECCCCC-CCEEEEEEEECHHHHHHHHHHHHHHHCCCEEEEEEEECCCEE
Q ss_conf             6232699999808310003899988630014244336-836999999604333220468767635741888985435464
Q gi|254780321|r  408 LREPWIQVTIITPNEYLGSILKLCQERRGIQIDMSHL-DNRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDYRD  486 (606)
Q Consensus       408 i~EPi~~~~I~~P~ey~G~Vm~~l~~RRG~~~~m~~~-~~~~~i~~~vPl~Eli~~f~~~LkS~T~G~as~~ye~~~Y~~  486 (606)
                      ++|||++++|.+|++|+|+||++|++|||++.++++. ++++.|+|.+|++|++ ||+++|+|+|+|+|+|+|+|.+|++
T Consensus         2 llEP~~~~~i~~p~~~~g~v~~~l~~rrg~i~~~~~~~~~~~~i~~~iP~~~~~-gf~~~L~s~T~G~a~~~~~f~~y~~   80 (89)
T pfam00679         2 LLEPIMKVEITVPEEYLGDVIGDLNKRRGEILDMEPIGGGRVVIEAEVPLAELF-GFSTELRSLTQGRGSFSMEFSGYEP   80 (89)
T ss_pred             EECCEEEEEEEECHHHHHHHHHHHHHHCCEEECCEECCCCEEEEEEEEEHHHHH-HHHHHHHHCCCCCCEEEEEECCEEE
T ss_conf             678289999998889999999999870683557477589879999997215766-7875886138997189999535037


Q ss_pred             CCEE
Q ss_conf             3667
Q gi|254780321|r  487 SDLV  490 (606)
Q Consensus       487 ~dlv  490 (606)
                      ....
T Consensus        81 ~~~~   84 (89)
T pfam00679        81 VPGD   84 (89)
T ss_pred             CCCC
T ss_conf             8979


No 88 
>cd01894 EngA1 EngA1 subfamily.  This CD represents the first GTPase domain of EngA and its orthologs, which are composed of two adjacent GTPase domains.  Since the sequences of the two domains are more similar to each other than to other GTPases, it is likely that an ancient gene duplication, rather than a fusion of evolutionarily distinct GTPases, gave rise to this family. Although the exact function of these proteins has not been elucidated, studies have revealed that the E. coli EngA homolog, Der, and Neisseria gonorrhoeae EngA are essential for cell viability.  A recent report suggests that E. coli Der functions in ribosome assembly and stability.
Probab=99.77  E-value=8.7e-18  Score=138.88  Aligned_cols=149  Identities=26%  Similarity=0.295  Sum_probs=106.1

Q ss_pred             EEECCCCCCHHHHHHHHHHHCCCCCCCCCCCEEECCCHHHHHHCCEEEEEEEEEEEECCCCCEEEEEEEECCCCCHHH--
Q ss_conf             998013898778899999982980544443113058677987195052327999974378843899996178730027--
Q gi|254780321|r   15 SIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVRLNYTSTDAKDYQLNLIDTPGHVDFT--   92 (606)
Q Consensus        15 ~IiaHvDhGKTTL~d~lL~~tg~i~~~~~~~~vlD~~~~EreRGITIka~~~~~~~~~~~~~~y~iNlIDTPGH~DF~--   92 (606)
                      ||+|...+|||||..+|+   |.  +...   +.+      .-|.|.......+.     ++++.+.|+||||+.+..  
T Consensus         1 aivG~pN~GKSsL~N~l~---~~--~~~i---vs~------~~gtTr~~~~~~~~-----~~~~~~~lvDTpG~~~~~~~   61 (157)
T cd01894           1 AIVGRPNVGKSTLFNRLT---GR--RDAI---VED------TPGVTRDRIYGEAE-----WGGREFILIDTGGIEPDDEG   61 (157)
T ss_pred             CCCCCCCCCHHHHHHHHH---CC--CCEE---EEC------CCCCEEEEEEEEEE-----ECCEEEEEEECCCCCCCCCH
T ss_conf             904899988999999995---88--7535---407------99935667899999-----99988999857875556606


Q ss_pred             --HH----HHHHHHHCCEEEEEEECCCCCCHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCCHHHHHHHHHHHHHHHHH
Q ss_conf             --99----999997302689999868788655899999999709967998326788753211338887755532232100
Q gi|254780321|r   93 --YE----VSRSLSACEGSLLVVDATQGVEAQTLANVYQAIDNNHEIITVLNKADLPSADPDRVKKQIEETIGISTEDAL  166 (606)
Q Consensus        93 --~E----V~r~l~a~dgaiLvVdA~~Gvq~QT~~~~~~A~~~~l~~I~viNKiD~~~A~~e~v~~ei~~~~g~~~~~ii  166 (606)
                        .+    ...++.-+|.+++|+||.+|+..+....+....+.+.|+++|+||+|+..  .+....++.. ++  -.+++
T Consensus        62 ~~~~~~~~~~~~i~~ad~il~viDa~~~~~~~d~~i~~~l~~~~kp~i~v~NK~D~~~--~~~~~~~~~~-l~--~~~~i  136 (157)
T cd01894          62 ISKEIREQAELAIEEADVILFVVDGREGLTPADEEIAKYLRKSKKPVILVVNKVDNIK--EEDEAAEFYS-LG--FGEPI  136 (157)
T ss_pred             HHHHHHHHHHHHHHHCCEEEEEEECCCCCCHHHHHHHHHHHHHCCCEEEEEECCCCCC--CHHHHHHHHH-CC--CCCEE
T ss_conf             7899999999999865907999989999998999999999984798099997871658--6456999996-59--99759


Q ss_pred             HHHHHCCCCCCHHHHHHHHHH
Q ss_conf             011100223200678776321
Q gi|254780321|r  167 LVSAKTGEGIPLLLERIVQQL  187 (606)
Q Consensus       167 ~vSAktG~GV~~LLd~Iv~~i  187 (606)
                      ++||++|.|++.|+|.|++.+
T Consensus       137 ~iSA~~g~Gid~L~~~I~~~L  157 (157)
T cd01894         137 PISAEHGRGIGDLLDAILELL  157 (157)
T ss_pred             EEEEECCCCHHHHHHHHHHHC
T ss_conf             999658949999999999659


No 89 
>cd04163 Era Era subfamily.  Era (E. coli Ras-like protein) is a multifunctional GTPase found in all bacteria except some eubacteria.  It binds to the 16S ribosomal RNA (rRNA) of the 30S subunit and appears to play a role in the assembly of the 30S subunit, possibly by chaperoning the 16S rRNA.  It also contacts several assembly elements of the 30S subunit.  Era couples cell growth with cytokinesis and plays a role in cell division and energy metabolism.  Homologs have also been found in eukaryotes. Era contains two domains: the N-terminal GTPase domain and a C-terminal domain KH domain that is critical for RNA binding.  Both domains are important for Era function.  Era is functionally able to compensate for deletion of RbfA, a cold-shock adaptation protein that is required for efficient processing of the 16S rRNA.
Probab=99.77  E-value=1.4e-17  Score=137.54  Aligned_cols=155  Identities=26%  Similarity=0.274  Sum_probs=105.9

Q ss_pred             EEEEECCCCCCHHHHHHHHHHHCCCCCCCCCCCEEECCCHHHHHHCCEEEEEEEEEEEECCCCCEEEEEEEECCCCCHH-
Q ss_conf             7999801389877889999998298054444311305867798719505232799997437884389999617873002-
Q gi|254780321|r   13 NFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVRLNYTSTDAKDYQLNLIDTPGHVDF-   91 (606)
Q Consensus        13 N~~IiaHvDhGKTTL~d~lL~~tg~i~~~~~~~~vlD~~~~EreRGITIka~~~~~~~~~~~~~~y~iNlIDTPGH~DF-   91 (606)
                      ++||+|+..+|||||..+|+   |.  +..   .+.+      .-|.|-.  .+.-.+   .++++++.|+||||...- 
T Consensus         5 ~V~ivG~pN~GKSsL~N~L~---~~--~~a---~vs~------~~gtTr~--~~~~~~---~~~~~~~~l~DtpG~~~~~   65 (168)
T cd04163           5 FVAIVGRPNVGKSTLLNALV---GQ--KIS---IVSP------KPQTTRN--RIRGIY---TDDDAQIIFVDTPGIHKPK   65 (168)
T ss_pred             EEEEECCCCCCHHHHHHHHH---CC--CEE---EECC------CCCEEEC--CCEEEE---EECCEEEEEEECCCCCCCH
T ss_conf             89999999999999999995---89--703---3238------8982634--423689---8499789999589866514


Q ss_pred             -------HHHHHHHHHHCCEEEEEEECCCCCCHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCCHHHHHHHHHH-HHHH
Q ss_conf             -------79999999730268999986878865589999999970996799832678875321133888775553-2232
Q gi|254780321|r   92 -------TYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQAIDNNHEIITVLNKADLPSADPDRVKKQIEETIG-ISTE  163 (606)
Q Consensus        92 -------~~EV~r~l~a~dgaiLvVdA~~Gvq~QT~~~~~~A~~~~l~~I~viNKiD~~~A~~e~v~~ei~~~~g-~~~~  163 (606)
                             .....+++.-||.+++|+||.+|...+....+....+.+.|+++|+||+|+... .+...+.++.... ....
T Consensus        66 ~~~~~~~~~~~~~~l~~~D~il~vvD~~~~~~~~d~~i~~~l~~~~~~~iivlNK~Dl~~~-~~~~~~~~~~~~~~~~~~  144 (168)
T cd04163          66 KKLGERMVKAAWSALKDVDLVLFVVDASEPIGEGDEFILELLKKSKTPVILVLNKIDLVKD-KEDLLPLLEKLKELGPFA  144 (168)
T ss_pred             HHHHHHHHHHHHHHHHCCCEEEEEEECCCCCCHHHHHHHHHHHHCCCCEEEEEECEEECCC-HHHHHHHHHHHHHHCCCC
T ss_conf             5677899999998651365589999789898667799999999809985999978870478-778999999999618999


Q ss_pred             HHHHHHHHCCCCCCHHHHHHHHHH
Q ss_conf             100011100223200678776321
Q gi|254780321|r  164 DALLVSAKTGEGIPLLLERIVQQL  187 (606)
Q Consensus       164 ~ii~vSAktG~GV~~LLd~Iv~~i  187 (606)
                      +++++||++|.|+++|+++|++++
T Consensus       145 ~vi~iSA~~g~Gid~L~~~i~~~L  168 (168)
T cd04163         145 EIFPISALKGENVDELLEEIVKYL  168 (168)
T ss_pred             CEEEEECCCCCCHHHHHHHHHHHC
T ss_conf             689997778969999999999539


No 90 
>cd00880 Era_like Era (E. coli Ras-like protein)-like.  This family includes several distinct subfamilies (TrmE/ThdF, FeoB, YihA (EngG), Era, and EngA/YfgK) that generally show sequence conservation in the region between the Walker A and B motifs (G1 and G3 box motifs), to the exclusion of other GTPases. TrmE is ubiquitous in bacteria and is a widespread mitochondrial protein in eukaryotes, but is absent from archaea. The yeast member of TrmE family, MSS1, is involved in mitochondrial translation; bacterial members are often present in translation-related operons.  FeoB represents an unusual adaptation of GTPases for high-affinity iron (II) transport. YihA (EngB) family of GTPases is typified by the E. coli YihA, which is an essential protein involved in cell division control.  Era is characterized by a distinct derivative of the KH domain (the pseudo-KH domain) which is located C-terminal to the GTPase domain.  EngA and its orthologs are composed of two GTPase domains and, since the se
Probab=99.76  E-value=1.1e-17  Score=138.21  Aligned_cols=154  Identities=25%  Similarity=0.249  Sum_probs=107.8

Q ss_pred             EECCCCCCHHHHHHHHHHHCCCCCCCCCCCEEECCCHHHHHHCCEEEEEEEEEEEECCCCCEEEEEEEECCCCCHH----
Q ss_conf             9801389877889999998298054444311305867798719505232799997437884389999617873002----
Q gi|254780321|r   16 IVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVRLNYTSTDAKDYQLNLIDTPGHVDF----   91 (606)
Q Consensus        16 IiaHvDhGKTTL~d~lL~~tg~i~~~~~~~~vlD~~~~EreRGITIka~~~~~~~~~~~~~~y~iNlIDTPGH~DF----   91 (606)
                      |||+..+|||||..+|+   |.  +...   +      ....|.|.......+.+  .  ....+.|+||||+.+.    
T Consensus         1 ivG~~N~GKStL~N~L~---~~--~~~~---v------s~~~gtT~~~~~~~~~~--~--~~~~i~lvDtpG~~~~~~~~   62 (163)
T cd00880           1 LFGRTNAGKSSLLNALL---GQ--EVAI---V------SPVPGTTTDPVEYVWEL--G--PLGPVVLIDTPGIDEAGGLG   62 (163)
T ss_pred             CCCCCCCCHHHHHHHHH---CC--CCCE---E------CCCCCEECCCEEEEEEE--C--CCCEEEEEECCCCCCCCCHH
T ss_conf             91979989999999995---89--9610---1------69899865645899995--4--78659997279852223101


Q ss_pred             ---HHHHHHHHHHCCEEEEEEECCCCCCHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCCHH-HHH-HHHHHHHHHHHH
Q ss_conf             ---799999997302689999868788655899999999709967998326788753211338-887-755532232100
Q gi|254780321|r   92 ---TYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQAIDNNHEIITVLNKADLPSADPDRVK-KQI-EETIGISTEDAL  166 (606)
Q Consensus        92 ---~~EV~r~l~a~dgaiLvVdA~~Gvq~QT~~~~~~A~~~~l~~I~viNKiD~~~A~~e~v~-~ei-~~~~g~~~~~ii  166 (606)
                         ...+.+++.-+|.+++||||..+...+....+......+.|+|+|+||+|+...+.++.. +.. .........+++
T Consensus        63 ~~~~~~~~~~~~~~D~il~viD~~~~~~~~~~~~l~~l~~~~~p~i~v~NK~D~~~~~~~~~~~~~~~~~~~~~~~~~i~  142 (163)
T cd00880          63 REREELARRVLERADLILFVVDADLRADEEEEKLLELLRERGKPVLLVLNKIDLLPEEEEEELLELRLLILLLLLGLPVI  142 (163)
T ss_pred             HHHHHHHHHHHHHCCEEEEEEECCCCCCHHHHHHHHHHHHHCCCEEEEEECEECCCHHHHHHHHHHHHHHHHHCCCCEEE
T ss_conf             68999999999868989999878999755669999999971974278853420678789999999999998767998599


Q ss_pred             HHHHHCCCCCCHHHHHHHHHH
Q ss_conf             011100223200678776321
Q gi|254780321|r  167 LVSAKTGEGIPLLLERIVQQL  187 (606)
Q Consensus       167 ~vSAktG~GV~~LLd~Iv~~i  187 (606)
                      ++||++|.|+++|++.|++.+
T Consensus       143 ~iSA~~g~gi~~L~~~i~e~L  163 (163)
T cd00880         143 AVSALTGEGIDELREALIEAL  163 (163)
T ss_pred             EEECCCCCCHHHHHHHHHHHC
T ss_conf             997898979999999999519


No 91 
>cd01876 YihA_EngB The YihA (EngB) subfamily.  This subfamily of GTPases is typified by the E. coli YihA, an essential protein involved in cell division control.  YihA and its orthologs are small proteins that typically contain less than 200 amino acid residues and consists of the GTPase domain only (some of the eukaryotic homologs contain an N-terminal extension of about 120 residues that might be involved in organellar targeting).  Homologs of yihA are found in most Gram-positive and Gram-negative pathogenic bacteria, with the exception of Mycobacterium tuberculosis.  The broad-spectrum nature of YihA and its essentiality for cell viability in bacteria make it an attractive antibacterial target.
Probab=99.76  E-value=1.1e-17  Score=138.14  Aligned_cols=153  Identities=22%  Similarity=0.324  Sum_probs=103.4

Q ss_pred             EEEECCCCCCHHHHHHHHHHHCCCCCCCCCCCEEECCCHHHHHHCCEEEEEEEEEEEECCCCCEEEEEEEECCCC--C--
Q ss_conf             999801389877889999998298054444311305867798719505232799997437884389999617873--0--
Q gi|254780321|r   14 FSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVRLNYTSTDAKDYQLNLIDTPGH--V--   89 (606)
Q Consensus        14 ~~IiaHvDhGKTTL~d~lL~~tg~i~~~~~~~~vlD~~~~EreRGITIka~~~~~~~~~~~~~~y~iNlIDTPGH--~--   89 (606)
                      |||+|+..+|||||.-+|+-... +..      +.      ..-|.|-.     +.+...+   ..+.|+||||.  .  
T Consensus         2 IaivG~pN~GKSTL~N~L~~~~~-~~~------vs------~~~gtTr~-----i~~~~~~---~~~~~vDtPG~g~~~~   60 (170)
T cd01876           2 IAFAGRSNVGKSSLINALTNRKK-LAR------TS------KTPGKTQL-----INFFNVN---DKFRLVDLPGYGYAKV   60 (170)
T ss_pred             EEEECCCCCCHHHHHHHHHCCCC-EEE------EE------CCCCEEEE-----EEEEEEC---CEEEEEECCCCHHCCC
T ss_conf             89998999999999999968996-278------60------78977852-----0588538---7799996578401016


Q ss_pred             ------HHHHHHHHHHH---HCCEEEEEEECCCCCCHHHHHHHHHHHHCCCCEEEEECCCCCCC-CCCCCHHHHHHHHHH
Q ss_conf             ------02799999997---30268999986878865589999999970996799832678875-321133888775553
Q gi|254780321|r   90 ------DFTYEVSRSLS---ACEGSLLVVDATQGVEAQTLANVYQAIDNNHEIITVLNKADLPS-ADPDRVKKQIEETIG  159 (606)
Q Consensus        90 ------DF~~EV~r~l~---a~dgaiLvVdA~~Gvq~QT~~~~~~A~~~~l~~I~viNKiD~~~-A~~e~v~~ei~~~~g  159 (606)
                            .|.....+.++   .++.+++|+||..|++.|.+..+....+.+.|+|+|+||+|+-. .+..+...++...++
T Consensus        61 ~~~~~~~~~~~~~~~l~~~~~~~~vi~viD~~~~~~~~d~~i~~~l~~~~kp~iiVlNKiDlv~~~~~~~~~~~~~~~l~  140 (170)
T cd01876          61 SKEVKEKWGKLIEEYLENRENLKGVVLLIDSRHGPTEIDLEMLDWLEELGIPFLVVLTKADKLKKSELAKALKEIKKELK  140 (170)
T ss_pred             CHHHHHHHHHHHHHHHHHHHHHCEEEEEEECCCCCCHHHHHHHHHHHHCCCCEEEEEEEEECCCHHHHHHHHHHHHHHHH
T ss_conf             87799999999999998406334999999632237486899999998769987999986753787789999999999874


Q ss_pred             H--HHHHHHHHHHHCCCCCCHHHHHHHHHH
Q ss_conf             2--232100011100223200678776321
Q gi|254780321|r  160 I--STEDALLVSAKTGEGIPLLLERIVQQL  187 (606)
Q Consensus       160 ~--~~~~ii~vSAktG~GV~~LLd~Iv~~i  187 (606)
                      .  ...+++++||++|.||++|+++|.+++
T Consensus       141 ~~~~~~~ii~iSA~~g~gi~~L~~~I~~~L  170 (170)
T cd01876         141 LFEIDPPIILFSSLKGQGIDELRALIEKWL  170 (170)
T ss_pred             CCCCCCEEEEEECCCCCCHHHHHHHHHHHC
T ss_conf             217998399998899977999999999859


No 92 
>PRK00089 era GTP-binding protein Era; Reviewed
Probab=99.76  E-value=2.8e-17  Score=135.51  Aligned_cols=158  Identities=25%  Similarity=0.290  Sum_probs=113.0

Q ss_pred             CEEEEEECCCCCCHHHHHHHHHHHCCCCCCCCCCCEEECCCHHHHHHCCEEEEEEEEEEEECCCCCEEEEEEEECCCCCH
Q ss_conf             31799980138987788999999829805444431130586779871950523279999743788438999961787300
Q gi|254780321|r   11 IRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVRLNYTSTDAKDYQLNLIDTPGHVD   90 (606)
Q Consensus        11 IRN~~IiaHvDhGKTTL~d~lL~~tg~i~~~~~~~~vlD~~~~EreRGITIka~~~~~~~~~~~~~~y~iNlIDTPGH~D   90 (606)
                      -=.+||||--..|||||.-+|+-.--++..+..              |-|-.  .+.-.+   .++++++.|+||||-.+
T Consensus         8 sG~VaivG~PNvGKSTL~N~l~~~k~siVS~k~--------------~TTR~--~i~gi~---~~~~~q~i~iDTpGi~~   68 (296)
T PRK00089          8 SGFVAIVGRPNVGKSTLLNALVGQKISIVSPKP--------------QTTRH--RIRGIV---TEDDAQIIFVDTPGIHK   68 (296)
T ss_pred             EEEEEEECCCCCCHHHHHHHHHCCCEEEECCCC--------------CCCCC--CEEEEE---EECCEEEEEEECCCCCC
T ss_conf             799999989998889999999689617614959--------------98728--389999---97997999998998667


Q ss_pred             --------HHHHHHHHHHHCCEEEEEEECCCCCCHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCCHHHHHHHHHH-HH
Q ss_conf             --------279999999730268999986878865589999999970996799832678875321133888775553-22
Q gi|254780321|r   91 --------FTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQAIDNNHEIITVLNKADLPSADPDRVKKQIEETIG-IS  161 (606)
Q Consensus        91 --------F~~EV~r~l~a~dgaiLvVdA~~Gvq~QT~~~~~~A~~~~l~~I~viNKiD~~~A~~e~v~~ei~~~~g-~~  161 (606)
                              +...+.+++.-+|-+++|+||.+|+..|....+....+.+.|+|+|+||+|+.  +.+++.+.+.++-. +.
T Consensus        69 ~~~~l~~~~~~~~~~ai~~aDlil~viD~~~~~~~~d~~i~~~l~~~~kp~ilviNKiDlv--~k~~l~~~~~~l~~~~~  146 (296)
T PRK00089         69 PKRALNRAMNKAAWSSLKDVDLVLFVVDADEKIGPGDEFILEKLKKVKTPVILVLNKIDLV--DKEELLPLLEELSELMD  146 (296)
T ss_pred             CHHHHHHHHHHHHHHHHHHCCEEEEEEECCCCCCHHHHHHHHHHHHCCCCEEEEEEHHHHC--CHHHHHHHHHHHHHHCC
T ss_conf             4677878999999999975999999985788989889999998887499889995478842--89889999999985379


Q ss_pred             HHHHHHHHHHCCCCCCHHHHHHHHHHHC
Q ss_conf             3210001110022320067877632100
Q gi|254780321|r  162 TEDALLVSAKTGEGIPLLLERIVQQLPS  189 (606)
Q Consensus       162 ~~~ii~vSAktG~GV~~LLd~Iv~~iP~  189 (606)
                      ..+++++||++|.|++.|++.|.+++|+
T Consensus       147 f~~if~iSA~~~~gi~~L~~~l~~~lp~  174 (296)
T PRK00089        147 FAEIVPISALKGDNVDELLDLIAKYLPE  174 (296)
T ss_pred             CCEEEEEECCCCCCHHHHHHHHHHHCCC
T ss_conf             7659999677888989999999986798


No 93 
>cd04096 eEF2_snRNP_like_C eEF2_snRNP_like_C: this family represents a C-terminal domain of eukaryotic elongation factor 2 (eEF-2) and a homologous domain of the spliceosomal human 116kD U5 small nuclear ribonucleoprotein (snRNP) protein (U5-116 kD) and, its yeast counterpart Snu114p.  Yeast Snu114p is essential for cell viability and for splicing in vivo. U5-116 kD binds GTP.  Experiments suggest that GTP binding and probably GTP hydrolysis is important for the function of the U5-116 kD/Snu114p.   In complex with GTP, EF-2 promotes the translocation step of translation. During translocation the peptidyl-tRNA is moved from the A site to the P site, the uncharged tRNA from the P site to the E-site and, the mRNA is shifted one codon relative to the ribosome.
Probab=99.75  E-value=3.9e-18  Score=141.21  Aligned_cols=77  Identities=26%  Similarity=0.316  Sum_probs=72.9

Q ss_pred             CCEEEEEEEECCCCCHHHHHHHHHHHHEEECCCCCC--CEEEEEEEECHHHHHHHHHHHHHHHCCCEEEEEEEECCCEEC
Q ss_conf             326999998083100038999886300142443368--369999996043332204687676357418889854354643
Q gi|254780321|r  410 EPWIQVTIITPNEYLGSILKLCQERRGIQIDMSHLD--NRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDYRDS  487 (606)
Q Consensus       410 EPi~~~~I~~P~ey~G~Vm~~l~~RRG~~~~m~~~~--~~~~i~~~vPl~Eli~~f~~~LkS~T~G~as~~ye~~~Y~~~  487 (606)
                      |||++++|.+|++|+|+|++++++|||++.+++...  +...|.|.+|++|+ +||.++|+|+|+|.|+|.++|+||++-
T Consensus         1 EPi~~veI~~p~~~~g~V~~~L~~RRG~I~~~~~~~g~~~~~I~a~vP~~e~-fg~~~~LRs~T~G~a~~~~~F~~y~~v   79 (80)
T cd04096           1 EPIYLVEIQCPEDALGKVYSVLSKRRGHVLSEEPKEGTPLFEIKAYLPVIES-FGFETDLRSATSGQAFPQLVFSHWEIV   79 (80)
T ss_pred             CCEEEEEEEECHHHHHHHHHHHHHCCCEEEEEEEECCCCEEEEEEEECHHHH-HCHHHHHHHHCCCCCEEEEEECCCCCC
T ss_conf             9859999998889988999988447858843100069976999999057997-184899996577971799896423228


No 94 
>cd01514 Elongation_Factor_C Elongation factor G C-terminus. This domain includes the carboxyl terminal regions of elongation factors (EFs) bacterial EF-G, eukaryotic and archeal EF-2 and eukaryotic mitochondrial mtEFG1s and mtEFG2s. This group also includes proteins similar to the ribosomal protection proteins Tet(M) and Tet(O), BipA, LepA and, spliceosomal proteins: human 116kD U5 small nuclear ribonucleoprotein (snRNP) protein (U5-116 kD) and yeast counterpart Snu114p.  This domain adopts a ferredoxin-like fold consisting of an alpha-beta sandwich with anti-parallel beta-sheets, resembling the topology of domain III found in the elongation factors EF-G and eukaryotic EF-2, with which it forms the C-terminal block. The two domains however are not superimposable and domain III lacks some of the characteristics of this domain.  EF-2/EF-G in complex with GTP, promotes the translocation step of translation. During translocation the peptidyl-tRNA is moved from the A site to the P site, the
Probab=99.74  E-value=5e-18  Score=140.51  Aligned_cols=78  Identities=37%  Similarity=0.626  Sum_probs=75.1

Q ss_pred             CCEEEEEEEECCCCCHHHHHHHHHHHHEEECCCCCC-CEEEEEEEECHHHHHHHHHHHHHHHCCCEEEEEEEECCCEECC
Q ss_conf             326999998083100038999886300142443368-3699999960433322046876763574188898543546436
Q gi|254780321|r  410 EPWIQVTIITPNEYLGSILKLCQERRGIQIDMSHLD-NRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDYRDSD  488 (606)
Q Consensus       410 EPi~~~~I~~P~ey~G~Vm~~l~~RRG~~~~m~~~~-~~~~i~~~vPl~Eli~~f~~~LkS~T~G~as~~ye~~~Y~~~d  488 (606)
                      |||++++|.+|++|+|.||++|++|||++.+++..+ ++..|.|.+|++|+ +||+++|+|+|+|+|+|+++|.+|++.+
T Consensus         1 EP~~~~~I~~p~~~~g~v~~~l~~rrg~i~~~~~~~~~~~~i~~~iP~~e~-~g~~~~Lrs~T~G~a~~~~~f~~y~~~~   79 (79)
T cd01514           1 EPIMKVEITVPEEYLGAVIGDLSKRRGEILGMEPRGTGRVVIKAELPLAEM-FGFATDLRSLTQGRASFSMEFSHYEPVP   79 (79)
T ss_pred             CCEEEEEEEECHHHHHHHHHHHHHCCCEEEEEEECCCCEEEEEEEECHHHH-CCHHHHHHCCCCCEEEEEEEECCEEECC
T ss_conf             998999999888999999999886177798778648985999999746886-2925274363799169999951305186


No 95 
>TIGR03594 GTPase_EngA ribosome-associated GTPase EngA. EngA (YfgK, Der) is a ribosome-associated essential GTPase with a duplication of its GTP-binding domain. It is broadly to universally distributed among bacteria. It appears to function in ribosome biogenesis or stability.
Probab=99.72  E-value=1.6e-16  Score=130.32  Aligned_cols=155  Identities=25%  Similarity=0.305  Sum_probs=114.4

Q ss_pred             EEEECCCCCCHHHHHHHHHHHCCCCCCCCCCCEEECCCHHHHHHCCEEEEEEEEEEEECCCCCEEEEEEEECCCCCH---
Q ss_conf             99980138987788999999829805444431130586779871950523279999743788438999961787300---
Q gi|254780321|r   14 FSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVRLNYTSTDAKDYQLNLIDTPGHVD---   90 (606)
Q Consensus        14 ~~IiaHvDhGKTTL~d~lL~~tg~i~~~~~~~~vlD~~~~EreRGITIka~~~~~~~~~~~~~~y~iNlIDTPGH~D---   90 (606)
                      +||+|--..|||||--+|+..-.++...              .-|.|--.....+.     |+++.++||||||-.+   
T Consensus         2 VaIvGrpNVGKStLfN~L~~~~~aIv~~--------------~~G~TRD~~~~~~~-----~~~~~~~liDT~G~~~~~~   62 (429)
T TIGR03594         2 VAIVGRPNVGKSTLFNRLTGKRDAIVAD--------------TPGVTRDRKYGDAE-----WGGREFILIDTGGIEEDDD   62 (429)
T ss_pred             EEEECCCCCCHHHHHHHHHCCCEEECCC--------------CCCCCCCCEEEEEE-----ECCEEEEEEECCCCCCCCH
T ss_conf             8999999987899999987886176159--------------89988773379999-----9990799998989898743


Q ss_pred             -H----HHHHHHHHHHCCEEEEEEECCCCCCHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCCHHHHHHHHHHHHHHHH
Q ss_conf             -2----79999999730268999986878865589999999970996799832678875321133888775553223210
Q gi|254780321|r   91 -F----TYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQAIDNNHEIITVLNKADLPSADPDRVKKQIEETIGISTEDA  165 (606)
Q Consensus        91 -F----~~EV~r~l~a~dgaiLvVdA~~Gvq~QT~~~~~~A~~~~l~~I~viNKiD~~~A~~e~v~~ei~~~~g~~~~~i  165 (606)
                       |    ...+..++.-+|.+++||||.+|+.++-...+......+-++|+|+||+|...  .+..   +.|...+.-.+.
T Consensus        63 ~~~~~~~~q~~~ai~~aDlIlfVvD~~~git~~D~~i~~~Lrk~~k~vilviNK~D~~~--~~~~---~~ef~~LG~~~~  137 (429)
T TIGR03594        63 GLDKQIREQAEIAIEEADVILFVVDGREGLTPEDEEIAKWLRKSGKPVILVANKIDGKK--EDAV---AAEFYSLGFGEP  137 (429)
T ss_pred             HHHHHHHHHHHHHHHHCCEEEEEEECCCCCCHHHHHHHHHHHHCCCCEEEEEECCCCCC--HHHH---HHHHHHHCCCCE
T ss_conf             78999999999999867999999857768986799999999871997899998346753--1456---999998368986


Q ss_pred             HHHHHHCCCCCCHHHHHHHHHHHCCCC
Q ss_conf             001110022320067877632100011
Q gi|254780321|r  166 LLVSAKTGEGIPLLLERIVQQLPSPTS  192 (606)
Q Consensus       166 i~vSAktG~GV~~LLd~Iv~~iP~P~~  192 (606)
                      +++||.+|.|+++|+|.|.+.+|....
T Consensus       138 i~iSA~h~~Gi~~L~~~i~~~l~~~~~  164 (429)
T TIGR03594       138 IPISAEHGRGIGDLLDAILELLPEEEE  164 (429)
T ss_pred             EEEEECCCCCHHHHHHHHHHHCCCCCC
T ss_conf             887420467999999999965886655


No 96 
>PRK00454 engB GTPase EngB; Reviewed
Probab=99.72  E-value=1.5e-16  Score=130.52  Aligned_cols=163  Identities=20%  Similarity=0.298  Sum_probs=110.8

Q ss_pred             CCCCHHHCEEEEEECCCCCCHHHHHHHHHHHCCCCCCCCCCCEEECCCHHHHHHCCEEEEEEEEEEEECCCCCEEEEEEE
Q ss_conf             89985253179998013898778899999982980544443113058677987195052327999974378843899996
Q gi|254780321|r    4 KPTPLSRIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVRLNYTSTDAKDYQLNLI   83 (606)
Q Consensus         4 ~~~p~~~IRN~~IiaHvDhGKTTL~d~lL~~tg~i~~~~~~~~vlD~~~~EreRGITIka~~~~~~~~~~~~~~y~iNlI   83 (606)
                      +..|..+.=-+||+|--..|||||.-+|+   |.  ++-+  .+.+      ..|.|-     .+.|...+   ..+.||
T Consensus        17 ~~~p~~~~p~VaivGrpNvGKSTL~N~L~---g~--k~~a--~vs~------~pgtTr-----~i~~~~~~---~~~~lv   75 (196)
T PRK00454         17 KQLPPDDGPEIAFAGRSNVGKSSLINALT---NR--KNLA--RTSK------TPGRTQ-----LINFFEVN---DGLRLV   75 (196)
T ss_pred             HHCCCCCCCEEEEECCCCCCHHHHHHHHH---CC--CCEE--EEEC------CCCCEE-----EEEEEECC---CCEEEE
T ss_conf             78999889689998489888999999986---89--7369--9747------888607-----98887618---833899


Q ss_pred             ECCCC----------CHHHHHHHHHH---HHCCEEEEEEECCCCCCHHHHHHHHHHHHCCCCEEEEECCCCCCC-CCCCC
Q ss_conf             17873----------00279999999---730268999986878865589999999970996799832678875-32113
Q gi|254780321|r   84 DTPGH----------VDFTYEVSRSL---SACEGSLLVVDATQGVEAQTLANVYQAIDNNHEIITVLNKADLPS-ADPDR  149 (606)
Q Consensus        84 DTPGH----------~DF~~EV~r~l---~a~dgaiLvVdA~~Gvq~QT~~~~~~A~~~~l~~I~viNKiD~~~-A~~e~  149 (606)
                      ||||+          ..|...+...|   ...+.++++|||..|+..|-...+..+.+.+.+.++|+||+|+-. .+..+
T Consensus        76 DtpGyG~a~~~~~~~~~~~~~i~~yl~~~~~l~~villIDa~~g~~~~D~~i~~~l~~~~~p~iivlNKiD~l~~~~~~~  155 (196)
T PRK00454         76 DLPGYGYAKVSKEEKEKWQKLIEEYLQKRENLKGVVLLIDSRHPLKELDLEMIEWLKEAGIPVLIVLTKADKLKKGERKK  155 (196)
T ss_pred             ECCCCCCCCCCHHHHHHHHHHHHHHHHHHHCCCEEEEEEECCCCCCHHHHHHHHHHHHCCCCCEEEEECCHHCCHHHHHH
T ss_conf             37997413277878889999999999962333638999971658988899999999862778599998725169789999


Q ss_pred             HHHHHHHHHH--HHHHHHHHHHHHCCCCCCHHHHHHHHHH
Q ss_conf             3888775553--2232100011100223200678776321
Q gi|254780321|r  150 VKKQIEETIG--ISTEDALLVSAKTGEGIPLLLERIVQQL  187 (606)
Q Consensus       150 v~~ei~~~~g--~~~~~ii~vSAktG~GV~~LLd~Iv~~i  187 (606)
                      ...++.+.+.  ....+++++||++|.|+++|++.|.+++
T Consensus       156 ~~~~i~~~l~~~~~~~~ii~ISA~~g~GI~eL~~~I~k~L  195 (196)
T PRK00454        156 LLKKVKKALARFAADPEVLLFSSLKKTGIDELRAAIAKWL  195 (196)
T ss_pred             HHHHHHHHHHHCCCCCCEEEEECCCCCCHHHHHHHHHHHH
T ss_conf             9999999976125898289996999979899999999985


No 97 
>PRK03003 engA GTP-binding protein EngA; Reviewed
Probab=99.72  E-value=1.6e-16  Score=130.45  Aligned_cols=161  Identities=22%  Similarity=0.284  Sum_probs=117.9

Q ss_pred             CCHHHCEEEEEECCCCCCHHHHHHHHHHHCCCCCCCCCCCEEECCCHHHHHHCCEEEEEEEEEEEECCCCCEEEEEEEEC
Q ss_conf             98525317999801389877889999998298054444311305867798719505232799997437884389999617
Q gi|254780321|r    6 TPLSRIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVRLNYTSTDAKDYQLNLIDT   85 (606)
Q Consensus         6 ~p~~~IRN~~IiaHvDhGKTTL~d~lL~~tg~i~~~~~~~~vlD~~~~EreRGITIka~~~~~~~~~~~~~~y~iNlIDT   85 (606)
                      -|-..+=-+||||--.-|||||--||+..-.+|-.        |      +-|.|=-.....     ..|.+..+++|||
T Consensus        33 ~~~~~lPiVaIvGRPNVGKStLFNrL~~~~~AIV~--------d------~pGvTRDr~~~~-----~~~~~~~f~lvDT   93 (474)
T PRK03003         33 EASGPLPVVAVVGRPNVGKSTLVNRILGRREAVVE--------D------IPGVTRDRVSYD-----AEWNGRRFVVQDT   93 (474)
T ss_pred             CCCCCCCEEEEECCCCCCHHHHHHHHHCCCEEEEC--------C------CCCCCCCCEEEE-----EEECCCEEEEEEC
T ss_conf             66799998999899998889999998688638805--------9------899880863689-----9999928999979


Q ss_pred             CCCCH----HH----HHHHHHHHHCCEEEEEEECCCCCCHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCCHHHHHHHH
Q ss_conf             87300----27----99999997302689999868788655899999999709967998326788753211338887755
Q gi|254780321|r   86 PGHVD----FT----YEVSRSLSACEGSLLVVDATQGVEAQTLANVYQAIDNNHEIITVLNKADLPSADPDRVKKQIEET  157 (606)
Q Consensus        86 PGH~D----F~----~EV~r~l~a~dgaiLvVdA~~Gvq~QT~~~~~~A~~~~l~~I~viNKiD~~~A~~e~v~~ei~~~  157 (606)
                      ||...    |.    ..+..++.-+|.+|+||||.+|+.+.-...+......+-++|+|+||+|-+..  +.   ...++
T Consensus        94 gG~~~~~~~~~~~i~~q~~~ai~eaD~IlfVvD~~~glt~~D~eia~~LRk~~kpviLVvNK~D~~~~--~~---~~~ef  168 (474)
T PRK03003         94 GGWEPDAKGLQALVAEQAEVAMRTADAVLFVVDATVGATATDEAVARLLRRSGKPVFLAANKVDSERG--EA---DAAAL  168 (474)
T ss_pred             CCCCCCHHHHHHHHHHHHHHHHHHCCEEEEEEECCCCCCHHHHHHHHHHHHCCCCEEEEEECCCCCCH--HH---HHHHH
T ss_conf             99999747899999999999998699999999689898878999999987539977998675566210--23---48999


Q ss_pred             HHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHCC
Q ss_conf             532232100011100223200678776321000
Q gi|254780321|r  158 IGISTEDALLVSAKTGEGIPLLLERIVQQLPSP  190 (606)
Q Consensus       158 ~g~~~~~ii~vSAktG~GV~~LLd~Iv~~iP~P  190 (606)
                      +.+--.+.+++||.+|.|+.+|+|.|.+.+|..
T Consensus       169 y~LGf~~~i~ISA~Hg~Gi~dLld~i~~~l~~~  201 (474)
T PRK03003        169 WSLGLGEPHPVSALHGRGVADLLDAVLAALPEV  201 (474)
T ss_pred             HHHCCCCEEEEEHHCCCCHHHHHHHHHHHCCCC
T ss_conf             975799869960203789799999999748776


No 98 
>PRK00093 engA GTP-binding protein EngA; Reviewed
Probab=99.71  E-value=2.9e-16  Score=128.66  Aligned_cols=155  Identities=25%  Similarity=0.283  Sum_probs=113.9

Q ss_pred             EEEEECCCCCCHHHHHHHHHHHCCCCCCCCCCCEEECCCHHHHHHCCEEEEEEEEEEEECCCCCEEEEEEEECCCCCH--
Q ss_conf             799980138987788999999829805444431130586779871950523279999743788438999961787300--
Q gi|254780321|r   13 NFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVRLNYTSTDAKDYQLNLIDTPGHVD--   90 (606)
Q Consensus        13 N~~IiaHvDhGKTTL~d~lL~~tg~i~~~~~~~~vlD~~~~EreRGITIka~~~~~~~~~~~~~~y~iNlIDTPGH~D--   90 (606)
                      -+||+|--..|||||--||+..-.++..        |      .-|.|--.....+.     |+++.++||||||...  
T Consensus         3 ~VaIvGrpNvGKStLfN~l~~~~~aIv~--------~------~~G~TRD~~~~~~~-----~~~~~~~lvDT~G~~~~~   63 (438)
T PRK00093          3 VVAIVGRPNVGKSTLFNRLTGKRDAIVA--------D------TPGVTRDRIYGEAE-----WLGREFIVIDTGGIDPGD   63 (438)
T ss_pred             EEEEECCCCCCHHHHHHHHHCCCEEEEC--------C------CCCCCCCCEEEEEE-----ECCEEEEEEECCCCCCCC
T ss_conf             8999899998789999998688618715--------9------89998471589999-----999289999897989888


Q ss_pred             ---HHHH----HHHHHHHCCEEEEEEECCCCCCHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCCHHHHHHHHHHHHHH
Q ss_conf             ---2799----999997302689999868788655899999999709967998326788753211338887755532232
Q gi|254780321|r   91 ---FTYE----VSRSLSACEGSLLVVDATQGVEAQTLANVYQAIDNNHEIITVLNKADLPSADPDRVKKQIEETIGISTE  163 (606)
Q Consensus        91 ---F~~E----V~r~l~a~dgaiLvVdA~~Gvq~QT~~~~~~A~~~~l~~I~viNKiD~~~A~~e~v~~ei~~~~g~~~~  163 (606)
                         |...    +..++.-+|.+|+||||.+|+.++-...+......+-++|+|+||+|....     .....|...+--.
T Consensus        64 ~~~~~~~i~~q~~~ai~~aDlIlfVvD~~~git~~D~~i~~~Lrk~~k~vilviNK~D~~~~-----~~~~~ef~~LGf~  138 (438)
T PRK00093         64 EDGFEKQMREQALLAIEEADVILFVVDGRAGLTPADEEIAKILRKSNKPVILVVNKVDGKKM-----EADAYEFYSLGLG  138 (438)
T ss_pred             CHHHHHHHHHHHHHHHHHCCEEEEEEECCCCCCHHHHHHHHHHHHCCCCEEEEEECCCCCCH-----HHHHHHHHHHCCC
T ss_conf             20799999999999998589999998377689878999999999739978999975566320-----3459999983689


Q ss_pred             HHHHHHHHCCCCCCHHHHHHHHHHHCCC
Q ss_conf             1000111002232006787763210001
Q gi|254780321|r  164 DALLVSAKTGEGIPLLLERIVQQLPSPT  191 (606)
Q Consensus       164 ~ii~vSAktG~GV~~LLd~Iv~~iP~P~  191 (606)
                      +.+++||.+|.|+++|+|.|.+.+|...
T Consensus       139 ~~i~iSA~h~~Gi~~L~~~i~~~l~~~~  166 (438)
T PRK00093        139 EPYPISAEHGRGIGDLLDAILELLPEEE  166 (438)
T ss_pred             CEEEEEECCCCCHHHHHHHHHHHCCCCC
T ss_conf             8188853056698999999985488554


No 99 
>cd04092 mtEFG2_II_like mtEFG2_C: C-terminus of mitochondrial Elongation factor G2 (mtEFG2)-like proteins found in eukaryotes.  Eukaryotic cells harbor 2 protein synthesis systems: one localized in the cytoplasm, the other in the mitochondria. Most factors regulating mitochondrial protein synthesis are encoded by nuclear genes, translated in the cytoplasm, and then transported to the mitochondria. The eukaryotic system of elongation factor (EF) components is more complex than that in prokaryotes, with both cytoplasmic and mitochondrial elongation factors and multiple isoforms being expressed in certain species.  Eukaryotic EF-2 operates in the cytosolic protein synthesis machinery of eukaryotes, EF-Gs in protein synthesis in bacteria.  Eukaryotic mtEFG1 proteins show significant homology to bacterial EF-Gs.  No clear phenotype has been found for mutants in the yeast homologue of mtEFG2, MEF2.  There are two forms of mtEFG present in mammals (designated mtEFG1s and mtEFG2s) mtEFG1s are n
Probab=99.71  E-value=5.1e-18  Score=140.44  Aligned_cols=82  Identities=28%  Similarity=0.421  Sum_probs=74.0

Q ss_pred             CCCCCCCEEECCCCCEEEEEEECCCCCCCCCEEEEECCCCCCCCCCCCCCC-CCEEEEHHCCCCCHHHHHHCCCCCCCCC
Q ss_conf             331012101147572599998169873558458873355642101222335-5412401012471233220110024444
Q gi|254780321|r  200 LKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVERIGILT-PKMIDIEALYPGEIGVMIASIKEVSHTR  278 (606)
Q Consensus       200 l~alVfds~~D~~~G~I~~~RV~sG~lk~Gd~I~~~~~g~~~~v~~ig~~~-~~~~~v~~l~aGdVG~ii~gik~l~~~~  278 (606)
                      |.|+|||+++|||+|+++|+||+||+|++||.|++.++++++++.+++.+. .++.+++++.|||||++.    ++++++
T Consensus         1 l~AlVFK~~~D~~~G~ls~vRVysG~l~~g~~v~n~~~~~~ekv~~l~~~~g~~~~~v~~~~AGdI~av~----gl~~~~   76 (83)
T cd04092           1 LCALAFKVVHDPQRGPLTFVRVYSGTLKRGSALYNTNTGKKERISRLLQPFADQYQEIPSLSAGNIGVIT----GLKQTR   76 (83)
T ss_pred             CEEEEEEEECCCCCCCEEEEEEEECEECCCCEEEECCCCCEEEEEEEEEEECCCCEECCEECCCCEEEEE----CCCCCC
T ss_conf             9499998650798440999999707897899999688996297308889757993299789699899997----877860


Q ss_pred             CCCEECC
Q ss_conf             5420004
Q gi|254780321|r  279 VGDTITD  285 (606)
Q Consensus       279 vGDTl~~  285 (606)
                      +|||||+
T Consensus        77 tGDTltt   83 (83)
T cd04092          77 TGDTLVT   83 (83)
T ss_pred             CCCEECC
T ss_conf             3889759


No 100
>PRK09518 bifunctional cytidylate kinase/GTP-binding protein; Reviewed
Probab=99.70  E-value=6.7e-16  Score=126.24  Aligned_cols=158  Identities=20%  Similarity=0.298  Sum_probs=116.9

Q ss_pred             HHCEEEEEECCCCCCHHHHHHHHHHHCCCCCCCCCCCEEECCCHHHHHHCCEEEEEEEEEEEECCCCCEEEEEEEECCCC
Q ss_conf             25317999801389877889999998298054444311305867798719505232799997437884389999617873
Q gi|254780321|r    9 SRIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVRLNYTSTDAKDYQLNLIDTPGH   88 (606)
Q Consensus         9 ~~IRN~~IiaHvDhGKTTL~d~lL~~tg~i~~~~~~~~vlD~~~~EreRGITIka~~~~~~~~~~~~~~y~iNlIDTPGH   88 (606)
                      +.+=-+||||--.-|||||--||+..-.+|-.        |      .-|+|=-     -.|...+|.+..+.||||.|.
T Consensus       277 ~~~p~VAIVGRPNVGKSTLFNRL~g~r~AIV~--------d------~pGvTRD-----R~~~~~~~~~~~F~lvDTGG~  337 (714)
T PRK09518        277 EPVGTVAIVGRPNVGKSTLVNRILGRREAVVE--------D------TPGVTRD-----RVSYDAEWAGRDFKLVDTGGW  337 (714)
T ss_pred             CCCCEEEEECCCCCCHHHHHHHHHCCCEEEEC--------C------CCCCCCC-----CCEEEEEECCEEEEEEECCCC
T ss_conf             88887999899987689999886288416846--------9------8998837-----555799999916999979999


Q ss_pred             C----HHHH----HHHHHHHHCCEEEEEEECCCCCCHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCCHHHHHHHHHHH
Q ss_conf             0----0279----9999997302689999868788655899999999709967998326788753211338887755532
Q gi|254780321|r   89 V----DFTY----EVSRSLSACEGSLLVVDATQGVEAQTLANVYQAIDNNHEIITVLNKADLPSADPDRVKKQIEETIGI  160 (606)
Q Consensus        89 ~----DF~~----EV~r~l~a~dgaiLvVdA~~Gvq~QT~~~~~~A~~~~l~~I~viNKiD~~~A~~e~v~~ei~~~~g~  160 (606)
                      .    +|..    .+..++.-+|-.|+|||+..|+.+.-.....+....+-|+|+|+||+|-+..+     ....+++.+
T Consensus       338 ~~~~~~~~~~I~~Q~~~Ai~eADlIlFVVD~~~Glt~~D~~ia~~LRk~~KpvilvvNK~D~~~~e-----~~~~ef~~L  412 (714)
T PRK09518        338 EADAEGIEAAIASQAEIAMTLADAIVFVVDGQVGMTSTDEVIARMLQRAGKPVVLVANKIDDQASE-----YDVAEFWKL  412 (714)
T ss_pred             CCCCHHHHHHHHHHHHHHHHHCCEEEEEEECCCCCCHHHHHHHHHHHHCCCCEEEEEECCCCCCCH-----HHHHHHHHC
T ss_conf             988326999999999999996899999996897989789999999985699889999897887640-----129999965


Q ss_pred             HHHHHHHHHHHCCCCCCHHHHHHHHHHHCC
Q ss_conf             232100011100223200678776321000
Q gi|254780321|r  161 STEDALLVSAKTGEGIPLLLERIVQQLPSP  190 (606)
Q Consensus       161 ~~~~ii~vSAktG~GV~~LLd~Iv~~iP~P  190 (606)
                      --.+.+++||.+|.|+.+|||.|++.+|..
T Consensus       413 G~~e~~~ISA~Hg~G~~dLld~i~~~l~~~  442 (714)
T PRK09518        413 GLGEPYSISAMHGRGVADLLDVVLDSLKQH  442 (714)
T ss_pred             CCCCCEEEECCCCCCHHHHHHHHHHHCCCC
T ss_conf             999968984735789899999999658888


No 101
>pfam10662 PduV-EutP Ethanolamine utilisation - propanediol utilisation. Members of this family function in ethanolamine and propanediol degradation pathways, however the exact roles of these proteins is poorly understood.
Probab=99.70  E-value=1.1e-16  Score=131.43  Aligned_cols=133  Identities=27%  Similarity=0.321  Sum_probs=92.0

Q ss_pred             EEEECCCCCCHHHHHHHHHHHCCCCCCCCCCCEEECCCHHHHHHCCEE-EEEEEEEEEECCCCCEEEEEEEECCC----C
Q ss_conf             999801389877889999998298054444311305867798719505-23279999743788438999961787----3
Q gi|254780321|r   14 FSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITI-KAQTVRLNYTSTDAKDYQLNLIDTPG----H   88 (606)
Q Consensus        14 ~~IiaHvDhGKTTL~d~lL~~tg~i~~~~~~~~vlD~~~~EreRGITI-ka~~~~~~~~~~~~~~y~iNlIDTPG----H   88 (606)
                      +||||...+|||||..+|+   |.  +                  |++ |.|++.          |..++|||||    |
T Consensus         4 VaivGrpNvGKSTLlN~L~---g~--~------------------i~~~K~qtt~----------~~~~~IDTPG~~~~~   50 (143)
T pfam10662         4 IMLIGRSGCGKTTLTQALN---GE--E------------------LKYKKTQAIE----------FSDNMIDTPGEYLEN   50 (143)
T ss_pred             EEEECCCCCCHHHHHHHHC---CC--C------------------EEECCCEEEE----------ECCCEEECCCCCCCC
T ss_conf             9998999999999999975---99--4------------------4517870798----------557489998766562


Q ss_pred             CHHHHHHHHHHHHCCEEEEEEECCCCCCHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCCHHHHHHHHH-HHHHHHHHH
Q ss_conf             0027999999973026899998687886558999999997099679983267887532113388877555-322321000
Q gi|254780321|r   89 VDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQAIDNNHEIITVLNKADLPSADPDRVKKQIEETI-GISTEDALL  167 (606)
Q Consensus        89 ~DF~~EV~r~l~a~dgaiLvVdA~~Gvq~QT~~~~~~A~~~~l~~I~viNKiD~~~A~~e~v~~ei~~~~-g~~~~~ii~  167 (606)
                      ..|...+..+..-||-.++|+||++......   -..+...+.|+|.||||||+...  ++..+.+++.+ .+..+++++
T Consensus        51 ~~~~~~~~~~~~daDvil~vvDa~~~~~~~~---~~~~~~~~kpvIlViNKiD~~~~--~~~l~~~~~~~~~~~~~~i~~  125 (143)
T pfam10662        51 RRFYSALIVTAADADVIALVQDATEPWSVFP---PGFASMFNKPVIGIITKIDLAKD--EANIEMVEEWLNNAGAEKIFE  125 (143)
T ss_pred             HHHHHHHHHHHHHCCEEEEEEECCCCCCCCC---HHHHHHCCCCEEEEEECCCCCCC--HHHHHHHHHHHHHCCCCEEEE
T ss_conf             8999999999964999999987788667568---77897547988999980224575--667899999997589987999


Q ss_pred             HHHHCCCCCCHHHHHHH
Q ss_conf             11100223200678776
Q gi|254780321|r  168 VSAKTGEGIPLLLERIV  184 (606)
Q Consensus       168 vSAktG~GV~~LLd~Iv  184 (606)
                      +||.+|.|+++|++.|-
T Consensus       126 iSA~~g~Gid~L~~~l~  142 (143)
T pfam10662       126 VSAVTNEGIDELFAYLE  142 (143)
T ss_pred             EECCCCCCHHHHHHHHH
T ss_conf             88989989999999974


No 102
>cd03691 BipA_TypA_II BipA_TypA_II: domain II of BipA (also called TypA) having homology to domain II of the elongation factors (EFs) EF-G and EF-Tu.  BipA is a highly conserved protein with global regulatory properties in Escherichia coli.  BipA is phosphorylated on a tyrosine residue under some cellular conditions. Mutants show altered regulation of some pathways. BipA functions as a translation factor that is required specifically for the expression of the transcriptional modulator Fis.  BipA binds to ribosomes at a site that coincides with that of EF-G and has a GTPase activity that is sensitive to high GDP:GTP ratios and, is stimulated  by 70S ribosomes programmed with mRNA and aminoacylated tRNAs. The growth rate-dependent induction of BipA allows the efficient expression of Fis, thereby modulating a range of downstream processes, including DNA metabolism and type III secretion.
Probab=99.67  E-value=5e-17  Score=133.79  Aligned_cols=82  Identities=26%  Similarity=0.488  Sum_probs=70.9

Q ss_pred             CCCCCCCEEECCCCCEEEEEEECCCCCCCCCEEEEECCCCC---CCCCCCCCCC-CCEEEEHHCCCCCHHHHHHCCCCCC
Q ss_conf             33101210114757259999816987355845887335564---2101222335-5412401012471233220110024
Q gi|254780321|r  200 LKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAK---YQVERIGILT-PKMIDIEALYPGEIGVMIASIKEVS  275 (606)
Q Consensus       200 l~alVfds~~D~~~G~I~~~RV~sG~lk~Gd~I~~~~~g~~---~~v~~ig~~~-~~~~~v~~l~aGdVG~ii~gik~l~  275 (606)
                      |+|+||+..||||.|+++++||+||+|++||+|.+++.+.+   .++.+++.|. .++.+++++.||||    +++.+++
T Consensus         1 f~mlv~~~~~d~~~Gri~~~RV~sG~lk~gd~v~~~~~~~~~~~~rv~~l~~~~g~~~~~v~~a~AGDI----vai~Gl~   76 (86)
T cd03691           1 LQMLVTTLDYDDYVGRIAIGRIFRGTVKVGQQVAVVKRDGKIEKAKITKLFGFEGLKRVEVEEAEAGDI----VAIAGIE   76 (86)
T ss_pred             CCEEEEEEECCCCCCEEEEEEEECCCCCCCCEEEEECCCCCEEECCCEEEEEEECCCCEEEEEECCCCE----EEECCCC
T ss_conf             968999810188775599999846951799989996167826762230768960698569718759999----9994888


Q ss_pred             CCCCCCEECC
Q ss_conf             4445420004
Q gi|254780321|r  276 HTRVGDTITD  285 (606)
Q Consensus       276 ~~~vGDTl~~  285 (606)
                      ++.+|||||+
T Consensus        77 ~~~iGdTl~D   86 (86)
T cd03691          77 DITIGDTICD   86 (86)
T ss_pred             CCCCCCCCCC
T ss_conf             8865471369


No 103
>PRK00093 engA GTP-binding protein EngA; Reviewed
Probab=99.67  E-value=2.8e-15  Score=122.02  Aligned_cols=159  Identities=27%  Similarity=0.389  Sum_probs=113.9

Q ss_pred             HHCEEEEEECCCCCCHHHHHHHHHHHCCCCCCCCCCCEEECCCHHHHHHCCEEEEEEEEEEEECCCCCEEEEEEEECCCC
Q ss_conf             25317999801389877889999998298054444311305867798719505232799997437884389999617873
Q gi|254780321|r    9 SRIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVRLNYTSTDAKDYQLNLIDTPGH   88 (606)
Q Consensus         9 ~~IRN~~IiaHvDhGKTTL~d~lL~~tg~i~~~~~~~~vlD~~~~EreRGITIka~~~~~~~~~~~~~~y~iNlIDTPGH   88 (606)
                      ++--++||||--..|||||.-+||..--.+....              -|.|.-+-.+.+.|     ++..+.||||+|-
T Consensus       170 ~~~iriaiiGrpNvGKStl~N~ll~~~r~ivs~~--------------~GtTrD~i~~~~~~-----~~~~~~~iDTaGi  230 (438)
T PRK00093        170 EDPIKIAIIGRPNVGKSTLINALLGEERVIVSDI--------------AGTTRDSIDTPFER-----DGQKYTLIDTAGI  230 (438)
T ss_pred             CCCEEEEEECCCCCCHHHHHHHHHHHHHHHCCCC--------------CCCCCCCEEEEEEE-----CCCEEEEEECCCC
T ss_conf             5560599955888655678887654333204799--------------98511232679998-----9967999989898


Q ss_pred             CHH--------HHHHHHH---HHHCCEEEEEEECCCCCCHHHHHHHHHHHHCCCCEEEEECCCCCCCCC---CCCHHHHH
Q ss_conf             002--------7999999---973026899998687886558999999997099679983267887532---11338887
Q gi|254780321|r   89 VDF--------TYEVSRS---LSACEGSLLVVDATQGVEAQTLANVYQAIDNNHEIITVLNKADLPSAD---PDRVKKQI  154 (606)
Q Consensus        89 ~DF--------~~EV~r~---l~a~dgaiLvVdA~~Gvq~QT~~~~~~A~~~~l~~I~viNKiD~~~A~---~e~v~~ei  154 (606)
                      .--        .+-|.|+   +.-||-++||+||.+|+.-|-...+.++.+.|-+.|+++||+|+..-+   .+...+++
T Consensus       231 rkk~k~~~~iE~~s~~~t~~~i~~~dvvilviDa~~~~~~qD~~i~~~i~~~gk~~ii~vNKwDLv~~~~~~~~~~~~~i  310 (438)
T PRK00093        231 RRRGKVTEGIEKYSVIRTLKAIERADVVLLVIDATEGITEQDLRIAGLALEAGRALVIVVNKWDLVEKDSKTMEEVKEEL  310 (438)
T ss_pred             CCCCCCCHHHHHHHHHHHHHHHHHCCEEEEEEECCCCCCHHHHHHHHHHHHCCCCEEEEEECHHCCCCCHHHHHHHHHHH
T ss_conf             76564213788999999999986446699999766588488899999999819966999970222566389999999999


Q ss_pred             HHHH-HHHHHHHHHHHHHCCCCCCHHHHHHHHH
Q ss_conf             7555-3223210001110022320067877632
Q gi|254780321|r  155 EETI-GISTEDALLVSAKTGEGIPLLLERIVQQ  186 (606)
Q Consensus       155 ~~~~-g~~~~~ii~vSAktG~GV~~LLd~Iv~~  186 (606)
                      ...+ -+....++++||++|.|++.|++.+.+.
T Consensus       311 ~~~l~~~~~~pIvfiSA~~g~gi~kl~~~i~~v  343 (438)
T PRK00093        311 RRRLPFLDFAPIVFISALTGQGVDKLFESILEA  343 (438)
T ss_pred             HHHCCCCCCCCEEEEECCCCCCHHHHHHHHHHH
T ss_conf             975612589877998514777999999999999


No 104
>PRK03003 engA GTP-binding protein EngA; Reviewed
Probab=99.67  E-value=2.5e-15  Score=122.42  Aligned_cols=158  Identities=21%  Similarity=0.342  Sum_probs=112.2

Q ss_pred             HHCEEEEEECCCCCCHHHHHHHHHHHCCCCCCCCCCCEEECCCHHHHHHCCEEEEEEEEEEEECCCCCEEEEEEEECCCC
Q ss_conf             25317999801389877889999998298054444311305867798719505232799997437884389999617873
Q gi|254780321|r    9 SRIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVRLNYTSTDAKDYQLNLIDTPGH   88 (606)
Q Consensus         9 ~~IRN~~IiaHvDhGKTTL~d~lL~~tg~i~~~~~~~~vlD~~~~EreRGITIka~~~~~~~~~~~~~~y~iNlIDTPGH   88 (606)
                      +..-++||||....|||||.-+||-.-..+..              -.-|.|.-+-.+.+.|     ++..+.||||+|-
T Consensus       209 ~~~~rIAIvGrPNvGKStL~N~llg~~r~ivs--------------~~~GTTRDsI~~~~~~-----~~~~~~liDTAGi  269 (474)
T PRK03003        209 GGPRRVALVGKPNVGKSSLLNKLAGEERSVVH--------------DVAGTTVDPVDSLIEL-----GGKVWRFVDTAGL  269 (474)
T ss_pred             CCCCEEEEECCCCCCHHHHHHHHHCCCCEEEC--------------CCCCCCCCCEEEEEEE-----CCEEEEEEECCCC
T ss_conf             77627999808998788999998589756745--------------8998515440589999-----9989999989876


Q ss_pred             C---------HHHHHHHHH---HHHCCEEEEEEECCCCCCHHHHHHHHHHHHCCCCEEEEECCCCCCCCCC-CCHHHHHH
Q ss_conf             0---------027999999---9730268999986878865589999999970996799832678875321-13388877
Q gi|254780321|r   89 V---------DFTYEVSRS---LSACEGSLLVVDATQGVEAQTLANVYQAIDNNHEIITVLNKADLPSADP-DRVKKQIE  155 (606)
Q Consensus        89 ~---------DF~~EV~r~---l~a~dgaiLvVdA~~Gvq~QT~~~~~~A~~~~l~~I~viNKiD~~~A~~-e~v~~ei~  155 (606)
                      -         +| +-+.|+   +.-||-+|||+||.+|+..|-...+.++.+.|.++|+++||.|+...+. +....+++
T Consensus       270 Rrk~kv~~~iE~-~s~~rtl~aI~~advvilviDa~egit~QD~~Ia~~v~~~gk~~IivvNKwDLv~~~~~~~~~~~i~  348 (474)
T PRK03003        270 RRKVGQASGHEF-YASLRTHAAIDAAEVAVVLIDASEPLTEQDQRVLSMVIEAGRALVLAFNKWDLVDEDRRYYLEREID  348 (474)
T ss_pred             CCCCCCCCCHHH-HHHHHHHHHHHHCCEEEEEEECCCCCCHHHHHHHHHHHHHCCCEEEEEECHHCCCHHHHHHHHHHHH
T ss_conf             635533431458-9999999998733557999854658749999999999980995799997144168678999999998


Q ss_pred             HHH-HHHHHHHHHHHHHCCCCCCHHHHHHHHH
Q ss_conf             555-3223210001110022320067877632
Q gi|254780321|r  156 ETI-GISTEDALLVSAKTGEGIPLLLERIVQQ  186 (606)
Q Consensus       156 ~~~-g~~~~~ii~vSAktG~GV~~LLd~Iv~~  186 (606)
                      ..+ -+....++++||++|.|+..|++.+.+.
T Consensus       349 ~~l~~~~~~piv~ISA~~g~~i~kL~~~i~~v  380 (474)
T PRK03003        349 RELAQVRWAPRVNISAKTGRAVQKLVPALETA  380 (474)
T ss_pred             HHHHHCCCCCEEEEEEECCCCHHHHHHHHHHH
T ss_conf             64554489856999810487989999999999


No 105
>TIGR03594 GTPase_EngA ribosome-associated GTPase EngA. EngA (YfgK, Der) is a ribosome-associated essential GTPase with a duplication of its GTP-binding domain. It is broadly to universally distributed among bacteria. It appears to function in ribosome biogenesis or stability.
Probab=99.67  E-value=2.6e-15  Score=122.31  Aligned_cols=159  Identities=25%  Similarity=0.358  Sum_probs=113.9

Q ss_pred             HHCEEEEEECCCCCCHHHHHHHHHHHCCCCCCCCCCCEEECCCHHHHHHCCEEEEEEEEEEEECCCCCEEEEEEEECCCC
Q ss_conf             25317999801389877889999998298054444311305867798719505232799997437884389999617873
Q gi|254780321|r    9 SRIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVRLNYTSTDAKDYQLNLIDTPGH   88 (606)
Q Consensus         9 ~~IRN~~IiaHvDhGKTTL~d~lL~~tg~i~~~~~~~~vlD~~~~EreRGITIka~~~~~~~~~~~~~~y~iNlIDTPGH   88 (606)
                      ++.-++||+|--..|||||.-+||..--.+....              -|.|--+-...+.|     ++..+.||||+|-
T Consensus       170 ~~~iriaivGrPNvGKSTl~N~ll~~~r~ivs~~--------------~GtTrD~i~~~~~~-----~~~~~~~iDTaGi  230 (429)
T TIGR03594       170 DGPIKIAIIGRPNVGKSTLVNALLGEERVIVSDI--------------AGTTRDSIDIPFER-----NGKKYLLIDTAGI  230 (429)
T ss_pred             CCCEEEEEECCCCCCHHHHHHHHHHHHHHHCCCC--------------CCCCCCCEEEEEEE-----CCEEEEEEECCCC
T ss_conf             5652699974887654677777654333214799--------------98631026879999-----9908999989887


Q ss_pred             CH----------H-HHHHHHHHHHCCEEEEEEECCCCCCHHHHHHHHHHHHCCCCEEEEECCCCCCC-C-CCCCHHHHHH
Q ss_conf             00----------2-79999999730268999986878865589999999970996799832678875-3-2113388877
Q gi|254780321|r   89 VD----------F-TYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQAIDNNHEIITVLNKADLPS-A-DPDRVKKQIE  155 (606)
Q Consensus        89 ~D----------F-~~EV~r~l~a~dgaiLvVdA~~Gvq~QT~~~~~~A~~~~l~~I~viNKiD~~~-A-~~e~v~~ei~  155 (606)
                      ..          | .....++++.||-++||+||.+|+..|-..-+.++.+.|.++|+++||+|+-. . ..+....++.
T Consensus       231 rkk~k~~~~~e~~s~~~t~~~i~~~dvvil~iD~~~~~~~qD~~i~~~i~~~~k~~ii~~NK~Dli~~~~~~~~~~~~i~  310 (429)
T TIGR03594       231 RRKGKVTEGIEKYSVLRTLKAIERADVVLLVLDATEGITEQDLRIAGLALEAGKALIIVVNKWDLVKDEKTREEFKKELR  310 (429)
T ss_pred             CCCCCCCHHHHHHHHHHHHHHHHHCCEEEEEEECCCCCCHHHHHHHHHHHHCCCCEEEEEEHHHCCCCHHHHHHHHHHHH
T ss_conf             63664230477999999999987447799999766588488899999898739976999972230379999999999999


Q ss_pred             HHH-HHHHHHHHHHHHHCCCCCCHHHHHHHHH
Q ss_conf             555-3223210001110022320067877632
Q gi|254780321|r  156 ETI-GISTEDALLVSAKTGEGIPLLLERIVQQ  186 (606)
Q Consensus       156 ~~~-g~~~~~ii~vSAktG~GV~~LLd~Iv~~  186 (606)
                      ..+ -+....++++||++|.|+..|++.+.+.
T Consensus       311 ~~l~~~~~~pI~fiSA~~g~gi~kl~~~i~~~  342 (429)
T TIGR03594       311 RKLPFLDFAPIVFISALTGQGVDKLLDAIDEV  342 (429)
T ss_pred             HHCCCCCCCCEEEEECCCCCCHHHHHHHHHHH
T ss_conf             85623689868997345778999999999999


No 106
>pfam02421 FeoB_N Ferrous iron transport protein B. Escherichia coli has an iron(II) transport system (feo) which may make an important contribution to the iron supply of the cell under anaerobic conditions. FeoB has been identified as part of this transport system. FeoB is a large 700-800 amino acid integral membrane protein. The N terminus contains a P-loop motif suggesting that iron transport may be ATP dependent.
Probab=99.67  E-value=1.2e-15  Score=124.42  Aligned_cols=153  Identities=26%  Similarity=0.394  Sum_probs=99.6

Q ss_pred             EEEEECCCCCCHHHHHHHHHHHCCCCCCCCCCCEEECCCHHHHHHCCEEEEEEEEEEEECCCCCEEEEEEEECCCCCHH-
Q ss_conf             7999801389877889999998298054444311305867798719505232799997437884389999617873002-
Q gi|254780321|r   13 NFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVRLNYTSTDAKDYQLNLIDTPGHVDF-   91 (606)
Q Consensus        13 N~~IiaHvDhGKTTL~d~lL~~tg~i~~~~~~~~vlD~~~~EreRGITIka~~~~~~~~~~~~~~y~iNlIDTPGH~DF-   91 (606)
                      .++|+|.-..|||||..+|+   |.   +.   .+.|      .-|.|.......+.     +.++.+.|+||||..++ 
T Consensus         1 tVaIvG~PNvGKSTLlN~L~---g~---~~---~Vs~------~pGtTrd~~~~~~~-----~~~~~~~lvDTpGi~~~~   60 (188)
T pfam02421         1 TIALVGNPNVGKTTLFNALT---GA---RQ---HVGN------WPGVTVEKKEGTFK-----YKGYEIEIVDLPGTYSLS   60 (188)
T ss_pred             CEEEECCCCCCHHHHHHHHH---CC---CC---EEEC------CCCCCCCEEEEEEE-----ECCEEEEEEECCCCCCCC
T ss_conf             98998899989999999995---99---96---5638------99972333576875-----251679999688850146


Q ss_pred             --HH-H-HHH-HH--HHCCEEEEEEECCCCCCHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCC-HHHHHHHHHHHHHH
Q ss_conf             --79-9-999-99--73026899998687886558999999997099679983267887532113-38887755532232
Q gi|254780321|r   92 --TY-E-VSR-SL--SACEGSLLVVDATQGVEAQTLANVYQAIDNNHEIITVLNKADLPSADPDR-VKKQIEETIGISTE  163 (606)
Q Consensus        92 --~~-E-V~r-~l--~a~dgaiLvVdA~~Gvq~QT~~~~~~A~~~~l~~I~viNKiD~~~A~~e~-v~~ei~~~~g~~~~  163 (606)
                        +- | +.+ ++  .-+|-+|+|+||.+ ++ ++..-+....+.+.|+|+|+||+|+...+... -.+++.+.+|+   
T Consensus        61 ~~~~~e~v~~~~~~~~~aDlvl~vvDa~~-~e-r~l~l~~~l~~~~~p~IvVlNK~Dl~~~~~~~~~~~~l~~~lg~---  135 (188)
T pfam02421        61 PYSEEEKVARDYLLEEKPDVIINVVDATN-LE-RNLYLTLQLLELGIPVVVALNMMDEAEKKGIKIDIKKLSELLGV---  135 (188)
T ss_pred             CCCHHHHHHHHHHHHCCCCCEEEEEECCC-HH-HHHHHHHHHHHCCCCEEEEECCCHHCCCCCCHHHHHHHHHHCCC---
T ss_conf             53278999999986236873699976762-45-44899999997699889996170201003652039999987399---


Q ss_pred             HHHHHHHHCCCCCCHHHHHHHHHHHCC
Q ss_conf             100011100223200678776321000
Q gi|254780321|r  164 DALLVSAKTGEGIPLLLERIVQQLPSP  190 (606)
Q Consensus       164 ~ii~vSAktG~GV~~LLd~Iv~~iP~P  190 (606)
                      +++++||++|.|+++|+++|++.++.+
T Consensus       136 ~vi~ISA~~g~Gi~eL~~~I~~~~~~~  162 (188)
T pfam02421       136 PVVPTSARKGEGIDELKDAIIEVAEGK  162 (188)
T ss_pred             CEEEEEEECCCCHHHHHHHHHHHHHCC
T ss_conf             689999316999999999999997268


No 107
>pfam00025 Arf ADP-ribosylation factor family. Pfam combines a number of different Prosite families together
Probab=99.67  E-value=1.4e-15  Score=124.17  Aligned_cols=154  Identities=16%  Similarity=0.227  Sum_probs=101.7

Q ss_pred             CEEEEEECCCCCCHHHHHHHHHHHCCCCCCCCCCCEEECCCHHHHHHCCEEEEEEEEEEEECCCCCEEEEEEEECCCCCH
Q ss_conf             31799980138987788999999829805444431130586779871950523279999743788438999961787300
Q gi|254780321|r   11 IRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVRLNYTSTDAKDYQLNLIDTPGHVD   90 (606)
Q Consensus        11 IRN~~IiaHvDhGKTTL~d~lL~~tg~i~~~~~~~~vlD~~~~EreRGITIka~~~~~~~~~~~~~~y~iNlIDTPGH~D   90 (606)
                      --.+.++|..++|||||..|+.  .+.+..  ..          .--|.++    ..+.+     +++.+++.|||||..
T Consensus        14 ~~Ki~llG~~~vGKTsll~~~~--~~~~~~--~~----------pTig~~~----~~v~~-----~~~~~~iwDt~Gqe~   70 (174)
T pfam00025        14 EMRILILGLDNAGKTTILYKLK--LGEIVT--TI----------PTIGFNV----ETVTY-----KNVKFTVWDVGGQES   70 (174)
T ss_pred             EEEEEEECCCCCCHHHHHHHHH--CCCCCC--CC----------CCCCCEE----EEEEE-----CCEEEEEEECCCCCC
T ss_conf             6699999999998899999995--499887--44----------7468238----99998-----999999982798702


Q ss_pred             HHHHHHHHHHHCCEEEEEEECCCCCCH-HHHHHHHHHHH----CCCCEEEEECCCCCCCCCCCCHHHHHHHHHHHH--HH
Q ss_conf             279999999730268999986878865-58999999997----099679983267887532113388877555322--32
Q gi|254780321|r   91 FTYEVSRSLSACEGSLLVVDATQGVEA-QTLANVYQAID----NNHEIITVLNKADLPSADPDRVKKQIEETIGIS--TE  163 (606)
Q Consensus        91 F~~EV~r~l~a~dgaiLvVdA~~Gvq~-QT~~~~~~A~~----~~l~~I~viNKiD~~~A~~e~v~~ei~~~~g~~--~~  163 (606)
                      |..-.....+-+||+++|+|+++--.- +....++..+.    .++|++++.||+|++++..++-..+...+-.+.  .-
T Consensus        71 ~~~~~~~y~~~a~~ii~V~D~t~~~s~~~~~~~l~~~l~~~~~~~~piliv~NK~DL~~~~~~~ei~~~~~~~~~~~~~~  150 (174)
T pfam00025        71 LRPLWRNYFPNTDAVIFVVDSADRDRIEEAKEELHALLNEEELADAPLLILANKQDLPGAMSEAEIRELLGLHELKSRPW  150 (174)
T ss_pred             CCHHHHHHHCCCCEEEEEEECCCHHHHHHHHHHHHHHHHHHCCCCCEEEEEEECCCCCCCCCHHHHHHHHHHHHCCCCCC
T ss_conf             32679988417826899986786787999999999987542358970899872566767899999999997864417996


Q ss_pred             HHHHHHHHCCCCCCHHHHHHHHHH
Q ss_conf             100011100223200678776321
Q gi|254780321|r  164 DALLVSAKTGEGIPLLLERIVQQL  187 (606)
Q Consensus       164 ~ii~vSAktG~GV~~LLd~Iv~~i  187 (606)
                      .++++||++|.||+++++.|.+++
T Consensus       151 ~~~~~SAktG~gI~e~f~~L~~~I  174 (174)
T pfam00025       151 EIQGCSAVTGEGLDEGLDWLSNYI  174 (174)
T ss_pred             EEEEEECCCCCCHHHHHHHHHHHC
T ss_conf             899998867959899999999539


No 108
>cd04088 EFG_mtEFG_II EFG_mtEFG_II: this subfamily represents the domain II of elongation factor G (EF-G) in bacteria and, the C-terminus of mitochondrial Elongation factor G1 (mtEFG1) and G2 (mtEFG2)_like proteins found in eukaryotes. During the process of peptide synthesis and tRNA site changes, the ribosome is moved along the mRNA a distance equal to one codon with the addition of each amino acid. In bacteria this translocation step is catalyzed by EF-G_GTP, which is hydrolyzed to provide the required energy. Thus, this action releases the uncharged tRNA from the P site and transfers the newly formed peptidyl-tRNA from the A site to the P site. Eukaryotic cells harbor 2 protein synthesis systems: one localized in the cytoplasm, the other in the mitochondria. Most factors regulating mitochondrial protein synthesis are encoded by nuclear genes, translated in the cytoplasm, and then transported to the mitochondria. The eukaryotic system of elongation factor (EF) components is more compl
Probab=99.67  E-value=4.2e-17  Score=134.32  Aligned_cols=82  Identities=26%  Similarity=0.442  Sum_probs=73.6

Q ss_pred             CCCCCCCEEECCCCCEEEEEEECCCCCCCCCEEEEECCCCCCCCCCCCCC-CCCEEEEHHCCCCCHHHHHHCCCCCCCCC
Q ss_conf             33101210114757259999816987355845887335564210122233-55412401012471233220110024444
Q gi|254780321|r  200 LKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVERIGIL-TPKMIDIEALYPGEIGVMIASIKEVSHTR  278 (606)
Q Consensus       200 l~alVfds~~D~~~G~I~~~RV~sG~lk~Gd~I~~~~~g~~~~v~~ig~~-~~~~~~v~~l~aGdVG~ii~gik~l~~~~  278 (606)
                      |.|+|||+++|||+|+++|+||++|+|++||.|+++++++++++.++..+ +.++.+++++.||||++    +.++++++
T Consensus         1 ~~a~VFK~~~d~~~Gri~~~RV~~G~l~~g~~v~~~~~~~~~kv~~l~~~~g~~~~~v~~~~aGdI~a----i~gl~~~~   76 (83)
T cd04088           1 FVALVFKTIHDPFVGKLSFVRVYSGTLKAGSTLYNSTKGKKERVGRLLRMHGKKQEEVEEAGAGDIGA----VAGLKDTA   76 (83)
T ss_pred             CEEEEEEEEECCCCCEEEEEEEECCEECCCCEEEECCCCEEEEECEEEEEECCCCEECCEECCCCEEE----EECCCCCC
T ss_conf             90999976655988869999995899867975886065104882204788569823946888999999----95888870


Q ss_pred             CCCEECC
Q ss_conf             5420004
Q gi|254780321|r  279 VGDTITD  285 (606)
Q Consensus       279 vGDTl~~  285 (606)
                      +|||||+
T Consensus        77 ~GDTl~d   83 (83)
T cd04088          77 TGDTLCD   83 (83)
T ss_pred             CCCCCCC
T ss_conf             5675369


No 109
>cd04098 eEF2_C_snRNP eEF2_C_snRNP: This family includes a C-terminal portion of the spliceosomal human 116kD U5 small nuclear ribonucleoprotein (snRNP) protein (U5-116 kD) and, its yeast counterpart Snu114p.  This domain is homologous to the C-terminal domain of the eukaryotic translational elongation factor EF-2.  Yeast Snu114p is essential for cell viability and for splicing in vivo. U5-116 kD binds GTP.  Experiments suggest that GTP binding and probably GTP hydrolysis is important for the function of the U5-116 kD/Snu114p.   In complex with GTP, EF-2 promotes the translocation step of translation. During translocation the peptidyl-tRNA is moved from the A site to the P site, the uncharged tRNA from the P site to the E-site and, the mRNA is shifted one codon relative to the ribosome.
Probab=99.67  E-value=1.6e-16  Score=130.48  Aligned_cols=76  Identities=21%  Similarity=0.277  Sum_probs=71.6

Q ss_pred             CCEEEEEEEECCCCCHHHHHHHHHHHHEEECCCCCC--CEEEEEEEECHHHHHHHHHHHHHHHCCCEEEEEEEECCCEE
Q ss_conf             326999998083100038999886300142443368--36999999604333220468767635741888985435464
Q gi|254780321|r  410 EPWIQVTIITPNEYLGSILKLCQERRGIQIDMSHLD--NRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDYRD  486 (606)
Q Consensus       410 EPi~~~~I~~P~ey~G~Vm~~l~~RRG~~~~m~~~~--~~~~i~~~vPl~Eli~~f~~~LkS~T~G~as~~ye~~~Y~~  486 (606)
                      |||++++|.||++|+|.|++++++|||.+.+++..+  +...+++.+|++|+ +||.++|+|+|+|.|+|.++|+||++
T Consensus         1 EPi~~veI~~p~~~~g~V~~~l~~RRG~ii~~~~~~gt~~~~I~A~vPv~es-FG~~tdLRs~T~G~a~~~~~Fsh~~~   78 (80)
T cd04098           1 EPIYEVEITCPADAVSAVYEVLSRRRGHVIYDTPIPGTPLYEVKAFIPVIES-FGFETDLRVHTQGQAFCQSVFDHWQI   78 (80)
T ss_pred             CCCEEEEEEECHHHHHHHHHHHHCCCCEEECCCCCCCCCEEEEEEECCHHHH-CCCHHHHHHHCCCCCEEEEEECCCEE
T ss_conf             9948999997779853688763048981413420499867999998757897-58479999657797269979632312


No 110
>cd04155 Arl3 Arl3 subfamily.  Arl3 (Arf-like 3) is an Arf family protein that differs from most Arf family members in the N-terminal extension.  In is inactive, GDP-bound form, the N-terminal extension forms an elongated loop that is hydrophobically anchored into the membrane surface; however, it has been proposed that this region might form a helix in the GTP-bound form.  The delta subunit of the rod-specific cyclic GMP phosphodiesterase type 6 (PDEdelta) is an Arl3 effector.  Arl3 binds microtubules in a regulated manner to alter specific aspects of cytokinesis via interactions with retinitis pigmentosa 2 (RP2).  It has been proposed that RP2 functions in concert with Arl3 to link the cell membrane and the cytoskeleton in photoreceptors as part of the cell signaling or vesicular transport machinery.  In mice, the absence of Arl3 is associated with abnormal epithelial cell proliferation and cyst formation.
Probab=99.67  E-value=1.4e-15  Score=124.03  Aligned_cols=151  Identities=19%  Similarity=0.294  Sum_probs=104.7

Q ss_pred             HHCEEEEEECCCCCCHHHHHHHHHHHCCCCCCCCCCCEEECCCHHHHHHCCEEEEEEEEEEEECCCCCEEEEEEEECCCC
Q ss_conf             25317999801389877889999998298054444311305867798719505232799997437884389999617873
Q gi|254780321|r    9 SRIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVRLNYTSTDAKDYQLNLIDTPGH   88 (606)
Q Consensus         9 ~~IRN~~IiaHvDhGKTTL~d~lL~~tg~i~~~~~~~~vlD~~~~EreRGITIka~~~~~~~~~~~~~~y~iNlIDTPGH   88 (606)
                      ++...+.|+|+-++|||||.-++.  .+.++..            ..-.|.++    .++.     .+++.+++.||||+
T Consensus        12 ~~~~Ki~ilG~~~sGKTsll~~l~--~~~~~~~------------~pT~g~~~----~~v~-----~~~~~~~lwD~~G~   68 (173)
T cd04155          12 SEEPRILILGLDNAGKTTILKQLA--SEDISHI------------TPTQGFNI----KTVQ-----SDGFKLNVWDIGGQ   68 (173)
T ss_pred             CCCCEEEEECCCCCCHHHHHHHHH--CCCCCCC------------CCCCCEEE----EEEE-----ECCEEEEEEECCCC
T ss_conf             877589999799998899999985--6998660------------68113237----9999-----89999999855875


Q ss_pred             CHHHHHHHHHHHHCCEEEEEEECCCCCC-HHHHHHHHHHH----HCCCCEEEEECCCCCCCCCCCCHHHHHHHHHHHHH-
Q ss_conf             0027999999973026899998687886-55899999999----70996799832678875321133888775553223-
Q gi|254780321|r   89 VDFTYEVSRSLSACEGSLLVVDATQGVE-AQTLANVYQAI----DNNHEIITVLNKADLPSADPDRVKKQIEETIGIST-  162 (606)
Q Consensus        89 ~DF~~EV~r~l~a~dgaiLvVdA~~Gvq-~QT~~~~~~A~----~~~l~~I~viNKiD~~~A~~e~v~~ei~~~~g~~~-  162 (606)
                      .-|..-....++-+||+|+|||+++--+ .++...++..+    ..++|++++.||+|+++|..   .++|.+.+++.. 
T Consensus        69 ~~~~~~~~~y~~~a~~iI~VvD~td~~~~~~~~~~l~~~l~~~~~~~~PiLiv~NK~Dl~~a~~---~~eI~~~l~l~~~  145 (173)
T cd04155          69 RAIRPYWRNYFENTDCLIYVIDSADKKRLEEAGAELVELLEEEKLAGVPVLVFANKQDLATAAP---AEEIAEALNLHDL  145 (173)
T ss_pred             HHHHHHHHHHCCCCCEEEEEEECCCHHHHHHHHHHHHHHHHHHHCCCCCEEEEEECCCCCCCCC---HHHHHHHHCHHHC
T ss_conf             1012689976555637999996675688999999999997413006983899997666777899---9999998587643


Q ss_pred             ----HHHHHHHHHCCCCCCHHHHHHHH
Q ss_conf             ----21000111002232006787763
Q gi|254780321|r  163 ----EDALLVSAKTGEGIPLLLERIVQ  185 (606)
Q Consensus       163 ----~~ii~vSAktG~GV~~LLd~Iv~  185 (606)
                          ..+++|||++|.||++.||-|++
T Consensus       146 ~~~~~~i~~~SA~tG~Gi~E~f~WL~~  172 (173)
T cd04155         146 RDRTWHIQACSAKTGEGLQEGMNWVCK  172 (173)
T ss_pred             CCCCCEEEEEECCCCCCHHHHHHHHHC
T ss_conf             488758999578579398999999854


No 111
>cd04164 trmE TrmE (MnmE, ThdF, MSS1) is a 3-domain protein found in bacteria and eukaryotes.  It controls modification of the uridine at the wobble position (U34) of tRNAs that read codons ending with A or G in the mixed codon family boxes.  TrmE contains a GTPase domain that forms a canonical Ras-like fold.  It functions a molecular switch GTPase, and apparently uses a conformational change associated with GTP hydrolysis to promote the tRNA modification reaction, in which the conserved cysteine in the C-terminal domain is thought to function as a catalytic residue.  In bacteria that are able to survive in extremely low pH conditions, TrmE regulates glutamate-dependent acid resistance.
Probab=99.66  E-value=1.8e-15  Score=123.30  Aligned_cols=146  Identities=29%  Similarity=0.423  Sum_probs=100.0

Q ss_pred             EEEEECCCCCCHHHHHHHHHHHCCCCCCCCCCCEEECCCHHHHHHCCEEEEEEEEEEEECCCCCEEEEEEEECCCCCHHH
Q ss_conf             79998013898778899999982980544443113058677987195052327999974378843899996178730027
Q gi|254780321|r   13 NFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVRLNYTSTDAKDYQLNLIDTPGHVDFT   92 (606)
Q Consensus        13 N~~IiaHvDhGKTTL~d~lL~~tg~i~~~~~~~~vlD~~~~EreRGITIka~~~~~~~~~~~~~~y~iNlIDTPGH~DF~   92 (606)
                      +++|+|.-.+|||||.-+|   +|.  +...   +.+      .-|.|-......+     ++++|.+.|+||||..+..
T Consensus         3 ~ValvG~pN~GKStL~N~l---~g~--~~~i---vs~------~pgtTrd~~~~~~-----~~~~~~i~l~DTpG~~~~~   63 (157)
T cd04164           3 KVVIVGKPNVGKSSLLNAL---AGR--DRAI---VSD------IAGTTRDVIEESI-----DIGGIPVRLIDTAGIRETE   63 (157)
T ss_pred             EEEEECCCCCCHHHHHHHH---HCC--CCEE---ECC------CCCEEEECCEEEE-----EECCEEEEEEECCCCCCCC
T ss_conf             9999889999899999999---689--7334---328------8984786326789-----5399889997267754445


Q ss_pred             HHH-----HHHHH---HCCEEEEEEECCCCCCHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCCHHHHHHHHHHHHHHH
Q ss_conf             999-----99997---3026899998687886558999999997099679983267887532113388877555322321
Q gi|254780321|r   93 YEV-----SRSLS---ACEGSLLVVDATQGVEAQTLANVYQAIDNNHEIITVLNKADLPSADPDRVKKQIEETIGISTED  164 (606)
Q Consensus        93 ~EV-----~r~l~---a~dgaiLvVdA~~Gvq~QT~~~~~~A~~~~l~~I~viNKiD~~~A~~e~v~~ei~~~~g~~~~~  164 (606)
                      ..+     .+++.   -+|.+++|+|+..+...+-...+  ....+.|+++|+||+|+...  ++    ....  ....+
T Consensus        64 ~~~e~~~~~~~~~~i~~aDlil~vvD~~~~~~~~~~~~~--~~~~~~p~i~v~NKiDl~~~--~~----~~~~--~~~~~  133 (157)
T cd04164          64 DEIEKIGIERAREAIEEADLVLFVIDASRGLDEEDLEIL--ELPADKPIIVVLNKSDLLPD--SE----LLSL--LAGKP  133 (157)
T ss_pred             CHHHHHHHHHHHHHCCCCCEEEEEEECCCCCCHHHHHHH--HHHCCCCEEEEEECCCCCCC--HH----HHHH--CCCCC
T ss_conf             789999999998630157679999889877888899999--85147998999967601486--66----7985--28997


Q ss_pred             HHHHHHHCCCCCCHHHHHHHHHH
Q ss_conf             00011100223200678776321
Q gi|254780321|r  165 ALLVSAKTGEGIPLLLERIVQQL  187 (606)
Q Consensus       165 ii~vSAktG~GV~~LLd~Iv~~i  187 (606)
                      ++++||++|.|+++|++.|.+..
T Consensus       134 vi~ISA~~g~Gi~~L~~~I~e~a  156 (157)
T cd04164         134 IIAISAKTGEGLDELKEALLELA  156 (157)
T ss_pred             EEEEECCCCCCHHHHHHHHHHHC
T ss_conf             79998527959999999999972


No 112
>COG1160 Predicted GTPases [General function prediction only]
Probab=99.66  E-value=3.2e-15  Score=121.67  Aligned_cols=155  Identities=26%  Similarity=0.304  Sum_probs=114.2

Q ss_pred             EEEEEECCCCCCHHHHHHHHHHHCCCCCCCCCCCEEECCCHHHHHHCCEEEEEEEEEEEECCCCCEEEEEEEECCCCCHH
Q ss_conf             17999801389877889999998298054444311305867798719505232799997437884389999617873002
Q gi|254780321|r   12 RNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVRLNYTSTDAKDYQLNLIDTPGHVDF   91 (606)
Q Consensus        12 RN~~IiaHvDhGKTTL~d~lL~~tg~i~~~~~~~~vlD~~~~EreRGITIka~~~~~~~~~~~~~~y~iNlIDTPGH~DF   91 (606)
                      .-+||+|--.-|||||--||.   |.   |.+  =|-|.-      |.|=     .-.|...+|..+.+.+|||+|-.+.
T Consensus         4 ~~VAIVGRPNVGKSTLFNRL~---g~---r~A--IV~D~p------GvTR-----Dr~y~~~~~~~~~f~lIDTgGl~~~   64 (444)
T COG1160           4 PVVAIVGRPNVGKSTLFNRLT---GR---RIA--IVSDTP------GVTR-----DRIYGDAEWLGREFILIDTGGLDDG   64 (444)
T ss_pred             CEEEEECCCCCCHHHHHHHHH---CC---EEE--EEECCC------CCCC-----CCCCCEEEECCCEEEEEECCCCCCC
T ss_conf             789998999875899998875---77---026--760699------9755-----7754506983860799978997768


Q ss_pred             H-----H----HHHHHHHHCCEEEEEEECCCCCCHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCCHHHHHHHHHHHHH
Q ss_conf             7-----9----999999730268999986878865589999999970996799832678875321133888775553223
Q gi|254780321|r   92 T-----Y----EVSRSLSACEGSLLVVDATQGVEAQTLANVYQAIDNNHEIITVLNKADLPSADPDRVKKQIEETIGIST  162 (606)
Q Consensus        92 ~-----~----EV~r~l~a~dgaiLvVdA~~Gvq~QT~~~~~~A~~~~l~~I~viNKiD~~~A~~e~v~~ei~~~~g~~~  162 (606)
                      .     .    .+..++.-+|.+|+|||+.+|+.++-......-+..+.|+|+|+||+|-..     -...+.++..+--
T Consensus        65 ~~~~l~~~i~~Qa~~Ai~eADvilfvVD~~~Git~~D~~ia~~Lr~~~kpviLvvNK~D~~~-----~e~~~~efyslG~  139 (444)
T COG1160          65 DEDELQELIREQALIAIEEADVILFVVDGREGITPADEEIAKILRRSKKPVILVVNKIDNLK-----AEELAYEFYSLGF  139 (444)
T ss_pred             CCHHHHHHHHHHHHHHHHHCCEEEEEEECCCCCCHHHHHHHHHHHHCCCCEEEEEECCCCCH-----HHHHHHHHHHCCC
T ss_conf             81289999999999999767999999848878997899999999853998899997666730-----4564899986478


Q ss_pred             HHHHHHHHHCCCCCCHHHHHHHHHHHCCC
Q ss_conf             21000111002232006787763210001
Q gi|254780321|r  163 EDALLVSAKTGEGIPLLLERIVQQLPSPT  191 (606)
Q Consensus       163 ~~ii~vSAktG~GV~~LLd~Iv~~iP~P~  191 (606)
                      .+.+++||..|.|+.+|+|+|++.+| |.
T Consensus       140 g~~~~ISA~Hg~Gi~dLld~v~~~l~-~~  167 (444)
T COG1160         140 GEPVPISAEHGRGIGDLLDAVLELLP-PD  167 (444)
T ss_pred             CCCEEEEHHHCCCHHHHHHHHHHHCC-CC
T ss_conf             98268425535698999999997567-74


No 113
>PRK09518 bifunctional cytidylate kinase/GTP-binding protein; Reviewed
Probab=99.65  E-value=4.1e-15  Score=120.95  Aligned_cols=160  Identities=24%  Similarity=0.329  Sum_probs=112.8

Q ss_pred             HHHCEEEEEECCCCCCHHHHHHHHHHHCCCCCCCCCCCEEECCCHHHHHHCCEEEEEEEEEEEECCCCCEEEEEEEECCC
Q ss_conf             52531799980138987788999999829805444431130586779871950523279999743788438999961787
Q gi|254780321|r    8 LSRIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVRLNYTSTDAKDYQLNLIDTPG   87 (606)
Q Consensus         8 ~~~IRN~~IiaHvDhGKTTL~d~lL~~tg~i~~~~~~~~vlD~~~~EreRGITIka~~~~~~~~~~~~~~y~iNlIDTPG   87 (606)
                      .+..+++||||--..|||||.-+||-.--.+...              .-|.|.-|-.+.+.|     ++..+.||||.|
T Consensus       449 ~~~~~rIAIIGRPNVGKSTLiN~LlgeeR~IVs~--------------iaGTTRDsId~~~~~-----~g~~~~lIDTAG  509 (714)
T PRK09518        449 LSGLRRVALVGRPNVGKSSLLNQLTREERAVVND--------------LAGTTRDPVDEIVNI-----DGKDWLFVDTAG  509 (714)
T ss_pred             CCCCCEEEEECCCCCCHHHHHHHHHCCCEEEECC--------------CCCCEECEEEEEEEE-----CCEEEEEEECHH
T ss_conf             4677358886699887899999996897588568--------------898502305567999-----997899998600


Q ss_pred             C-----CHH---HHHHHHHH---HHCCEEEEEEECCCCCCHHHHHHHHHHHHCCCCEEEEECCCCCCCCC-CCCHHHHHH
Q ss_conf             3-----002---79999999---73026899998687886558999999997099679983267887532-113388877
Q gi|254780321|r   88 H-----VDF---TYEVSRSL---SACEGSLLVVDATQGVEAQTLANVYQAIDNNHEIITVLNKADLPSAD-PDRVKKQIE  155 (606)
Q Consensus        88 H-----~DF---~~EV~r~l---~a~dgaiLvVdA~~Gvq~QT~~~~~~A~~~~l~~I~viNKiD~~~A~-~e~v~~ei~  155 (606)
                      -     .+-   -+-+.|++   .-||-||||+||++|+..|-.....++.+.|-++|+++||.|+...+ .++...++.
T Consensus       510 iRkk~k~~~~iE~~S~~rt~~aI~~adVvllviDA~~git~QD~~Ia~~i~~~gk~~IivvNKWDLv~~~~~~~~~~~i~  589 (714)
T PRK09518        510 IRRKQKKLTGAEYYASLRTQAAIERCELALILFDASQPISEQDLRVMSMAVDAGRALVLAFNKWDLMDEFRRQRLEREID  589 (714)
T ss_pred             CCCCCCCCCCCCHHHHHHHHHHHHHCCEEEEEEECCCCCCHHHHHHHHHHHHHCCCEEEEEECHHCCCHHHHHHHHHHHH
T ss_conf             15244325432279999999988658899999867767528999999999985993799996143068668999999999


Q ss_pred             HHH-HHHHHHHHHHHHHCCCCCCHHHHHHHHH
Q ss_conf             555-3223210001110022320067877632
Q gi|254780321|r  156 ETI-GISTEDALLVSAKTGEGIPLLLERIVQQ  186 (606)
Q Consensus       156 ~~~-g~~~~~ii~vSAktG~GV~~LLd~Iv~~  186 (606)
                      ..+ -+.-..++++||++|.|++.|++++.+-
T Consensus       590 ~~l~~~~~apiv~iSA~~g~~v~kl~~~i~~~  621 (714)
T PRK09518        590 TEFDRVMWAERVNISAKTGRHTNRLARAMDKA  621 (714)
T ss_pred             HHCCCCCCCCEEEEECCCCCCHHHHHHHHHHH
T ss_conf             75636899988999667897889999999999


No 114
>KOG0052 consensus
Probab=99.65  E-value=3.6e-17  Score=134.78  Aligned_cols=125  Identities=34%  Similarity=0.527  Sum_probs=101.3

Q ss_pred             CEEEEEECCCCCCHHHHHHHHHHHCCCCCCCCCC----------------CEEECCCHHHHHHCCEEEEEEEEEEEECCC
Q ss_conf             3179998013898778899999982980544443----------------113058677987195052327999974378
Q gi|254780321|r   11 IRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMS----------------SQVLDNMDIERERGITIKAQTVRLNYTSTD   74 (606)
Q Consensus        11 IRN~~IiaHvDhGKTTL~d~lL~~tg~i~~~~~~----------------~~vlD~~~~EreRGITIka~~~~~~~~~~~   74 (606)
                      -+|+++|+|+|.||||+..   +.+|.++.|.+.                +.++|++..||||||||..    ..| ...
T Consensus         7 ~~ni~~i~h~~s~~stt~~---~~~g~id~~~~~k~~keaa~~~kgsf~~a~~~dk~~ae~~r~i~I~~----~l~-~~~   78 (391)
T KOG0052           7 HINIVVIGHVDSGKSTTTG---YKCGGIDKRTIEKFEKEAAEMGKGSFKYAWVLDKLKAERERGITIDI----ALW-KFE   78 (391)
T ss_pred             CCCEEEEEEEEEEEEEEEE---EECCCCCCHHHHHHCHHHHHHCCCEEEEEEEECHHHHCCCCCEEEEE----EEE-CCC
T ss_conf             3025898763221268986---30366453013330667776356416655431111211146548999----850-433


Q ss_pred             CCEEEEEEEECCCCCHHHHHHHHHHHHCCEEEEEEEC-CCCCC------HHHHHHHHHHHHCCCC-EEEEECCCCCC
Q ss_conf             8438999961787300279999999730268999986-87886------5589999999970996-79983267887
Q gi|254780321|r   75 AKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDA-TQGVE------AQTLANVYQAIDNNHE-IITVLNKADLP  143 (606)
Q Consensus        75 ~~~y~iNlIDTPGH~DF~~EV~r~l~a~dgaiLvVdA-~~Gvq------~QT~~~~~~A~~~~l~-~I~viNKiD~~  143 (606)
                      ...|.+++||.|||-||+..+....+++|.|+|.|.| +.+.+      .||++|+.+|...|.+ +|+-+||||..
T Consensus        79 t~k~~i~iid~pgh~d~~k~mitg~sqaD~avliva~~~gefEagiskngqt~ehalla~tlgv~qliv~v~k~D~~  155 (391)
T KOG0052          79 TSKYYVTIIDAPGHRDFIKNMITGTSQADCAVLIVAAGTGEFEAGISKNGQTREHALLAFTLGVKQLIVGVNKMDST  155 (391)
T ss_pred             CEEEEEEEECCCCCCCEEEEEEEEEEEECCEEEEEEEECCCEEEECCCCCHHHHHHHHHCCCCCEEEEEEEECCCCC
T ss_conf             10677998537788742146876687623058999750353355203351144565553103531456776034336


No 115
>TIGR03598 GTPase_YsxC ribosome biogenesis GTP-binding protein YsxC/EngB. Members of this protein family are a GTPase associated with ribosome biogenesis, typified by YsxC from Bacillus subutilis. The family is widely but not universally distributed among bacteria. Members commonly are called EngB based on homology to EngA, one of several other GTPases of ribosome biogenesis. Cutoffs as set find essentially all bacterial members, but also identify large numbers of eukaryotic (probably organellar) sequences. This protein is found in about 80 percent of bacterial genomes.
Probab=99.64  E-value=2.7e-15  Score=122.20  Aligned_cols=154  Identities=19%  Similarity=0.273  Sum_probs=105.3

Q ss_pred             CCCCCHHHCEEEEEECCCCCCHHHHHHHHHHHCCCCCCCCCCCEEECCCHHHHHHCCEEEEEEEEEEEECCCCCEEEEEE
Q ss_conf             88998525317999801389877889999998298054444311305867798719505232799997437884389999
Q gi|254780321|r    3 KKPTPLSRIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVRLNYTSTDAKDYQLNL   82 (606)
Q Consensus         3 ~~~~p~~~IRN~~IiaHvDhGKTTL~d~lL~~tg~i~~~~~~~~vlD~~~~EreRGITIka~~~~~~~~~~~~~~y~iNl   82 (606)
                      ++..|.++.=-|||+|.-..|||||.-+|+   |.  ++-+  .+      ....|.|-     .+.+...+   ..+.|
T Consensus        10 ~~~~p~~~~p~IaivGrpNvGKSTL~N~L~---g~--k~~a--~v------s~~pGtTr-----~i~~~~~~---~~~~l   68 (179)
T TIGR03598        10 LKQLPPDDGPEIAFAGRSNVGKSSLINALT---NR--KKLA--RT------SKTPGRTQ-----LINFFEVN---DGFRL   68 (179)
T ss_pred             HHHCCCCCCCEEEEECCCCCCHHHHHHHHH---CC--CCEE--EE------CCCCCEEE-----ECCEEEEC---CCEEE
T ss_conf             767999889789998699988899999986---89--8558--97------08997366-----02320104---73699


Q ss_pred             EECCCC----------CHHHHHHHHHHH---HCCEEEEEEECCCCCCHHHHHHHHHHHHCCCCEEEEECCCCCCC-CCCC
Q ss_conf             617873----------002799999997---30268999986878865589999999970996799832678875-3211
Q gi|254780321|r   83 IDTPGH----------VDFTYEVSRSLS---ACEGSLLVVDATQGVEAQTLANVYQAIDNNHEIITVLNKADLPS-ADPD  148 (606)
Q Consensus        83 IDTPGH----------~DF~~EV~r~l~---a~dgaiLvVdA~~Gvq~QT~~~~~~A~~~~l~~I~viNKiD~~~-A~~e  148 (606)
                      |||||+          ..|...++..+.   .++.+++|+||.+|+..|-...+.++.+.+.++++++||+|+-+ .+..
T Consensus        69 vDtpGyG~~~~~~~~~~~~~~~~~~~~~~~~~l~~villiDa~~gl~~~D~~i~~~l~~~~kp~iivlNK~Dll~~~~~~  148 (179)
T TIGR03598        69 VDLPGYGYAKVSKEEKEKWQKLIEEYLRGRENLKGVVLLMDIRHPLKELDLEMLEWLDERGIPVLIVLTKADKLKKSERN  148 (179)
T ss_pred             EECCCHHHCCCCHHHHHHHHHHHHHHHHHHHHHHCEEEEEECCCCCCHHHHHHHHHHHHCCCCEEEEEECCCCCCHHHHH
T ss_conf             97776021127888899999999999999886430289874377998999999999997599889999781306989999


Q ss_pred             CHHHHHHHHHHH--HHHHHHHHHHHCCCCCC
Q ss_conf             338887755532--23210001110022320
Q gi|254780321|r  149 RVKKQIEETIGI--STEDALLVSAKTGEGIP  177 (606)
Q Consensus       149 ~v~~ei~~~~g~--~~~~ii~vSAktG~GV~  177 (606)
                      +..+++.+.+..  +...++++||++|.|++
T Consensus       149 ~~~~~i~~~l~~~~~~~~v~~ISA~~g~GID  179 (179)
T TIGR03598       149 KQLKKIKKALKKDADDPSVQLFSSLKKTGIE  179 (179)
T ss_pred             HHHHHHHHHHHCCCCCCCEEEEECCCCCCCC
T ss_conf             9999999997336688948999799983879


No 116
>cd04091 mtEFG1_II_like mtEFG1_C: C-terminus of mitochondrial Elongation factor G1 (mtEFG1)-like proteins found in eukaryotes.  Eukaryotic cells harbor 2 protein synthesis systems: one localized in the cytoplasm, the other in the mitochondria. Most factors regulating mitochondrial protein synthesis are encoded by nuclear genes, translated in the cytoplasm, and then transported to the mitochondria. The eukaryotic system of elongation factor (EF) components is more complex than that in prokaryotes, with both cytoplasmic and mitochondrial elongation factors and multiple isoforms being expressed in certain species.  Eukaryotic EF-2 operates in the cytosolic protein synthesis machinery of eukaryotes, EF-Gs in protein synthesis in bacteria.  Eukaryotic mtEFG1 proteins show significant homology to bacterial EF-Gs.  Mutants in yeast mtEFG1 have impaired mitochondrial protein synthesis, respiratory defects and a tendency to lose mitochondrial DNA. There are two forms of mtEFG present in mammals 
Probab=99.62  E-value=1.9e-16  Score=129.88  Aligned_cols=80  Identities=28%  Similarity=0.425  Sum_probs=71.4

Q ss_pred             CCCCCCCEEECCCCCEEEEEEECCCCCCCCCEEEEECCCCCCCCCCCCCCCCC-EEEEHHCCCCCHHHHHHCCCCCCCCC
Q ss_conf             33101210114757259999816987355845887335564210122233554-12401012471233220110024444
Q gi|254780321|r  200 LKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVERIGILTPK-MIDIEALYPGEIGVMIASIKEVSHTR  278 (606)
Q Consensus       200 l~alVfds~~D~~~G~I~~~RV~sG~lk~Gd~I~~~~~g~~~~v~~ig~~~~~-~~~v~~l~aGdVG~ii~gik~l~~~~  278 (606)
                      |.|+||++..||| |+++|+|||||+|++|+.+++.++++++++.++..++++ +.+++++.||||+.+.    ++ ++.
T Consensus         1 f~a~vFK~~~d~~-G~lsf~RVysG~l~~g~~v~n~~~~~~eri~~l~~~~~~~~~~v~~a~aGDIvav~----gl-~~~   74 (81)
T cd04091           1 FVGLAFKLEEGRF-GQLTYMRIYQGKLKKGDTIYNVRTGKKVRVPRLVRMHSNEMEEVEEAGAGDICAIF----GI-DCA   74 (81)
T ss_pred             CCEEEEEEECCCC-CCEEEEEEEEEEECCCCEEEECCCCCEEEEEEEEEEECCCCEECCEECCCCEEEEE----CC-CCC
T ss_conf             9499998761899-88999999672887999999786891687202289978985076568799899998----99-967


Q ss_pred             CCCEECC
Q ss_conf             5420004
Q gi|254780321|r  279 VGDTITD  285 (606)
Q Consensus       279 vGDTl~~  285 (606)
                      +|||||+
T Consensus        75 tGDTL~d   81 (81)
T cd04091          75 SGDTFTD   81 (81)
T ss_pred             CCCCCCC
T ss_conf             4776359


No 117
>PRK04213 GTP-binding protein; Provisional
Probab=99.62  E-value=1.4e-14  Score=117.27  Aligned_cols=153  Identities=26%  Similarity=0.285  Sum_probs=104.4

Q ss_pred             EEEEECCCCCCHHHHHHHHHHHCCCCCCCCCCCEEECCCHHHHHHCCEEEEEEEEEEEECCCCCEEEEEEEECCCCC---
Q ss_conf             79998013898778899999982980544443113058677987195052327999974378843899996178730---
Q gi|254780321|r   13 NFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVRLNYTSTDAKDYQLNLIDTPGHV---   89 (606)
Q Consensus        13 N~~IiaHvDhGKTTL~d~lL~~tg~i~~~~~~~~vlD~~~~EreRGITIka~~~~~~~~~~~~~~y~iNlIDTPGH~---   89 (606)
                      -+||+|.-..|||||.-+|+   |.   +-.   +.+      .-|.|-.     ..+  .+|+++  -|+||||+-   
T Consensus         3 ~VaivGRpNVGKSTL~N~L~---g~---k~~---vs~------~pg~Tr~-----~~~--~~~~~~--~~vDtPG~g~~~   58 (195)
T PRK04213          3 EIIFVGRSNVGKSTLIRALT---GK---KVR---VGK------RPGVTLK-----PNE--YDWGDF--ILVDLPGFGFMS   58 (195)
T ss_pred             EEEEECCCCCCHHHHHHHHH---CC---CCC---CCC------CCCEEEE-----EEE--EECCCE--EEEECCCCCCCC
T ss_conf             79997699988999999996---89---851---348------9964873-----458--850889--999999962224


Q ss_pred             ----HH----HHHH----HHHHHHCCEEEEEEECCCCCC-----------HHHHHHHHHHHHCCCCEEEEECCCCCCCCC
Q ss_conf             ----02----7999----999973026899998687886-----------558999999997099679983267887532
Q gi|254780321|r   90 ----DF----TYEV----SRSLSACEGSLLVVDATQGVE-----------AQTLANVYQAIDNNHEIITVLNKADLPSAD  146 (606)
Q Consensus        90 ----DF----~~EV----~r~l~a~dgaiLvVdA~~Gvq-----------~QT~~~~~~A~~~~l~~I~viNKiD~~~A~  146 (606)
                          ..    ....    +++...++.+++||||..++.           ++-...+.+..+.+.|+|+|+||+|+-. +
T Consensus        59 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~vvD~~~~~~~~dr~~~~~~~~~D~~i~~~l~~~~~p~ilv~NKiD~i~-~  137 (195)
T PRK04213         59 GVPKKVQERIKDEIVHYIEDNADRIAAAVLVVDGKSFPEIIERWESRGEIPIDVEMFDFLRELGINPIVAVNKMDKIK-N  137 (195)
T ss_pred             CCCHHHHHHHHHHHHHHHHHHHHHCCEEEEEEECCCCCCCCCCCCCCCCCHHHHHHHHHHHHCCCCEEEEEECHHHCC-C
T ss_conf             588889999999999999998851789999995786544211234456777789999999874998799998733058-7


Q ss_pred             CCCHHHHHHHHHHHHH------HHHHHHHHHCCCCCCHHHHHHHHHHHCCC
Q ss_conf             1133888775553223------21000111002232006787763210001
Q gi|254780321|r  147 PDRVKKQIEETIGIST------EDALLVSAKTGEGIPLLLERIVQQLPSPT  191 (606)
Q Consensus       147 ~e~v~~ei~~~~g~~~------~~ii~vSAktG~GV~~LLd~Iv~~iP~P~  191 (606)
                      -+....++.+.+++.+      +.++++||++| |+++|++.|.+++|.-+
T Consensus       138 ~~~~l~~i~e~~~~~~~~~~~~~~iv~iSakk~-Gid~L~~~I~~~L~E~~  187 (195)
T PRK04213        138 SEEVLDEIAERLGLYPPWRQWLDIIAPISAKKG-GIEALKGLINKRLREFK  187 (195)
T ss_pred             HHHHHHHHHHHHHCCCCHHHCCCEEEEEECCCC-CHHHHHHHHHHHCHHHC
T ss_conf             788899999998257615656987999845779-99999999999675537


No 118
>cd00878 Arf_Arl Arf (ADP-ribosylation factor)/Arl (Arf-like) small GTPases.  Arf proteins are activators of phospholipase D isoforms.  Unlike Ras proteins they lack cysteine residues at their C-termini and therefore are unlikely to be prenylated.  Arfs are N-terminally myristoylated.  Members of the Arf family are regulators of vesicle formation in intracellular traffic that interact reversibly with membranes of the secretory and endocytic compartments in a GTP-dependent manner.  They depart from other small GTP-binding proteins by a unique structural device, interswitch toggle, that implements front-back communication from N-terminus to the nucleotide binding site.  Arf-like (Arl) proteins are close relatives of the Arf, but only Arl1 has been shown to function in membrane traffic like the Arf proteins.  Arl2 has an unrelated function in the folding of native tubulin, and Arl4 may function in the nucleus.  Most other Arf family proteins are so far relatively poorly characterized.  Thu
Probab=99.62  E-value=9.7e-15  Score=118.42  Aligned_cols=146  Identities=20%  Similarity=0.254  Sum_probs=97.7

Q ss_pred             EEEECCCCCCHHHHHHHHHHHCCCCCCCCCCCEEECCCHHHHHHCCEEEEEEEEEEEECCCCCEEEEEEEECCCCCHHHH
Q ss_conf             99980138987788999999829805444431130586779871950523279999743788438999961787300279
Q gi|254780321|r   14 FSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVRLNYTSTDAKDYQLNLIDTPGHVDFTY   93 (606)
Q Consensus        14 ~~IiaHvDhGKTTL~d~lL~~tg~i~~~~~~~~vlD~~~~EreRGITIka~~~~~~~~~~~~~~y~iNlIDTPGH~DF~~   93 (606)
                      +.++|..+.|||||..|+.  .+.+...            +    -|+.     +.+...+++++.+++.||||+.-|..
T Consensus         2 i~ilG~~~vGKTsll~~l~--~~~~~~~------------~----pTig-----~~~~~i~~~~~~l~iwDt~G~~~~~~   58 (158)
T cd00878           2 ILILGLDGAGKTTILYKLK--LGEVVTT------------I----PTIG-----FNVETVEYKNVSFTVWDVGGQDKIRP   58 (158)
T ss_pred             EEEECCCCCCHHHHHHHHH--CCCCCCC------------C----CEEC-----CCEEEEEECCEEEEEEECCCCCCCCH
T ss_conf             9999999998899999995--3998874------------4----5607-----40899984889999998899722144


Q ss_pred             HHHHHHHHCCEEEEEEECCCCCCHHHHHHH-HHHHH----CCCCEEEEECCCCCCCCCCCCHHHHHHHHHHHHH-----H
Q ss_conf             999999730268999986878865589999-99997----0996799832678875321133888775553223-----2
Q gi|254780321|r   94 EVSRSLSACEGSLLVVDATQGVEAQTLANV-YQAID----NNHEIITVLNKADLPSADPDRVKKQIEETIGIST-----E  163 (606)
Q Consensus        94 EV~r~l~a~dgaiLvVdA~~Gvq~QT~~~~-~~A~~----~~l~~I~viNKiD~~~A~~e~v~~ei~~~~g~~~-----~  163 (606)
                      -.....+-+||+|+|+|+++--.-+....| ...+.    .+.|++++.||+|++++..   ..++.+.++++.     -
T Consensus        59 ~~~~y~~~a~~~i~V~D~t~~~s~~~~~~~~~~~~~~~~~~~~piliv~NK~Dl~~~~~---~~ei~~~l~~~~~~~~~~  135 (158)
T cd00878          59 LWKHYYENTNGIIFVVDSSDRERIEEAKEELHKLLNEEELKGVPLLIFANKQDLPGALS---VSELIEKLGLEKILGRRW  135 (158)
T ss_pred             HHHHHHCCCCEEEEEEECCCHHHHHHHHHHHHHHHHHCCCCCCEEEEEEECCCCCCCCC---HHHHHHHHHHHHHCCCCC
T ss_conf             89987276877689983798889999999999998660557653898760547665789---999999985875107998


Q ss_pred             HHHHHHHHCCCCCCHHHHHHHH
Q ss_conf             1000111002232006787763
Q gi|254780321|r  164 DALLVSAKTGEGIPLLLERIVQ  185 (606)
Q Consensus       164 ~ii~vSAktG~GV~~LLd~Iv~  185 (606)
                      .++.+||++|.||++.++.|.+
T Consensus       136 ~~~~~SAktg~gI~e~f~~L~e  157 (158)
T cd00878         136 HIQPCSAVTGDGLDEGLDWLLQ  157 (158)
T ss_pred             EEEEEECCCCCCHHHHHHHHHC
T ss_conf             9999988879298999999956


No 119
>cd04160 Arfrp1 Arfrp1 subfamily.  Arfrp1 (Arf-related protein 1), formerly known as ARP, is a membrane-associated Arf family member that lacks the N-terminal myristoylation motif.  Arfrp1 is mainly associated with the trans-Golgi compartment and the trans-Golgi network, where it regulates the targeting of Arl1 and the GRIP domain-containing proteins, golgin-97 and golgin-245, onto Golgi membranes.  It is also involved in the anterograde transport of the vesicular stomatitis virus G protein from the Golgi to the plasma membrane, and in the retrograde transport of TGN38 and Shiga toxin from endosomes to the trans-Golgi network.  Arfrp1 also inhibits Arf/Sec7-dependent activation of phospholipase D.  Deletion of Arfrp1 in mice causes embryonic lethality at the gastrulation stage and apoptosis of mesodermal cells, indicating its importance in development.
Probab=99.61  E-value=9.8e-15  Score=118.39  Aligned_cols=152  Identities=20%  Similarity=0.267  Sum_probs=99.6

Q ss_pred             EEEECCCCCCHHHHHHHHHHHCCCCCCCCCCCEEECCCHHHHHH--CCEEEEEEEEEEEECCCCCEEEEEEEECCCCCHH
Q ss_conf             99980138987788999999829805444431130586779871--9505232799997437884389999617873002
Q gi|254780321|r   14 FSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERER--GITIKAQTVRLNYTSTDAKDYQLNLIDTPGHVDF   91 (606)
Q Consensus        14 ~~IiaHvDhGKTTL~d~lL~~tg~i~~~~~~~~vlD~~~~EreR--GITIka~~~~~~~~~~~~~~y~iNlIDTPGH~DF   91 (606)
                      +.++|.-++|||||..||-  +. ......          +...  ..||     .+.+...+++++.+++.||||+..|
T Consensus         2 ivilG~~~~GKTsll~~l~--~~-~~~~~~----------~~~~~~~~Tv-----g~~~~~i~~~~~~l~iwD~~Gqe~~   63 (167)
T cd04160           2 VLILGLDNAGKTTFLEQLK--TL-FSKYKG----------LPPSKITPTV-----GLNIGTIEVGNARLKFWDLGGQESL   63 (167)
T ss_pred             EEEECCCCCCHHHHHHHHH--HC-CCCCCC----------CCCCCCCCCC-----CEEEEEEEECCEEEEEEECCCCHHH
T ss_conf             9999999988889999887--50-367677----------7655403531-----3268999989999999968987888


Q ss_pred             HHHHHHHHHHCCEEEEEEECCCCCC-HHHHHHHHHHHH----CCCCEEEEECCCCCCCCCCCCHHHHHHHHHHHH-----
Q ss_conf             7999999973026899998687886-558999999997----099679983267887532113388877555322-----
Q gi|254780321|r   92 TYEVSRSLSACEGSLLVVDATQGVE-AQTLANVYQAID----NNHEIITVLNKADLPSADPDRVKKQIEETIGIS-----  161 (606)
Q Consensus        92 ~~EV~r~l~a~dgaiLvVdA~~Gvq-~QT~~~~~~A~~----~~l~~I~viNKiD~~~A~~e~v~~ei~~~~g~~-----  161 (606)
                      ..-...-.+-|+|+|+|||+++--. .+....+...+.    .++|++++.||+|+|++..   .+++.+.++..     
T Consensus        64 ~~l~~~y~~~a~~ii~VvD~sd~~~~~~~~~~l~~~~~~~~~~~~pili~~NK~Dl~~~~~---~~ei~~~~~~~~~~~~  140 (167)
T cd04160          64 RSLWDKYYAECHAIIYVIDSTDRERFEESKSALEKVLRNEALEGVPLLILANKQDLPDALS---VEEIKEVFQDKAEEIG  140 (167)
T ss_pred             HHHHHHHCCCCCEEEEEEECCCHHHHHHHHHHHHHHHHCCCCCCCCEEEEEECCCCCCCCC---HHHHHHHHHHHHHHHC
T ss_conf             7899874289878999986686788999999999975110248962999970667665778---9999999999999854


Q ss_pred             --HHHHHHHHHHCCCCCCHHHHHHHHH
Q ss_conf             --3210001110022320067877632
Q gi|254780321|r  162 --TEDALLVSAKTGEGIPLLLERIVQQ  186 (606)
Q Consensus       162 --~~~ii~vSAktG~GV~~LLd~Iv~~  186 (606)
                        .-.+++|||++|.||++.|+-+++.
T Consensus       141 ~~~~~~~~~SAktG~Gv~e~f~wL~~k  167 (167)
T cd04160         141 RRDCLVLPVSALEGTGVREGIEWLVER  167 (167)
T ss_pred             CCCCEEEEEECCCCCCHHHHHHHHHCC
T ss_conf             699899998878294989999999659


No 120
>cd04154 Arl2 Arl2 subfamily.  Arl2 (Arf-like 2) GTPases are members of the Arf family that bind GDP and GTP with very low affinity.  Unlike most Arf family proteins, Arl2 is not myristoylated at its N-terminal helix.  The protein PDE-delta, first identified in photoreceptor rod cells, binds specifically to Arl2 and is structurally very similar to RhoGDI.  Despite the high structural similarity between Arl2 and Rho proteins and between PDE-delta and RhoGDI, the interactions between the GTPases and their effectors are very different.  In its GTP bound form, Arl2 interacts with the protein Binder of Arl2 (BART), and the complex is believed to play a role in mitochondrial adenine nucleotide transport.  In its GDP bound form, Arl2 interacts with tubulin- folding Cofactor D; this interaction is believed to play a role in regulation of microtubule dynamics that impact the cytoskeleton, cell division, and cytokinesis.
Probab=99.61  E-value=1.2e-14  Score=117.82  Aligned_cols=149  Identities=21%  Similarity=0.312  Sum_probs=101.7

Q ss_pred             CEEEEEECCCCCCHHHHHHHHHHHCCCCCCCCCCCEEECCCHHHHHHCCEEEEEEEEEEEECCCCCEEEEEEEECCCCCH
Q ss_conf             31799980138987788999999829805444431130586779871950523279999743788438999961787300
Q gi|254780321|r   11 IRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVRLNYTSTDAKDYQLNLIDTPGHVD   90 (606)
Q Consensus        11 IRN~~IiaHvDhGKTTL~d~lL~~tg~i~~~~~~~~vlD~~~~EreRGITIka~~~~~~~~~~~~~~y~iNlIDTPGH~D   90 (606)
                      =-++.++|.-++|||||..+++  .+.+..  .              ..|+-....++.+     +++.+++-||+|+..
T Consensus        14 ~~KililG~~~sGKTsll~~l~--~~~~~~--~--------------~pT~G~~~~~~~~-----~~~~l~iwD~~G~e~   70 (173)
T cd04154          14 EMRILILGLDNAGKTTILKKLL--GEDIDT--I--------------SPTLGFQIKTLEY-----EGYKLNIWDVGGQKT   70 (173)
T ss_pred             CEEEEEECCCCCCHHHHHHHHC--CCCCCC--C--------------CCCCCEEEEEEEE-----CCEEEEEEECCCCCC
T ss_conf             3189999899978899999983--999897--2--------------6705777899998-----999999996688602


Q ss_pred             HHHHHHHHHHHCCEEEEEEECCCCCCHH-HHHHHHHHH----HCCCCEEEEECCCCCCCCCCCCHHHHHHHHHHHHH---
Q ss_conf             2799999997302689999868788655-899999999----70996799832678875321133888775553223---
Q gi|254780321|r   91 FTYEVSRSLSACEGSLLVVDATQGVEAQ-TLANVYQAI----DNNHEIITVLNKADLPSADPDRVKKQIEETIGIST---  162 (606)
Q Consensus        91 F~~EV~r~l~a~dgaiLvVdA~~Gvq~Q-T~~~~~~A~----~~~l~~I~viNKiD~~~A~~e~v~~ei~~~~g~~~---  162 (606)
                      |..-...-.+-|||+|+|||+++--.-+ .+..++..+    ..+.|++++.||+|++++..   .+||.+.++++.   
T Consensus        71 ~~~~~~~y~~~a~~ii~VvD~td~~~~~~~~~~l~~ll~~~~~~~~pili~~NK~Dl~~~~~---~~ei~~~l~l~~~~~  147 (173)
T cd04154          71 LRPYWRNYFESTDALIWVVDSSDRLRLDDCKRELKELLQEERLAGATLLILANKQDLPGALS---EEEIREALELDKISS  147 (173)
T ss_pred             CCHHHHHHHCCCCEEEEEEECCCHHHHHHHHHHHHHHHHHHHCCCCCEEEEEECCCCCCCCC---HHHHHHHHHHHHCCC
T ss_conf             00589997226653899985565788999999999998635415984799987656777889---999999986874457


Q ss_pred             --HHHHHHHHHCCCCCCHHHHHHHH
Q ss_conf             --21000111002232006787763
Q gi|254780321|r  163 --EDALLVSAKTGEGIPLLLERIVQ  185 (606)
Q Consensus       163 --~~ii~vSAktG~GV~~LLd~Iv~  185 (606)
                        -.+++|||++|.||+++++-+++
T Consensus       148 ~~~~~~~~SAktG~gI~e~f~wL~~  172 (173)
T cd04154         148 HHWRIQPCSAVTGEGLLQGIDWLVD  172 (173)
T ss_pred             CCCEEEEEECCCCCCHHHHHHHHHC
T ss_conf             9829999889669298999999864


No 121
>COG1160 Predicted GTPases [General function prediction only]
Probab=99.59  E-value=1.7e-14  Score=116.76  Aligned_cols=206  Identities=23%  Similarity=0.288  Sum_probs=133.9

Q ss_pred             HCEEEEEECCCCCCHHHHHHHHHHHCCCCCCCCCCCEEECCCHHHHHHCCEEEEEEEEEEEECCCCCEEEEEEEECCCC-
Q ss_conf             5317999801389877889999998298054444311305867798719505232799997437884389999617873-
Q gi|254780321|r   10 RIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVRLNYTSTDAKDYQLNLIDTPGH-   88 (606)
Q Consensus        10 ~IRN~~IiaHvDhGKTTL~d~lL~~tg~i~~~~~~~~vlD~~~~EreRGITIka~~~~~~~~~~~~~~y~iNlIDTPGH-   88 (606)
                      +-.-|||||....|||||.-+||-.--++...              +-|.|+-+  +...|. .+++.  +-||||-|- 
T Consensus       177 ~~ikiaiiGrPNvGKSsLiN~ilgeeR~Iv~~--------------~aGTTRD~--I~~~~e-~~~~~--~~liDTAGiR  237 (444)
T COG1160         177 DPIKIAIIGRPNVGKSSLINAILGEERVIVSD--------------IAGTTRDS--IDIEFE-RDGRK--YVLIDTAGIR  237 (444)
T ss_pred             CCEEEEEEECCCCCCHHHHHHHCCCCEEEECC--------------CCCCCCCC--EEEEEE-ECCEE--EEEEECCCCC
T ss_conf             75089999278787058887750682598459--------------99862203--312589-98818--9999877877


Q ss_pred             ---------CHHHHHHHHHHH---HCCEEEEEEECCCCCCHHHHHHHHHHHHCCCCEEEEECCCCCCC---CCCCCHHHH
Q ss_conf             ---------002799999997---30268999986878865589999999970996799832678875---321133888
Q gi|254780321|r   89 ---------VDFTYEVSRSLS---ACEGSLLVVDATQGVEAQTLANVYQAIDNNHEIITVLNKADLPS---ADPDRVKKQ  153 (606)
Q Consensus        89 ---------~DF~~EV~r~l~---a~dgaiLvVdA~~Gvq~QT~~~~~~A~~~~l~~I~viNKiD~~~---A~~e~v~~e  153 (606)
                               .-|+  |.|++.   .+|-++||+||.+|+..|-.....++.+.|..+|+|+||-|+-.   +..+....+
T Consensus       238 rk~ki~e~~E~~S--v~rt~~aI~~a~vvllviDa~~~~~~qD~~ia~~i~~~g~~~vIvvNKWDl~~~~~~~~~~~k~~  315 (444)
T COG1160         238 RKGKITESVEKYS--VARTLKAIERADVVLLVIDATEGISEQDLRIAGLIEEAGRGIVIVVNKWDLVEEDEATMEEFKKK  315 (444)
T ss_pred             CCCCCCCCEEEEE--EHHHHHHHHHCCEEEEEEECCCCCHHHHHHHHHHHHHCCCCEEEEEECCCCCCCHHHHHHHHHHH
T ss_conf             4664124268875--05467678656889999988878368899999999975897499997532578516679999999


Q ss_pred             HHHHHH-HHHHHHHHHHHHCCCCCCHHHHHHHHHHHCCCCHH---HHHCCCCCCCCCEEEC-C--CCCEEEEEEECCCCC
Q ss_conf             775553-22321000111002232006787763210001111---2201233101210114-7--572599998169873
Q gi|254780321|r  154 IEETIG-ISTEDALLVSAKTGEGIPLLLERIVQQLPSPTSPE---GANAPLKALLIDSWYN-S--YLGVMVLVRIINGQL  226 (606)
Q Consensus       154 i~~~~g-~~~~~ii~vSAktG~GV~~LLd~Iv~~iP~P~~~~---~~~~Pl~alVfds~~D-~--~~G~I~~~RV~sG~l  226 (606)
                      +...+. ++-..++++||++|.|+..|+++|.+-.-.-...-   ..+.-++.-+-  +.- +  +-.++.+.-..++..
T Consensus       316 i~~~l~~l~~a~i~~iSA~~~~~i~~l~~~i~~~~~~~~~ri~Ts~LN~~l~~a~~--~~pP~~~~G~r~ki~Ya~q~~~  393 (444)
T COG1160         316 LRRKLPFLDFAPIVFISALTGQGLDKLFEAIKEIYECATRRISTSLLNRVLEDAVA--KHPPPVRYGRRLKIKYATQVST  393 (444)
T ss_pred             HHHHHCCCCCCEEEEEEECCCCCHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHH--HCCCCCCCCCEEEEEEEECCCC
T ss_conf             99872213677279997047877278899999999986545476899999999997--3899756881688999963678


Q ss_pred             CCCCEEEEECCC
Q ss_conf             558458873355
Q gi|254780321|r  227 TKGQSIRLMGTN  238 (606)
Q Consensus       227 k~Gd~I~~~~~g  238 (606)
                      ++=.-+.+++..
T Consensus       394 ~PP~fvlf~N~~  405 (444)
T COG1160         394 NPPTFVLFGNRP  405 (444)
T ss_pred             CCCEEEEEECCH
T ss_conf             898799993362


No 122
>COG1159 Era GTPase [General function prediction only]
Probab=99.59  E-value=3e-14  Score=115.19  Aligned_cols=157  Identities=24%  Similarity=0.309  Sum_probs=107.2

Q ss_pred             EEEEEECCCCCCHHHHHHHHHHHCCCCCCCCCCCEEECCCHHHHHHCCEEEEEEEEEEEECCCCCEEEEEEEECCCCCH-
Q ss_conf             1799980138987788999999829805444431130586779871950523279999743788438999961787300-
Q gi|254780321|r   12 RNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVRLNYTSTDAKDYQLNLIDTPGHVD-   90 (606)
Q Consensus        12 RN~~IiaHvDhGKTTL~d~lL~~tg~i~~~~~~~~vlD~~~~EreRGITIka~~~~~~~~~~~~~~y~iNlIDTPGH~D-   90 (606)
                      ==+||||--..|||||.-+|+-.-=.+..+..+.        -|-+        ++--+..   ++++|=||||||-.- 
T Consensus         7 GfVaIiGrPNvGKSTLlN~l~G~KisIvS~k~QT--------TR~~--------I~GI~t~---~~~QiIfvDTPGih~p   67 (298)
T COG1159           7 GFVAIIGRPNVGKSTLLNALVGQKISIVSPKPQT--------TRNR--------IRGIVTT---DNAQIIFVDTPGIHKP   67 (298)
T ss_pred             EEEEEECCCCCCHHHHHHHHHCCCEEEECCCCCH--------HHHH--------EEEEEEC---CCCEEEEEECCCCCCC
T ss_conf             9999986998768999989856825751598531--------1442--------1479986---9844999848988876


Q ss_pred             ------H-HHHHHHHHHHCCEEEEEEECCCCCCHHHHHHHHHHHHCCCCEEEEECCCCCCCCCC--CCHHHHHHHHHHHH
Q ss_conf             ------2-79999999730268999986878865589999999970996799832678875321--13388877555322
Q gi|254780321|r   91 ------F-TYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQAIDNNHEIITVLNKADLPSADP--DRVKKQIEETIGIS  161 (606)
Q Consensus        91 ------F-~~EV~r~l~a~dgaiLvVdA~~Gvq~QT~~~~~~A~~~~l~~I~viNKiD~~~A~~--e~v~~ei~~~~g~~  161 (606)
                            + .-++..+|.-||-+|+||||.++.-+.-.+.+..-...+.|+|.++||+|+...+.  ....+.....+++ 
T Consensus        68 k~~l~~~m~~~a~~sl~dvDlilfvvd~~~~~~~~d~~il~~lk~~~~pvil~iNKID~~~~~~~l~~~~~~~~~~~~f-  146 (298)
T COG1159          68 KHALGELMNKAARSALKDVDLILFVVDADEGWGPGDEFILEQLKKTKTPVILVVNKIDKVKPKTVLLKLIAFLKKLLPF-  146 (298)
T ss_pred             CHHHHHHHHHHHHHHHCCCCEEEEEEECCCCCCCCHHHHHHHHHHCCCCEEEEEECCCCCCCHHHHHHHHHHHHHHCCC-
T ss_conf             5178899999999872457599999866656891079999977643898699998402578477899999999850883-


Q ss_pred             HHHHHHHHHHCCCCCCHHHHHHHHHHHC
Q ss_conf             3210001110022320067877632100
Q gi|254780321|r  162 TEDALLVSAKTGEGIPLLLERIVQQLPS  189 (606)
Q Consensus       162 ~~~ii~vSAktG~GV~~LLd~Iv~~iP~  189 (606)
                       .+++|+||++|.|++.|++.+.+++|.
T Consensus       147 -~~ivpiSA~~g~n~~~L~~~i~~~Lpe  173 (298)
T COG1159         147 -KEIVPISALKGDNVDTLLEIIKEYLPE  173 (298)
T ss_pred             -CEEEEEECCCCCCHHHHHHHHHHHCCC
T ss_conf             -017995101567889999999985888


No 123
>cd01897 NOG NOG1 is a nucleolar GTP-binding protein present in eukaryotes ranging from trypanosomes to humans.  NOG1 is functionally linked to ribosome biogenesis and found in association with the nuclear pore complexes and identified in many preribosomal complexes.  Thus, defects in NOG1 can lead to defects in 60S biogenesis.  The S. cerevisiae NOG1 gene is essential for cell viability, and mutations in the predicted G motifs abrogate function.  It is a member of the ODN family of GTP-binding proteins that also includes the bacterial Obg and DRG proteins.
Probab=99.59  E-value=6.6e-14  Score=112.84  Aligned_cols=152  Identities=24%  Similarity=0.329  Sum_probs=95.3

Q ss_pred             EEEEECCCCCCHHHHHHHHHHHCCCCCCCCCCCEEECCCHHHHHHCCEEEEEEEEEEEECCCCCEEEEEEEECCCCCHHH
Q ss_conf             79998013898778899999982980544443113058677987195052327999974378843899996178730027
Q gi|254780321|r   13 NFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVRLNYTSTDAKDYQLNLIDTPGHVDFT   92 (606)
Q Consensus        13 N~~IiaHvDhGKTTL~d~lL~~tg~i~~~~~~~~vlD~~~~EreRGITIka~~~~~~~~~~~~~~y~iNlIDTPGH~DF~   92 (606)
                      -+||+|--..|||||.-+|   +|.  +..    +.++      -|.|-....-.+.     ++++.+.|+||||..+..
T Consensus         2 ~VaivG~pNvGKStL~N~L---~g~--~~~----v~~~------p~TTr~~~~~~~~-----~~~~~~~liDTpGi~~~~   61 (168)
T cd01897           2 TLVIAGYPNVGKSSLVNKL---TRA--KPE----VAPY------PFTTKSLFVGHFD-----YKYLRWQVIDTPGLLDRP   61 (168)
T ss_pred             EEEEECCCCCCHHHHHHHH---HCC--CCE----ECCC------CCCCCCCEEEEEE-----ECCCEEEEECCCCCCCCC
T ss_conf             7999889998899999999---589--860----2375------8723574368999-----837276872488655674


Q ss_pred             ----HHHHH----HHH-HCCEEEEEEECCCCCC--HHHHHHHHHH---HHCCCCEEEEECCCCCCCCCCCCHHHHHHHHH
Q ss_conf             ----99999----997-3026899998687886--5589999999---97099679983267887532113388877555
Q gi|254780321|r   93 ----YEVSR----SLS-ACEGSLLVVDATQGVE--AQTLANVYQA---IDNNHEIITVLNKADLPSADPDRVKKQIEETI  158 (606)
Q Consensus        93 ----~EV~r----~l~-a~dgaiLvVdA~~Gvq--~QT~~~~~~A---~~~~l~~I~viNKiD~~~A~~e~v~~ei~~~~  158 (606)
                          ..+++    +++ ..|..++|+|+++...  ......+...   ...+.|+|+|+||+|+...  +. ..++.+..
T Consensus        62 ~~~~~~ie~~~~~~l~~~~d~il~viD~~~~~~~~~~~~~~l~~~i~~~~~~~p~i~v~NK~Dl~~~--~~-~~~~~~~~  138 (168)
T cd01897          62 LEERNTIEMQAITALAHLRAAVLFLFDPSETCGYSLEEQLSLFEEIKPLFKNKPVIVVLNKIDLLTF--ED-LSEIEEEE  138 (168)
T ss_pred             HHHHHHHHHHHHHHHHHCCCEEEEEEECCCCCCCCHHHHHHHHHHHHHHHCCCCEEEEEECCCCCCC--CC-HHHHHHHH
T ss_conf             7888899999999998357768999968876784899999999987765258887999947534581--00-79999999


Q ss_pred             HHHHHHHHHHHHHCCCCCCHHHHHHHHHH
Q ss_conf             32232100011100223200678776321
Q gi|254780321|r  159 GISTEDALLVSAKTGEGIPLLLERIVQQL  187 (606)
Q Consensus       159 g~~~~~ii~vSAktG~GV~~LLd~Iv~~i  187 (606)
                      .....+++++||++|.|+++|+++|++.+
T Consensus       139 ~~~~~~vi~ISA~~g~Gi~~L~~~i~ell  167 (168)
T cd01897         139 ELEGEEVLKISTLTEEGVDEVKNKACELL  167 (168)
T ss_pred             HCCCCCEEEEECCCCCCHHHHHHHHHHHC
T ss_conf             70899889998158969999999999963


No 124
>cd01878 HflX HflX subfamily.  A distinct conserved domain with a glycine-rich segment N-terminal of the GTPase domain characterizes the HflX subfamily.  The E. coli HflX has been implicated in the control of the lambda cII repressor proteolysis, but the actual biological functions of these GTPases remain unclear.  HflX is widespread, but not universally represented in all three superkingdoms.
Probab=99.57  E-value=1.1e-13  Score=111.41  Aligned_cols=152  Identities=30%  Similarity=0.331  Sum_probs=90.0

Q ss_pred             CEEEEEECCCCCCHHHHHHHHHHHCCCCCCCCCCCEEECCCHHHHHHCCEEEEEEEEEEEECCCCCEEEEEEEECCC-CC
Q ss_conf             31799980138987788999999829805444431130586779871950523279999743788438999961787-30
Q gi|254780321|r   11 IRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVRLNYTSTDAKDYQLNLIDTPG-HV   89 (606)
Q Consensus        11 IRN~~IiaHvDhGKTTL~d~lL~~tg~i~~~~~~~~vlD~~~~EreRGITIka~~~~~~~~~~~~~~y~iNlIDTPG-H~   89 (606)
                      +--+||+|...+|||||.-+|.   |.  +..    +-|+      -|.|.....-.+.+.    ..+.+.|+|||| ..
T Consensus        41 ~p~VaivG~PNvGKSTLlN~L~---g~--~~~----v~~~------~~tT~d~~~~~i~~~----~~~~i~l~DT~G~i~  101 (204)
T cd01878          41 IPTVALVGYTNAGKSTLFNALT---GA--DVY----AEDQ------LFATLDPTTRRLRLP----DGREVLLTDTVGFIR  101 (204)
T ss_pred             CCEEEEECCCCCCHHHHHHHHH---CC--CCE----EECC------CCCCCCCEEEEEEEC----CCCEEEEEECCCCCC
T ss_conf             9879998899998999999994---89--963----4156------776457636689956----997799983686446


Q ss_pred             HHH---HHH-HHH---HHHCCEEEEEEECCCCCC-HHHHHHHHHHH---HCCCCEEEEECCCCCCCCCCCCHHHHHHHHH
Q ss_conf             027---999-999---973026899998687886-55899999999---7099679983267887532113388877555
Q gi|254780321|r   90 DFT---YEV-SRS---LSACEGSLLVVDATQGVE-AQTLANVYQAI---DNNHEIITVLNKADLPSADPDRVKKQIEETI  158 (606)
Q Consensus        90 DF~---~EV-~r~---l~a~dgaiLvVdA~~Gvq-~QT~~~~~~A~---~~~l~~I~viNKiD~~~A~~e~v~~ei~~~~  158 (606)
                      |-.   .|. .++   +.-+|-.|+||||++... .|.........   ..+.|+|+|+||+|+.+.  +.....    +
T Consensus       102 ~~p~~lie~~~~tle~i~~AD~il~vvD~s~~~~~~~~~~~~~~l~~l~~~~k~~i~V~NKiDl~~~--~~~~~~----~  175 (204)
T cd01878         102 DLPHQLVEAFRSTLEEVAEADLLLHVVDASDPDYEEQIETVEKVLKELGAEDIPMILVLNKIDLLDD--EELEER----L  175 (204)
T ss_pred             CCCHHHHHHHHHHHHHHHHCCEEEEEEECCCCCHHHHHHHHHHHHHHHCCCCCCEEEEEECCCCCCC--HHHHHH----H
T ss_conf             7837899999999999973989999997998536677999999999806555760788867047995--758999----9


Q ss_pred             HHHHHHHHHHHHHCCCCCCHHHHHHHHHH
Q ss_conf             32232100011100223200678776321
Q gi|254780321|r  159 GISTEDALLVSAKTGEGIPLLLERIVQQL  187 (606)
Q Consensus       159 g~~~~~ii~vSAktG~GV~~LLd~Iv~~i  187 (606)
                      .....+++++||++|.|++.|+++|.+.+
T Consensus       176 ~~~~~~~i~ISA~~g~Gid~L~~~I~e~L  204 (204)
T cd01878         176 EAGRPDAVFISAKTGEGLDELLEAIEELL  204 (204)
T ss_pred             HHCCCCEEEEECCCCCCHHHHHHHHHHHC
T ss_conf             70899879998868949999999999559


No 125
>cd04152 Arl4_Arl7 Arl4/Arl7 subfamily.  Arl4 (Arf-like 4) is highly expressed in testicular germ cells, and is found in the nucleus and nucleolus.  In mice, Arl4 is developmentally expressed during embryogenesis, and a role in somite formation and central nervous system differentiation has been proposed.  Arl7 has been identified as the only Arf/Arl protein to be induced by agonists of liver X-receptor and retinoid X-receptor and by cholesterol loading in human macrophages.  Arl7 is proposed to play a role in transport between a perinuclear compartment and the plasma membrane, apparently linked to the ABCA1-mediated cholesterol secretion pathway.  Older literature suggests that Arl6 is a part of the Arl4/Arl7 subfamily, but analyses based on more recent sequence data place Arl6 in its own subfamily.
Probab=99.56  E-value=2e-13  Score=109.66  Aligned_cols=156  Identities=17%  Similarity=0.220  Sum_probs=104.1

Q ss_pred             EEEEECCCCCCHHHHHHHHHHHCCCCCCCCCCCEEECCCHHHHHHCCEEEEEEEEEEEECCCCCEEEEEEEECCCCCHHH
Q ss_conf             79998013898778899999982980544443113058677987195052327999974378843899996178730027
Q gi|254780321|r   13 NFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVRLNYTSTDAKDYQLNLIDTPGHVDFT   92 (606)
Q Consensus        13 N~~IiaHvDhGKTTL~d~lL~~tg~i~~~~~~~~vlD~~~~EreRGITIka~~~~~~~~~~~~~~y~iNlIDTPGH~DF~   92 (606)
                      ++.++|--..|||||..|+.  .+.+...                --||-...-.+.+...+++.+.+++-||.|+..|.
T Consensus         5 kIvilG~~~~GKTsil~r~~--~~~f~~~----------------~pTiG~~~~~~~~~~~~~~~v~l~iwDtaGqe~~r   66 (183)
T cd04152           5 HIVMLGLDSAGKTTVLYRLK--FNEFVNT----------------VPTKGFNTEKIKVSLGNSKGITFHFWDVGGQEKLR   66 (183)
T ss_pred             EEEEECCCCCCHHHHHHHHH--CCCCCCC----------------CCCCCEEEEEEEEECCCCCEEEEEEEECCCCCCCC
T ss_conf             99999999998899999996--4986776----------------87035578999996167866799999789873451


Q ss_pred             HHHHHHHHHCCEEEEEEECCCCCCH-HHHHHHHHHH----HCCCCEEEEECCCCCCCCCCCCHHHHHHHHHHHH------
Q ss_conf             9999999730268999986878865-5899999999----7099679983267887532113388877555322------
Q gi|254780321|r   93 YEVSRSLSACEGSLLVVDATQGVEA-QTLANVYQAI----DNNHEIITVLNKADLPSADPDRVKKQIEETIGIS------  161 (606)
Q Consensus        93 ~EV~r~l~a~dgaiLvVdA~~Gvq~-QT~~~~~~A~----~~~l~~I~viNKiD~~~A~~e~v~~ei~~~~g~~------  161 (606)
                      .-...-.+-++|+|+|+|+++--.- +....+...+    ..++|++++-||+|++++...   .++++.+++.      
T Consensus        67 ~l~~~Y~r~a~g~i~V~D~td~~~~~~~~~~l~~~~~~~~~~~~piliv~NK~Dl~~~~~~---~ei~~~l~l~~~~~~~  143 (183)
T cd04152          67 PLWKSYTRCTDGIVFVVDSVDVERMEEAKTELHKITRFSENQGVPVLVLANKQDLPNALSV---SEVEKLLALHELSAST  143 (183)
T ss_pred             EEHHHHHCCCCEEEEEEECCCHHHHHHHHHHHHHHHHCCCCCCCEEEEEEECCCCCCCCCH---HHHHHHHHHHHHHCCC
T ss_conf             0087674678678999967768899999999999973212379629999866777668788---9999997199986669


Q ss_pred             HHHHHHHHHHCCCCCCHHHHHHHHHHHC
Q ss_conf             3210001110022320067877632100
Q gi|254780321|r  162 TEDALLVSAKTGEGIPLLLERIVQQLPS  189 (606)
Q Consensus       162 ~~~ii~vSAktG~GV~~LLd~Iv~~iP~  189 (606)
                      .-.+..|||++|.||++.++.+++.+-.
T Consensus       144 ~~~i~~tSA~tG~gI~e~f~~L~~~i~~  171 (183)
T cd04152         144 PWHVQPACAIIGEGLQEGLEKLYEMILK  171 (183)
T ss_pred             CCEEEEEECCCCCCHHHHHHHHHHHHHH
T ss_conf             9899972799796989999999999999


No 126
>cd00882 Ras_like_GTPase Ras-like GTPase superfamily. The Ras-like superfamily of small GTPases consists of several families with an extremely high degree of structural and functional similarity. The Ras superfamily is divided into at least four families in eukaryotes: the Ras, Rho, Rab, and Sar1/Arf families.  This superfamily also includes proteins like the GTP translation factors, Era-like GTPases, and G-alpha chain of the heterotrimeric G proteins.  Members of the Ras superfamily regulate a wide variety of cellular functions: the Ras family regulates gene expression, the Rho family regulates cytoskeletal reorganization and gene expression, the Rab and Sar1/Arf families regulate vesicle trafficking, and the Ran family regulates nucleocytoplasmic transport and microtubule organization. The GTP translation factor family regulate initiation, elongation, termination, and release in translation, and the Era-like GTPase family regulates cell division, sporulation, and DNA replication. Memb
Probab=99.55  E-value=2e-13  Score=109.67  Aligned_cols=151  Identities=25%  Similarity=0.283  Sum_probs=102.2

Q ss_pred             EECCCCCCHHHHHHHHHHHCCCCCCCCCCCEEECCCHHHHHHCCE-EEEEEEEEEEECCCCCEEEEEEEECCCCCHHHHH
Q ss_conf             980138987788999999829805444431130586779871950-5232799997437884389999617873002799
Q gi|254780321|r   16 IVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGIT-IKAQTVRLNYTSTDAKDYQLNLIDTPGHVDFTYE   94 (606)
Q Consensus        16 IiaHvDhGKTTL~d~lL~~tg~i~~~~~~~~vlD~~~~EreRGIT-Ika~~~~~~~~~~~~~~y~iNlIDTPGH~DF~~E   94 (606)
                      ++|+.++|||||..+++.  +.....              ++..| +......+.   .++..+.++++||||+.+|...
T Consensus         1 vvG~~~~GKSsl~~~~~~--~~~~~~--------------~~~~~~~~~~~~~~~---~~~~~~~~~i~D~~g~~~~~~~   61 (157)
T cd00882           1 VVGDSGVGKTSLLNRLLG--GEFVPE--------------EYETTIIDFYSKTIE---VDGKKVKLQIWDTAGQERFRSL   61 (157)
T ss_pred             CCCCCCCCHHHHHHHHHC--CCCCCC--------------CCCCCEEEEEEEEEE---ECCEEEEEEEEECCCCHHHHHH
T ss_conf             929499688999999971--988876--------------468715789999999---9999999999985895115678


Q ss_pred             HHHHHHHCCEEEEEEECCCCCCHHHHHHHH--H---HHHCCCCEEEEECCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHH
Q ss_conf             999997302689999868788655899999--9---99709967998326788753211338887755532232100011
Q gi|254780321|r   95 VSRSLSACEGSLLVVDATQGVEAQTLANVY--Q---AIDNNHEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVS  169 (606)
Q Consensus        95 V~r~l~a~dgaiLvVdA~~Gvq~QT~~~~~--~---A~~~~l~~I~viNKiD~~~A~~e~v~~ei~~~~g~~~~~ii~vS  169 (606)
                      ....+.-+|++++|+|.++.-.-+....|+  .   ....+.++++|.||+|++..+.....++.+.......-..+.+|
T Consensus        62 ~~~~~~~~~~~i~v~d~~~~~s~~~~~~~~~~~~~~~~~~~~~iiiv~nK~Dl~~~~~~~~~~~~~~~~~~~~~~~~~~S  141 (157)
T cd00882          62 RRLYYRGADGIILVYDVTDRESFENVKEWLLLILINKEGENIPIILVGNKIDLPEERVVSEEELAEQLAKELGVPYFETS  141 (157)
T ss_pred             HHHHHHHCCEEEEEEECCCHHHHHHHHHHHHHHHHHHCCCCCCEEEEEECCCCHHCCCCCHHHHHHHHHHHCCCEEEEEC
T ss_conf             99997535799999865888889999999999999752589849999853561540668899999999987898699984


Q ss_pred             HHCCCCCCHHHHHHHH
Q ss_conf             1002232006787763
Q gi|254780321|r  170 AKTGEGIPLLLERIVQ  185 (606)
Q Consensus       170 AktG~GV~~LLd~Iv~  185 (606)
                      |++|.||+++++.|++
T Consensus       142 a~~~~~i~~l~~~i~~  157 (157)
T cd00882         142 AKTGENVEELFEELAE  157 (157)
T ss_pred             CCCCCCHHHHHHHHHC
T ss_conf             7888399999999859


No 127
>cd01879 FeoB Ferrous iron transport protein B (FeoB) subfamily.  E. coli has an iron(II) transport system, known as feo, which may make an important contribution to the iron supply of the cell under anaerobic conditions.  FeoB has been identified as part of this transport system.  FeoB is a large 700-800 amino acid integral membrane protein. The N terminus contains a P-loop motif suggesting that iron transport may be ATP dependent.
Probab=99.55  E-value=6.5e-14  Score=112.88  Aligned_cols=147  Identities=24%  Similarity=0.360  Sum_probs=93.4

Q ss_pred             EECCCCCCHHHHHHHHHHHCCCCCCCCCCCEEECCCHHHHHHCCEEEEEEEEEEEECCCCCEEEEEEEECCCCCHH---H
Q ss_conf             9801389877889999998298054444311305867798719505232799997437884389999617873002---7
Q gi|254780321|r   16 IVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVRLNYTSTDAKDYQLNLIDTPGHVDF---T   92 (606)
Q Consensus        16 IiaHvDhGKTTL~d~lL~~tg~i~~~~~~~~vlD~~~~EreRGITIka~~~~~~~~~~~~~~y~iNlIDTPGH~DF---~   92 (606)
                      |||.-..|||||.-+|+   |.   +.   .+.|      .-|.|.......+.     +.++.+-|+||||..++   +
T Consensus         1 ivG~pNvGKSTL~N~L~---g~---~~---~vs~------~pgtTrd~~~~~~~-----~~~~~~~lvDtpGi~~~~~~~   60 (158)
T cd01879           1 LVGNPNVGKTTLFNALT---GA---RQ---KVGN------WPGVTVEKKEGRFK-----LGGKEIEIVDLPGTYSLSPYS   60 (158)
T ss_pred             CCCCCCCCHHHHHHHHH---CC---CC---EECC------CCCCEEEEEEEEEE-----ECCEEEEEEECCCCCCCCCCC
T ss_conf             97989888999999995---99---86---4617------89827634788996-----299379999798741256413


Q ss_pred             H--HHHHHH---HHCCEEEEEEECCCCCCHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCC-HHHHHHHHHHHHHHHHH
Q ss_conf             9--999999---73026899998687886558999999997099679983267887532113-38887755532232100
Q gi|254780321|r   93 Y--EVSRSL---SACEGSLLVVDATQGVEAQTLANVYQAIDNNHEIITVLNKADLPSADPDR-VKKQIEETIGISTEDAL  166 (606)
Q Consensus        93 ~--EV~r~l---~a~dgaiLvVdA~~Gvq~QT~~~~~~A~~~~l~~I~viNKiD~~~A~~e~-v~~ei~~~~g~~~~~ii  166 (606)
                      -  .+.+..   .-+|.+++|+||++ ++. ....+....+.+.|+|+|+||+|+....... ..+++++.+++   +++
T Consensus        61 ~~e~i~~~~~~~~~~d~vl~vvD~~~-~~~-~l~~~~~l~~~~~p~ivV~NK~D~~~~~~~~~~~~~l~~~~~~---~ii  135 (158)
T cd01879          61 EDEKVARDFLLGEKPDLIVNVVDATN-LER-NLYLTLQLLELGLPVVVALNMIDEAEKRGIKIDLDKLSELLGV---PVV  135 (158)
T ss_pred             HHHHHHHHHHHHCCCCCEEEEEECCH-HHH-HHHHHHHHHHCCCCEEEEEEHHHHHHHCCCHHHHHHHHHHCCC---CEE
T ss_conf             56789999998517871799977740-677-6899999986599889994027765522546679999987199---489


Q ss_pred             HHHHHCCCCCCHHHHHHHHHH
Q ss_conf             011100223200678776321
Q gi|254780321|r  167 LVSAKTGEGIPLLLERIVQQL  187 (606)
Q Consensus       167 ~vSAktG~GV~~LLd~Iv~~i  187 (606)
                      ++||++|.|+++|++.|.+.+
T Consensus       136 ~iSA~~g~Gi~~L~~~i~el~  156 (158)
T cd01879         136 PTSARKGEGIDELKDAIAELA  156 (158)
T ss_pred             EEECCCCCCHHHHHHHHHHHH
T ss_conf             998778979999999999986


No 128
>pfam00071 Ras Ras family. Includes sub-families Ras, Rab, Rac, Ral, Ran, Rap Ypt1 and more. Shares P-loop motif with GTP_EFTU, arf and myosin_head. See pfam00009 pfam00025, pfam00063. As regards Rab GTPases, these are important regulators of vesicle formation, motility and fusion. They share a fold in common with all Ras GTPases: this is a six-stranded beta-sheet surrounded by five alpha-helices.
Probab=99.54  E-value=1.7e-13  Score=110.11  Aligned_cols=155  Identities=24%  Similarity=0.233  Sum_probs=101.9

Q ss_pred             EEEECCCCCCHHHHHHHHHHHCCCCCCCCCCCEEECCCHHHHHHCCEEEEEEEEEEEECCCCCEEEEEEEECCCCCHHHH
Q ss_conf             99980138987788999999829805444431130586779871950523279999743788438999961787300279
Q gi|254780321|r   14 FSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVRLNYTSTDAKDYQLNLIDTPGHVDFTY   93 (606)
Q Consensus        14 ~~IiaHvDhGKTTL~d~lL~~tg~i~~~~~~~~vlD~~~~EreRGITIka~~~~~~~~~~~~~~y~iNlIDTPGH~DF~~   93 (606)
                      ++++|.-+.|||||..|++  +|.+.+..             .-.+........+.   .+++.+.++|.||||...|..
T Consensus         2 i~vvG~~~vGKTsli~r~~--~~~f~~~~-------------~~t~~~~~~~~~~~---~~~~~~~~~i~Dt~G~e~~~~   63 (162)
T pfam00071         2 LVLVGDGGVGKSSLLIRFT--QNKFPEEY-------------IPTIGVDFYTKTIE---VDGKTVKLQIWDTAGQERFRA   63 (162)
T ss_pred             EEEECCCCCCHHHHHHHHH--HCCCCCCC-------------CCCCEEEEEEEEEE---ECCEEEEEEEEECCCCHHHHH
T ss_conf             8999979977999999996--19999874-------------77413556789999---999999999997898720467


Q ss_pred             HHHHHHHHCCEEEEEEECCCCCCHHHHHHHHH-HHH---CCCCEEEEECCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHH
Q ss_conf             99999973026899998687886558999999-997---09967998326788753211338887755532232100011
Q gi|254780321|r   94 EVSRSLSACEGSLLVVDATQGVEAQTLANVYQ-AID---NNHEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVS  169 (606)
Q Consensus        94 EV~r~l~a~dgaiLvVdA~~Gvq~QT~~~~~~-A~~---~~l~~I~viNKiD~~~A~~e~v~~ei~~~~g~~~~~ii~vS  169 (606)
                      .....++-+|++|+|.|.++=---+....|.. +.+   .++|+|+|-||+|++..+.- -.++.+++..--.-..+.+|
T Consensus        64 ~~~~~~~~ad~~iivfd~~~~~S~~~i~~~~~~i~~~~~~~~piilvgnK~Dl~~~~~i-~~~e~~~~a~~~~~~y~e~S  142 (162)
T pfam00071        64 LRPLYYRGAQGFLLVYDITSRDSFENVKKWLEEILRHADDNVPIVLVGNKCDLEDQRVV-STEEGEALAKELGLPFMETS  142 (162)
T ss_pred             HHHHHHCCCCCCEEECCCCCHHHHHHHHHHHHHHHHHCCCCCEEEEEEECCCHHHCCCC-CHHHHHHHHHHHCCEEEEEC
T ss_conf             88998625765504234898899999999999999857988628899752474651889-99999999998099799973


Q ss_pred             HHCCCCCCHHHHHHHHHH
Q ss_conf             100223200678776321
Q gi|254780321|r  170 AKTGEGIPLLLERIVQQL  187 (606)
Q Consensus       170 AktG~GV~~LLd~Iv~~i  187 (606)
                      |++|.||+++++.|++.+
T Consensus       143 ak~g~gI~~~F~~i~~~i  160 (162)
T pfam00071       143 AKTNENVEEAFEELAREI  160 (162)
T ss_pred             CCCCCCHHHHHHHHHHHH
T ss_conf             788829999999999996


No 129
>cd01898 Obg Obg subfamily.  The Obg nucleotide binding protein subfamily has been implicated in stress response, chromosome partitioning, replication initiation, mycelium development, and sporulation.  Obg proteins are among a large group of GTP binding proteins conserved from bacteria to humans.  The E. coli homolog, ObgE is believed to function in ribosomal biogenesis.  Members of the subfamily contain two equally and highly conserved domains, a C-terminal GTP binding domain and an N-terminal glycine-rich domain.
Probab=99.54  E-value=1.8e-13  Score=109.99  Aligned_cols=154  Identities=21%  Similarity=0.269  Sum_probs=93.6

Q ss_pred             EEEEECCCCCCHHHHHHHHHHHCCCCCCCCCCCEEECCCHHHHHHCCEEEEEEEEEEEECCCCCEEEEEEEECCCC----
Q ss_conf             7999801389877889999998298054444311305867798719505232799997437884389999617873----
Q gi|254780321|r   13 NFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVRLNYTSTDAKDYQLNLIDTPGH----   88 (606)
Q Consensus        13 N~~IiaHvDhGKTTL~d~lL~~tg~i~~~~~~~~vlD~~~~EreRGITIka~~~~~~~~~~~~~~y~iNlIDTPGH----   88 (606)
                      ++||||--..|||||.-+|   +|.  +..    +.|+      -|-|.....-.+.+  .  ....+-|+||||.    
T Consensus         2 ~VAiiG~pNvGKSTLlN~l---~~~--~~~----V~~~------pgTT~~~~~g~i~~--~--~~~~i~~~DtpGi~~~~   62 (170)
T cd01898           2 DVGLVGLPNAGKSTLLSAI---SNA--KPK----IADY------PFTTLVPNLGVVRV--D--DGRSFVVADIPGLIEGA   62 (170)
T ss_pred             CEEEECCCCCCHHHHHHHH---HCC--CCE----EECC------CCCCCCCEEEEEEE--C--CCCEEEEECCCCCCCCC
T ss_conf             5899899999899999999---678--760----3256------66523744779993--6--98569996488644455


Q ss_pred             -CHH--HHHHHHHHHHCCEEEEEEECCCCCCH-HHHHHHHHHHH------CCCCEEEEECCCCCCCCCCCCHHHHHHHHH
Q ss_conf             -002--79999999730268999986878865-58999999997------099679983267887532113388877555
Q gi|254780321|r   89 -VDF--TYEVSRSLSACEGSLLVVDATQGVEA-QTLANVYQAID------NNHEIITVLNKADLPSADPDRVKKQIEETI  158 (606)
Q Consensus        89 -~DF--~~EV~r~l~a~dgaiLvVdA~~Gvq~-QT~~~~~~A~~------~~l~~I~viNKiD~~~A~~e~v~~ei~~~~  158 (606)
                       .++  +.+.-|.+.-+|-.++|||++.+..+ ++...+..-++      .+-|.|+|+||+|+.+.  +...+.+++.+
T Consensus        63 ~~~~~l~~~~l~~i~~advil~vvD~~~~~~~~~~~~~i~~~l~~~~~~~~~kp~ilv~NK~Dl~~~--~~~~~~~~~~~  140 (170)
T cd01898          63 SEGKGLGHRFLRHIERTRLLLHVIDLSGDDDPVEDYKTIRNELELYNPELLEKPRIVVLNKIDLLDE--EELFELLKELL  140 (170)
T ss_pred             CCCCCHHHHHHHCCCCCCEEEEEEECCCCCCHHHHHHHHHHHHHHHCHHHHCCCCEEEEEHHHCCCH--HHHHHHHHHHH
T ss_conf             4662248999861334561799998998789899999999999982744403865067762024283--56389999999


Q ss_pred             H-HHHHHHHHHHHHCCCCCCHHHHHHHHHH
Q ss_conf             3-2232100011100223200678776321
Q gi|254780321|r  159 G-ISTEDALLVSAKTGEGIPLLLERIVQQL  187 (606)
Q Consensus       159 g-~~~~~ii~vSAktG~GV~~LLd~Iv~~i  187 (606)
                      . ....+++++||++|.|+++|++.|.+.+
T Consensus       141 ~~~~~~~vi~iSA~~g~gi~~L~~~I~~~L  170 (170)
T cd01898         141 KELWGKPVFPISALTGEGLDELLRKLAELL  170 (170)
T ss_pred             HHCCCCCEEEEECCCCCCHHHHHHHHHHHC
T ss_conf             856999589997547979999999999669


No 130
>cd04159 Arl10_like Arl10-like subfamily.  Arl9/Arl10 was identified from a human cancer-derived EST dataset.  No functional information about the subfamily is available at the current time, but crystal structures of human Arl10b and Arl10c have been solved.
Probab=99.53  E-value=1.3e-13  Score=110.82  Aligned_cols=147  Identities=21%  Similarity=0.333  Sum_probs=97.6

Q ss_pred             EEEECCCCCCHHHHHHHHHHHCCCCCCCCCCCEEECCCHHHHHHCCEEEEEEEEEEEECCCCCEEEEEEEECCCCCHHHH
Q ss_conf             99980138987788999999829805444431130586779871950523279999743788438999961787300279
Q gi|254780321|r   14 FSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVRLNYTSTDAKDYQLNLIDTPGHVDFTY   93 (606)
Q Consensus        14 ~~IiaHvDhGKTTL~d~lL~~tg~i~~~~~~~~vlD~~~~EreRGITIka~~~~~~~~~~~~~~y~iNlIDTPGH~DF~~   93 (606)
                      ++++|--+.|||||.-|+.  .+.+...- ..++          |.+++    .+.     .+++.+.+.||||+..|..
T Consensus         2 I~llG~~~~GKTsll~~~~--~~~f~~~~-~pTi----------g~~~~----~i~-----~~~~~l~iwDt~G~e~~~~   59 (159)
T cd04159           2 ITLVGLQNSGKTTLVNVIA--GGQFSEDT-IPTV----------GFNMR----KVT-----KGNVTLKVWDLGGQPRFRS   59 (159)
T ss_pred             EEEECCCCCCHHHHHHHHH--CCCCCCCC-CCCC----------CEEEE----EEE-----ECCEEEEEEECCCHHHHHH
T ss_conf             8999999986999999997--59998861-6732----------50589----999-----8999999997983587799


Q ss_pred             HHHHHHHHCCEEEEEEECCCCCCHHHHHH----HHHHH----HCCCCEEEEECCCCCCCCCC-CCHHHHHHHHHHHHH--
Q ss_conf             99999973026899998687886558999----99999----70996799832678875321-133888775553223--
Q gi|254780321|r   94 EVSRSLSACEGSLLVVDATQGVEAQTLAN----VYQAI----DNNHEIITVLNKADLPSADP-DRVKKQIEETIGIST--  162 (606)
Q Consensus        94 EV~r~l~a~dgaiLvVdA~~Gvq~QT~~~----~~~A~----~~~l~~I~viNKiD~~~A~~-e~v~~ei~~~~g~~~--  162 (606)
                      -..+-++.|+|+++|+|+++   .++...    ++..+    ..++|++++.||+|++++.. +++.+++ ++-.+..  
T Consensus        60 l~~~y~~~~~~ii~V~D~sd---~~s~~~~~~~l~~~~~~~~~~~~piliv~NK~Dl~~~~~~~~i~~~~-~~~~~~~~~  135 (159)
T cd04159          60 MWERYCRGVNAIVYVVDAAD---RTALEAAKNELHDLLEKPSLEGIPLLVLGNKNDLPGALSVDELIEQM-NLKSITDRE  135 (159)
T ss_pred             HHHHHHCCCCEEEECCCCCC---HHHHHHHHHHHHHHHHHHCCCCCEEEEEEECCCCCCCCCHHHHHHHH-HHHHHHCCC
T ss_conf             99987468636875157787---88999999999999854434898289888356764347899999999-999873499


Q ss_pred             HHHHHHHHHCCCCCCHHHHHHHHH
Q ss_conf             210001110022320067877632
Q gi|254780321|r  163 EDALLVSAKTGEGIPLLLERIVQQ  186 (606)
Q Consensus       163 ~~ii~vSAktG~GV~~LLd~Iv~~  186 (606)
                      -.++.+|||+|.||+++++-++++
T Consensus       136 ~~~~~~SAktg~gI~e~f~wL~~~  159 (159)
T cd04159         136 VSCYSISCKEKTNIDIVLDWLIKH  159 (159)
T ss_pred             CEEEEEECCCCCCHHHHHHHHHCC
T ss_conf             879999796896989999999659


No 131
>cd04153 Arl5_Arl8 Arl5/Arl8 subfamily.  Arl5 (Arf-like 5) and Arl8, like Arl4 and Arl7, are localized to the nucleus and nucleolus.  Arl5 is developmentally regulated during embryogenesis in mice.  Human Arl5 interacts with the heterochromatin protein 1-alpha (HP1alpha), a nonhistone chromosomal protein that is associated with heterochromatin and telomeres, and prevents telomere fusion.  Arl5 may also play a role in embryonic nuclear dynamics and/or signaling cascades. Arl8 was identified from a fetal cartilage cDNA library.  It is found in brain, heart, lung, cartilage, and kidney.  No function has been assigned for Arl8 to date.
Probab=99.52  E-value=3.5e-13  Score=107.94  Aligned_cols=150  Identities=23%  Similarity=0.332  Sum_probs=102.2

Q ss_pred             HCEEEEEECCCCCCHHHHHHHHHHHCCCCCCCCCCCEEECCCHHHHHHCCEEEEEEEEEEEECCCCCEEEEEEEECCCCC
Q ss_conf             53179998013898778899999982980544443113058677987195052327999974378843899996178730
Q gi|254780321|r   10 RIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVRLNYTSTDAKDYQLNLIDTPGHV   89 (606)
Q Consensus        10 ~IRN~~IiaHvDhGKTTL~d~lL~~tg~i~~~~~~~~vlD~~~~EreRGITIka~~~~~~~~~~~~~~y~iNlIDTPGH~   89 (606)
                      +=-.+.++|--++|||||..++.  .+.+...                .-|+......+.+     +++.+++.||+|+.
T Consensus        14 k~~KililG~~~sGKTsil~~l~--~~~~~~~----------------~pT~G~~~~~i~~-----~~~~~~iwD~~G~e   70 (174)
T cd04153          14 KEYKVIIVGLDNAGKTTILYQFL--LGEVVHT----------------SPTIGSNVEEIVY-----KNIRFLMWDIGGQE   70 (174)
T ss_pred             CEEEEEEECCCCCCHHHHHHHHH--CCCCCCC----------------CCCCCCCEEEEEE-----CCEEEEEEECCCCC
T ss_conf             77999999899998899999997--3992771----------------6723604699997-----88899999899986


Q ss_pred             HHHHHHHHHHHHCCEEEEEEECCCCCC-HHHHHHHHHHHH----CCCCEEEEECCCCCCCCCCCCHHHHHHHHHHHHH--
Q ss_conf             027999999973026899998687886-558999999997----0996799832678875321133888775553223--
Q gi|254780321|r   90 DFTYEVSRSLSACEGSLLVVDATQGVE-AQTLANVYQAID----NNHEIITVLNKADLPSADPDRVKKQIEETIGIST--  162 (606)
Q Consensus        90 DF~~EV~r~l~a~dgaiLvVdA~~Gvq-~QT~~~~~~A~~----~~l~~I~viNKiD~~~A~~e~v~~ei~~~~g~~~--  162 (606)
                      .|..-.+.-.+-+||+|+|||+++--. ...+..++..+.    .+.|++++.||.|++++..   .+||.+.++++.  
T Consensus        71 ~~~~~~~~y~~~a~~ii~VvD~sd~~~~~~~~~~l~~~l~~~~~~~~pili~~NK~Dl~~~~~---~~ei~~~l~l~~~~  147 (174)
T cd04153          71 SLRSSWNTYYTNTDAVILVIDSTDRERLPLTKEELYKMLAHEDLRKAVLLVLANKQDLKGAMT---PAEISESLGLTSIR  147 (174)
T ss_pred             CCCCHHHHHHCCCCEEEEEEECCCHHHHHHHHHHHHHHHHCCCCCCCCEEEEEECCCCCCCCC---HHHHHHHHHHHHHH
T ss_conf             566226777057753799997678889999999999997261016982899995555655789---99999997477763


Q ss_pred             ---HHHHHHHHHCCCCCCHHHHHHHH
Q ss_conf             ---21000111002232006787763
Q gi|254780321|r  163 ---EDALLVSAKTGEGIPLLLERIVQ  185 (606)
Q Consensus       163 ---~~ii~vSAktG~GV~~LLd~Iv~  185 (606)
                         -.+..|||++|.||++.++-+.+
T Consensus       148 ~~~~~~~~~SAktG~Gv~e~f~wLa~  173 (174)
T cd04153         148 DHTWHIQGCCALTGEGLPEGLDWIAS  173 (174)
T ss_pred             CCCCEEEEEECCCCCCHHHHHHHHHC
T ss_conf             59809999668589198999999866


No 132
>COG2229 Predicted GTPase [General function prediction only]
Probab=99.51  E-value=3.3e-13  Score=108.15  Aligned_cols=167  Identities=19%  Similarity=0.278  Sum_probs=113.8

Q ss_pred             EEEEECCCCCCHHHHHHHHHHHCCCCCCCCCCCEEECCCHHHHHHCCEEEEEEEEEEEECCCCC-EEEEEEEECCCCCHH
Q ss_conf             7999801389877889999998298054444311305867798719505232799997437884-389999617873002
Q gi|254780321|r   13 NFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVRLNYTSTDAK-DYQLNLIDTPGHVDF   91 (606)
Q Consensus        13 N~~IiaHvDhGKTTL~d~lL~~tg~i~~~~~~~~vlD~~~~EreRGITIka~~~~~~~~~~~~~-~y~iNlIDTPGH~DF   91 (606)
                      -|.|+|-+|+||||.+.++.+...........+   ++...  .|-.|+     ++.|-...-. ++.+.|.|||||.-|
T Consensus        12 KIvv~G~~~agKtTfv~~~s~k~~v~t~~~~~~---~s~k~--kr~tTv-----a~D~g~~~~~~~~~v~LfgtPGq~RF   81 (187)
T COG2229          12 KIVVIGPVGAGKTTFVRALSDKPLVITEADASS---VSGKG--KRPTTV-----AMDFGSIELDEDTGVHLFGTPGQERF   81 (187)
T ss_pred             EEEEECCCCCCHHHHHHHHHCCCCCEEECCCCC---CCCCC--CCCEEE-----EECCCCEEECCCCEEEEECCCCCHHH
T ss_conf             699984436640667887653456201033555---54466--455068-----63241137758616899658970778


Q ss_pred             HHHHHHHHHHCCEEEEEEECCCCCCHHHHHHHHHHHHCC-CCEEEEECCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             799999997302689999868788655899999999709-9679983267887532113388877555322321000111
Q gi|254780321|r   92 TYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQAIDNN-HEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSA  170 (606)
Q Consensus        92 ~~EV~r~l~a~dgaiLvVdA~~Gvq~QT~~~~~~A~~~~-l~~I~viNKiD~~~A~~e~v~~ei~~~~g~~~~~ii~vSA  170 (606)
                      -+--+-.++-+.||+++||++.++----++-+..-.... +|.++++||.|+++|.+.+...|..++ .+..-+++..+|
T Consensus        82 ~fm~~~l~~ga~gaivlVDss~~~~~~a~~ii~f~~~~~~ip~vVa~NK~DL~~a~ppe~i~e~l~~-~~~~~~vi~~~a  160 (187)
T COG2229          82 KFMWEILSRGAVGAIVLVDSSRPITFHAEEIIDFLTSRNPIPVVVAINKQDLFDALPPEKIREALKL-ELLSVPVIEIDA  160 (187)
T ss_pred             HHHHHHHHCCCCEEEEEEECCCCCCHHHHHHHHHHHHCCCCCEEEEEECCCCCCCCCHHHHHHHHHH-CCCCCCEEEEEC
T ss_conf             9899987487642899995699964678999998852068878999504225778998999999971-127986443442


Q ss_pred             HCCCCCCHHHHHHHHH-HHCC
Q ss_conf             0022320067877632-1000
Q gi|254780321|r  171 KTGEGIPLLLERIVQQ-LPSP  190 (606)
Q Consensus       171 ktG~GV~~LLd~Iv~~-iP~P  190 (606)
                      ..+.|..+.|+.+..+ .+.|
T Consensus       161 ~e~~~~~~~L~~ll~~~~~~~  181 (187)
T COG2229         161 TEGEGARDQLDVLLLKDLLGS  181 (187)
T ss_pred             CCCHHHHHHHHHHHHHCCCCC
T ss_conf             463417899999873035675


No 133
>cd03690 Tet_II Tet_II: This subfamily represents domain II of ribosomal protection proteins Tet(M) and Tet(O). This domain has homology to domain II of the elongation factors EF-G and EF-2. Tet(M) and Tet(O) catalyze the release of tetracycline (Tc) from the ribosome in a GTP-dependent manner thereby mediating Tc resistance.  Tcs are broad-spectrum antibiotics.  Typical Tcs bind to the ribosome and inhibit the elongation phase of protein synthesis, by inhibiting the occupation of site A by aminoacyl-tRNA.
Probab=99.51  E-value=1.5e-14  Score=117.26  Aligned_cols=84  Identities=17%  Similarity=0.372  Sum_probs=72.5

Q ss_pred             HCCCCCCCCCEEECCCCCEEEEEEECCCCCCCCCEEEEECCCCCCCCCCCCCCCC-CEEEEHHCCCCCHHHHHHCCCCCC
Q ss_conf             0123310121011475725999981698735584588733556421012223355-412401012471233220110024
Q gi|254780321|r  197 NAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVERIGILTP-KMIDIEALYPGEIGVMIASIKEVS  275 (606)
Q Consensus       197 ~~Pl~alVfds~~D~~~G~I~~~RV~sG~lk~Gd~I~~~~~g~~~~v~~ig~~~~-~~~~v~~l~aGdVG~ii~gik~l~  275 (606)
                      ++||+|+||+..+||+.|+++|+||+||+|+.++.+. .+.+++.++.++..+.. +..+++++.||||+.    +.++.
T Consensus         1 e~~l~a~VFKi~~d~~~grl~yvRv~sG~l~~~~~v~-~~~~~~eki~~l~~~~~~~~~~v~~~~AGdI~a----v~gl~   75 (85)
T cd03690           1 ESELSGTVFKIERDDKGERLAYLRLYSGTLRLRDSVR-VNREEKIKITELRVFNNGEVVTADTVTAGDIAI----LTGLK   75 (85)
T ss_pred             CCCCEEEEEEEEECCCCCEEEEEEEEEEEECCCCEEE-CCCCCEEEECEEEEEECCCEEECCEECCCCEEE----EECCC
T ss_conf             9973499998887799985999998340982898896-589960402348999089956977898999999----98999


Q ss_pred             CCCCCCEECC
Q ss_conf             4445420004
Q gi|254780321|r  276 HTRVGDTITD  285 (606)
Q Consensus       276 ~~~vGDTl~~  285 (606)
                      ++++||||.+
T Consensus        76 ~~~~GDtlgd   85 (85)
T cd03690          76 GLRVGDVLGD   85 (85)
T ss_pred             CCCCCCCCCC
T ss_conf             8837772278


No 134
>cd04157 Arl6 Arl6 subfamily.  Arl6 (Arf-like 6) forms a subfamily of the Arf family of small GTPases.  Arl6 expression is limited to the brain and kidney in adult mice, but it is expressed in the neural plate and somites during embryogenesis, suggesting a possible role for Arl6 in early development.  Arl6 is also believed to have a role in cilia or flagella function.  Several proteins have been identified that bind Arl6, including Arl6 interacting protein (Arl6ip), and SEC61beta, a subunit of the heterotrimeric conducting channel SEC61p.  Based on Arl6 binding to these effectors, Arl6 is also proposed to play a role in protein transport, membrane trafficking, or cell signaling during hematopoietic maturation.  At least three specific homozygous Arl6 mutations in humans have been found to cause Bardet-Biedl syndrome, a disorder characterized by obesity, retinopathy, polydactyly, renal and cardiac malformations, learning disabilities, and hypogenitalism.  Older literature suggests that A
Probab=99.50  E-value=4.5e-13  Score=107.24  Aligned_cols=149  Identities=17%  Similarity=0.274  Sum_probs=98.7

Q ss_pred             EEEEECCCCCCHHHHHHHHHHHCCCCCCCCCCCEEECCCHHHHHHCCEEEEEEEEEEEECCCCCEEEEEEEECCCCCHHH
Q ss_conf             79998013898778899999982980544443113058677987195052327999974378843899996178730027
Q gi|254780321|r   13 NFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVRLNYTSTDAKDYQLNLIDTPGHVDFT   92 (606)
Q Consensus        13 N~~IiaHvDhGKTTL~d~lL~~tg~i~~~~~~~~vlD~~~~EreRGITIka~~~~~~~~~~~~~~y~iNlIDTPGH~DF~   92 (606)
                      |+.++|.-.+|||||..+|.  ++.........++          |..+    ..+.     .+++.+++.|++|+..|.
T Consensus         1 ~Il~lGl~~sGKTtil~~l~--~~~~~~~~~~pT~----------G~~~----~~~~-----~~~~~~~iwD~~G~~~~r   59 (162)
T cd04157           1 NILVVGLDNSGKTTIINQLK--PENAQSQIIVPTV----------GFNV----ESFE-----KGNLSFTAFDMSGQGKYR   59 (162)
T ss_pred             CEEEECCCCCCHHHHHHHHH--CCCCCCCCCCCCC----------CEEE----EEEE-----ECCEEEEEEECCCCCCCC
T ss_conf             99999999998899999997--2898756416850----------7578----9998-----399889999858874420


Q ss_pred             HHHHHHHHHCCEEEEEEECCCCCCHH-HHHHHHHHHH------CCCCEEEEECCCCCCCCCCCCHHHHHHHHHHHHH---
Q ss_conf             99999997302689999868788655-8999999997------0996799832678875321133888775553223---
Q gi|254780321|r   93 YEVSRSLSACEGSLLVVDATQGVEAQ-TLANVYQAID------NNHEIITVLNKADLPSADPDRVKKQIEETIGIST---  162 (606)
Q Consensus        93 ~EV~r~l~a~dgaiLvVdA~~Gvq~Q-T~~~~~~A~~------~~l~~I~viNKiD~~~A~~e~v~~ei~~~~g~~~---  162 (606)
                      .-..+-.+-|+|+|+|||+++=-.-+ .+..++..++      .++|++++.||+|+++|-.   .+||.+.++++.   
T Consensus        60 ~lw~~y~~~~~~iI~VvDssd~~~~~~~~~~l~~ll~~~~~~~~~~PiLI~~NK~D~~~~~~---~~ei~~~l~l~~~~~  136 (162)
T cd04157          60 GLWEHYYKNIQGIIFVIDSSDRLRLVVVKDELELLLNHPDIKHRRVPILFFANKMDLPDALT---AVKITQLLGLENIKD  136 (162)
T ss_pred             HHHHHHHCCCCEEEEEEECCCHHHHHHHHHHHHHHHHCHHHCCCCCEEEEEEECCCCCCCCC---HHHHHHHHCHHHHCC
T ss_conf             55898705674489997076388899999999999717655179845999981477889999---999998858665248


Q ss_pred             --HHHHHHHHHCCCCCCHHHHHHHH
Q ss_conf             --21000111002232006787763
Q gi|254780321|r  163 --EDALLVSAKTGEGIPLLLERIVQ  185 (606)
Q Consensus       163 --~~ii~vSAktG~GV~~LLd~Iv~  185 (606)
                        -.+++|||++|.||++.|+=+..
T Consensus       137 ~~~~i~~~SA~tG~Gi~e~f~WL~~  161 (162)
T cd04157         137 KPWHIFASNALTGEGLDEGVQWLQA  161 (162)
T ss_pred             CCEEEEEEECCCCCCHHHHHHHHHC
T ss_conf             9649999789789798999999865


No 135
>PTZ00133 ADP-ribosylation factor; Provisional
Probab=99.50  E-value=6.2e-13  Score=106.29  Aligned_cols=151  Identities=18%  Similarity=0.220  Sum_probs=102.5

Q ss_pred             CEEEEEECCCCCCHHHHHHHHHHHCCCCCCCCCCCEEECCCHHHHHHCCEEEEEEEEEEEECCCCCEEEEEEEECCCCCH
Q ss_conf             31799980138987788999999829805444431130586779871950523279999743788438999961787300
Q gi|254780321|r   11 IRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVRLNYTSTDAKDYQLNLIDTPGHVD   90 (606)
Q Consensus        11 IRN~~IiaHvDhGKTTL~d~lL~~tg~i~~~~~~~~vlD~~~~EreRGITIka~~~~~~~~~~~~~~y~iNlIDTPGH~D   90 (606)
                      =.++.++|--++|||||..+|.  .|.+...                -.|+..+..++.+     +++.+++.||.|+.-
T Consensus        17 ~~kililGl~~sGKTsil~~l~--~~~~~~~----------------~pTvg~~~~~~~~-----~~~~l~iwD~~Gqe~   73 (182)
T PTZ00133         17 EVRILMVGLDAAGKTTILYKLK--LGEVVTT----------------IPTIGFNVETVEY-----KNLKFTMWDVGGQDK   73 (182)
T ss_pred             EEEEEEECCCCCCHHHHHHHHH--CCCCCCC----------------CCCCCCCEEEEEE-----CCEEEEEEECCCCCC
T ss_conf             4799999679988999999996--2997773----------------7868845699997-----888999998999845


Q ss_pred             HHHHHHHHHHHCCEEEEEEECCCCC-CHHHHHHHHHHHH----CCCCEEEEECCCCCCCCCCCCHHHHHHHHHHHHH---
Q ss_conf             2799999997302689999868788-6558999999997----0996799832678875321133888775553223---
Q gi|254780321|r   91 FTYEVSRSLSACEGSLLVVDATQGV-EAQTLANVYQAID----NNHEIITVLNKADLPSADPDRVKKQIEETIGIST---  162 (606)
Q Consensus        91 F~~EV~r~l~a~dgaiLvVdA~~Gv-q~QT~~~~~~A~~----~~l~~I~viNKiD~~~A~~e~v~~ei~~~~g~~~---  162 (606)
                      |..-...-.+-|||+|+|||+++-= ..+.+..+...+.    .+.|++++.||.|+|+|...   .||.+.++++.   
T Consensus        74 ~r~lw~~yy~~~~giI~VvD~sd~~~~~~~~~~l~~~l~~~~~~~~piLi~~NK~Dl~~a~~~---~ei~~~l~l~~~~~  150 (182)
T PTZ00133         74 LRPLWRHYYQNTNGIIFVVDSNDRERIGDARQELEKMLAEDELRNAVLLVFANKQDLPNAMST---TEVTEKLGLHSVRQ  150 (182)
T ss_pred             CCHHHHHCCCCCCEEEEEEECCCHHHHHHHHHHHHHHHCCHHHCCCEEEEEECCCCCCCCCCH---HHHHHHHCHHHHHC
T ss_conf             474787605676449999966787899999999999971442248859999706687788899---99999969555615


Q ss_pred             --HHHHHHHHHCCCCCCHHHHHHHHHH
Q ss_conf             --2100011100223200678776321
Q gi|254780321|r  163 --EDALLVSAKTGEGIPLLLERIVQQL  187 (606)
Q Consensus       163 --~~ii~vSAktG~GV~~LLd~Iv~~i  187 (606)
                        -.+.+|||++|.||++.++-+.+.+
T Consensus       151 ~~~~i~~~SA~tG~Gi~e~f~wL~~~i  177 (182)
T PTZ00133        151 RNWYIQGCCATTAQGLYEGLDWLSANI  177 (182)
T ss_pred             CCCEEEEEECCCCCCHHHHHHHHHHHH
T ss_conf             995899825758949899999999999


No 136
>cd04150 Arf1_5_like Arf1-Arf5-like subfamily.  This subfamily contains Arf1, Arf2, Arf3, Arf4, Arf5, and related proteins.  Arfs1-5 are soluble proteins that are crucial for assembling coat proteins during vesicle formation.  Each contains an N-terminal myristoylated amphipathic helix that is folded into the protein in the GDP-bound state.  GDP/GTP exchange exposes the helix, which anchors to the membrane.  Following GTP hydrolysis, the helix dissociates from the membrane and folds back into the protein.  A general feature of Arf1-5 signaling may be the cooperation of two Arfs at the same site.  Arfs1-5 are generally considered to be interchangeable in function and location, but some specific functions have been assigned.  Arf1 localizes to the early/cis-Golgi, where it is activated by GBF1 and recruits the coat protein COPI.  It also localizes to the trans-Golgi network (TGN), where it is activated by BIG1/BIG2 and recruits the AP1, AP3, AP4, and GGA proteins.  Humans, but not rodents
Probab=99.50  E-value=5.8e-13  Score=106.48  Aligned_cols=147  Identities=17%  Similarity=0.257  Sum_probs=98.3

Q ss_pred             EEEEECCCCCCHHHHHHHHHHHCCCCCCCCCCCEEECCCHHHHHHCCEEEEEEEEEEEECCCCCEEEEEEEECCCCCHHH
Q ss_conf             79998013898778899999982980544443113058677987195052327999974378843899996178730027
Q gi|254780321|r   13 NFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVRLNYTSTDAKDYQLNLIDTPGHVDFT   92 (606)
Q Consensus        13 N~~IiaHvDhGKTTL~d~lL~~tg~i~~~~~~~~vlD~~~~EreRGITIka~~~~~~~~~~~~~~y~iNlIDTPGH~DF~   92 (606)
                      .+.++|--++|||||..|+.  .|.+...                --|+......+.+     +++.+++.|++|+.-|.
T Consensus         2 KililG~~~sGKTsll~~l~--~~~~~~~----------------~pT~g~~~~~~~~-----~~~~l~iwD~~G~~~~r   58 (159)
T cd04150           2 RILMVGLDAAGKTTILYKLK--LGEIVTT----------------IPTIGFNVETVEY-----KNISFTVWDVGGQDKIR   58 (159)
T ss_pred             EEEEECCCCCCHHHHHHHHH--CCCCCCC----------------CCCCCCCEEEEEE-----CCEEEEEEECCCCCCCC
T ss_conf             99999999999899999997--2996775----------------8968701799998-----98999999789972146


Q ss_pred             HHHHHHHHHCCEEEEEEECCCCCCH-HHHHHHHHHHH----CCCCEEEEECCCCCCCCCCCCHHHHHHHHHHHHH-----
Q ss_conf             9999999730268999986878865-58999999997----0996799832678875321133888775553223-----
Q gi|254780321|r   93 YEVSRSLSACEGSLLVVDATQGVEA-QTLANVYQAID----NNHEIITVLNKADLPSADPDRVKKQIEETIGIST-----  162 (606)
Q Consensus        93 ~EV~r~l~a~dgaiLvVdA~~Gvq~-QT~~~~~~A~~----~~l~~I~viNKiD~~~A~~e~v~~ei~~~~g~~~-----  162 (606)
                      .-.+.-.+-|+|+|+|||+++--.- ..+..++..+.    .+.|++++.||+|+|++...   +|+.+.++++.     
T Consensus        59 ~l~~~Y~~~a~~iI~VvD~sd~~~~~~~~~~l~~~l~~~~~~~~pili~~NK~Dl~~~~~~---~ei~~~l~l~~~~~~~  135 (159)
T cd04150          59 PLWRHYFQNTQGLIFVVDSNDRERIGEAREELQRMLNEDELRDAVLLVFANKQDLPNAMSA---AEVTDKLGLHSLRNRN  135 (159)
T ss_pred             HHHHHHCCCCCEEEEEEECCCHHHHHHHHHHHHHHHCCHHHCCCEEEEEEECCCCCCCCCH---HHHHHHHCHHHHHCCC
T ss_conf             5678647687389999977777899999999999962353369829999975667789899---9999996866663798


Q ss_pred             HHHHHHHHHCCCCCCHHHHHHHH
Q ss_conf             21000111002232006787763
Q gi|254780321|r  163 EDALLVSAKTGEGIPLLLERIVQ  185 (606)
Q Consensus       163 ~~ii~vSAktG~GV~~LLd~Iv~  185 (606)
                      -.+.++||++|.||++.|+-+.+
T Consensus       136 ~~i~~~SA~tG~Gv~e~f~WL~~  158 (159)
T cd04150         136 WYIQATCATSGDGLYEGLDWLSN  158 (159)
T ss_pred             EEEEEEECCCCCCHHHHHHHHHC
T ss_conf             59998268679398999999855


No 137
>cd04149 Arf6 Arf6 subfamily.  Arf6 (ADP ribosylation factor 6) proteins localize to the plasma membrane, where they perform a wide variety of functions.  In its active, GTP-bound form, Arf6 is involved in cell spreading, Rac-induced formation of plasma membrane ruffles, cell migration, wound healing, and Fc-mediated phagocytosis.  Arf6 appears to change the actin structure at the plasma membrane by activating Rac, a Rho family protein involved in membrane ruffling.  Arf6 is required for and enhances Rac formation of ruffles.  Arf6 can regulate dendritic branching in hippocampal neurons, and in yeast it localizes to the growing bud, where it plays a role in polarized growth and bud site selection.  In leukocytes, Arf6 is required for chemokine-stimulated migration across endothelial cells.  Arf6 also plays a role in down-regulation of beta2-adrenergic receptors and luteinizing hormone receptors by facilitating the release of sequestered arrestin to allow endocytosis.  Arf6 is believed t
Probab=99.50  E-value=2.9e-13  Score=108.54  Aligned_cols=148  Identities=18%  Similarity=0.238  Sum_probs=99.6

Q ss_pred             EEEEEECCCCCCHHHHHHHHHHHCCCCCCCCCCCEEECCCHHHHHHCCEEEEEEEEEEEECCCCCEEEEEEEECCCCCHH
Q ss_conf             17999801389877889999998298054444311305867798719505232799997437884389999617873002
Q gi|254780321|r   12 RNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVRLNYTSTDAKDYQLNLIDTPGHVDF   91 (606)
Q Consensus        12 RN~~IiaHvDhGKTTL~d~lL~~tg~i~~~~~~~~vlD~~~~EreRGITIka~~~~~~~~~~~~~~y~iNlIDTPGH~DF   91 (606)
                      -++.++|.-++|||||..+|.  .+.....                -.|+..+...+.+     +++.+++.||+|+..|
T Consensus        10 ~kililG~~~sGKTsil~~l~--~~~~~~~----------------~pTvg~~~~~~~~-----~~~~l~iwD~~Gqe~~   66 (168)
T cd04149          10 MRILMLGLDAAGKTTILYKLK--LGQSVTT----------------IPTVGFNVETVTY-----KNVKFNVWDVGGQDKI   66 (168)
T ss_pred             EEEEEECCCCCCHHHHHHHHH--CCCCCCC----------------CCCCCCEEEEEEE-----CCEEEEEEECCCCCCC
T ss_conf             899999999999899999996--6998760----------------2626700799998-----9889999989999746


Q ss_pred             HHHHHHHHHHCCEEEEEEECCCCCC-HHHHHHHHHHHH----CCCCEEEEECCCCCCCCCCCCHHHHHHHHHHHHH----
Q ss_conf             7999999973026899998687886-558999999997----0996799832678875321133888775553223----
Q gi|254780321|r   92 TYEVSRSLSACEGSLLVVDATQGVE-AQTLANVYQAID----NNHEIITVLNKADLPSADPDRVKKQIEETIGIST----  162 (606)
Q Consensus        92 ~~EV~r~l~a~dgaiLvVdA~~Gvq-~QT~~~~~~A~~----~~l~~I~viNKiD~~~A~~e~v~~ei~~~~g~~~----  162 (606)
                      ..-...-.+-++|+++|||+++--. .+.+..++..+.    .+.|++++.||+|+|++-..   +||.+.++++.    
T Consensus        67 r~l~~~y~~~~~~iifVvDstd~~~~~~~~~~l~~~l~~~~~~~~pilI~~NK~Dl~~~~~~---~ei~~~l~l~~~~~~  143 (168)
T cd04149          67 RPLWRHYYTGTQGLIFVVDSADRDRIDEARQELHRIINDREMRDALLLVFANKQDLPDAMKP---HEIQEKLGLTRIRDR  143 (168)
T ss_pred             CCHHHHHCCCCCEEEEEEECCCHHHHHHHHHHHHHHHHCHHHCCCEEEEEEECCCCCCCCCH---HHHHHHHCHHHHHCC
T ss_conf             60657643788668999837767899999999999971452279869999975667778899---999999787655179


Q ss_pred             -HHHHHHHHHCCCCCCHHHHHHHH
Q ss_conf             -21000111002232006787763
Q gi|254780321|r  163 -EDALLVSAKTGEGIPLLLERIVQ  185 (606)
Q Consensus       163 -~~ii~vSAktG~GV~~LLd~Iv~  185 (606)
                       -.+.+|||++|.||++.|+-+.+
T Consensus       144 ~~~i~~~SA~tG~Gv~e~f~WL~~  167 (168)
T cd04149         144 NWYVQPSCATSGDGLYEGLTWLSS  167 (168)
T ss_pred             CCEEEEEECCCCCCHHHHHHHHHC
T ss_conf             809998068789697999999865


No 138
>smart00177 ARF ARF-like small GTPases; ARF, ADP-ribosylation factor. Ras homologues involved in vesicular transport. Activator of phospholipase D isoforms. Unlike Ras proteins they lack cysteine residues at their C-termini and therefore are unlikely to be prenylated. ARFs are N-terminally myristoylated. Contains ATP/GTP-binding motif (P-loop).
Probab=99.50  E-value=7.9e-13  Score=105.62  Aligned_cols=150  Identities=19%  Similarity=0.224  Sum_probs=101.3

Q ss_pred             EEEEEECCCCCCHHHHHHHHHHHCCCCCCCCCCCEEECCCHHHHHHCCEEEEEEEEEEEECCCCCEEEEEEEECCCCCHH
Q ss_conf             17999801389877889999998298054444311305867798719505232799997437884389999617873002
Q gi|254780321|r   12 RNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVRLNYTSTDAKDYQLNLIDTPGHVDF   91 (606)
Q Consensus        12 RN~~IiaHvDhGKTTL~d~lL~~tg~i~~~~~~~~vlD~~~~EreRGITIka~~~~~~~~~~~~~~y~iNlIDTPGH~DF   91 (606)
                      ..+.++|--++|||||..++.  .|.....                -.|+......+.+     +++.+++.||+|+.-|
T Consensus        14 ~kililG~~~~GKTsil~~l~--~~~~~~~----------------~pTvg~~~~~~~~-----~~~~l~iwD~~Gqe~~   70 (175)
T smart00177       14 MRILMVGLDAAGKTTILYKLK--LGESVTT----------------IPTIGFNVETVTY-----KNISFTVWDVGGQDKI   70 (175)
T ss_pred             EEEEEECCCCCCHHHHHHHHH--CCCCCCC----------------CCCCCCEEEEEEE-----CCEEEEEEECCCCCCC
T ss_conf             999999889999899999996--5997775----------------7978810799998-----9899999989998545


Q ss_pred             HHHHHHHHHHCCEEEEEEECCCCCCH-HHHHHHHHHH----HCCCCEEEEECCCCCCCCCCCCHHHHHHHHHHHHH----
Q ss_conf             79999999730268999986878865-5899999999----70996799832678875321133888775553223----
Q gi|254780321|r   92 TYEVSRSLSACEGSLLVVDATQGVEA-QTLANVYQAI----DNNHEIITVLNKADLPSADPDRVKKQIEETIGIST----  162 (606)
Q Consensus        92 ~~EV~r~l~a~dgaiLvVdA~~Gvq~-QT~~~~~~A~----~~~l~~I~viNKiD~~~A~~e~v~~ei~~~~g~~~----  162 (606)
                      ..-...-.+-|+|+|+|||+++--.- +.+..+...+    ..+.|++++.||+|+|++...   .+|.+.++++.    
T Consensus        71 r~l~~~Yy~~a~~iIfVvD~sd~~~~~~~~~~l~~~l~~~~~~~~piLil~NK~Dl~~~~~~---~ei~~~l~l~~~~~~  147 (175)
T smart00177       71 RPLWRHYYTNTQGLIFVVDSNDRDRIDEAREELHRMLNEDELRDAVILVFANKQDLPDAMKA---AEITEKLGLHSIRDR  147 (175)
T ss_pred             CHHHHHHCCCCCEEEEEEECCCHHHHHHHHHHHHHHHCCHHHCCCEEEEEEECCCCCCCCCH---HHHHHHHCHHHHCCC
T ss_conf             53677755776189999866877899999999999963153169869999845667678899---999999686654079


Q ss_pred             -HHHHHHHHHCCCCCCHHHHHHHHHH
Q ss_conf             -2100011100223200678776321
Q gi|254780321|r  163 -EDALLVSAKTGEGIPLLLERIVQQL  187 (606)
Q Consensus       163 -~~ii~vSAktG~GV~~LLd~Iv~~i  187 (606)
                       -.+.+|||++|.||++.++-|.+.+
T Consensus       148 ~~~i~~~SA~tG~GI~e~f~wL~~~i  173 (175)
T smart00177      148 NWYIQPTCATSGDGLYEGLTWLSNNL  173 (175)
T ss_pred             CEEEEEEECCCCCCHHHHHHHHHHHH
T ss_conf             75999826878969899999999984


No 139
>cd03689 RF3_II RF3_II: this subfamily represents the domain II of bacterial Release Factor 3 (RF3). Termination of protein synthesis by the ribosome requires two release factor (RF) classes. The class II RF3 is a GTPase that removes class I RFs (RF1 or RF2) from the ribosome after release of the nascent polypeptide. RF3 in the GDP state binds to the ribosomal class I RF complex, followed by an exchange of GDP for GTP and release of the class I RF. Sequence comparison of class II release factors with elongation factors shows that prokaryotic RF3 is more similar to EF-G whereas eukaryotic eRF3 is more similar to eEF1A, implying that their precise function may differ.
Probab=99.49  E-value=1.6e-14  Score=116.90  Aligned_cols=80  Identities=15%  Similarity=0.358  Sum_probs=70.5

Q ss_pred             CCCCCEEE--CC-CCCEEEEEEECCCCCCCCCEEEEECCCCCCCCCCCCCCC-CCEEEEHHCCCCCHHHHHHCCCCCCCC
Q ss_conf             10121011--47-572599998169873558458873355642101222335-541240101247123322011002444
Q gi|254780321|r  202 ALLIDSWY--NS-YLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVERIGILT-PKMIDIEALYPGEIGVMIASIKEVSHT  277 (606)
Q Consensus       202 alVfds~~--D~-~~G~I~~~RV~sG~lk~Gd~I~~~~~g~~~~v~~ig~~~-~~~~~v~~l~aGdVG~ii~gik~l~~~  277 (606)
                      +||||+..  || |+|+++|+||+||++++|++|.+.++++++++.++..|. -++.++++++||||    +++.+++++
T Consensus         1 GfVFKiqanmd~~h~grlaf~RV~SG~l~~G~~v~n~rtgK~~ri~r~~~~~a~~Re~ie~A~aGDI----vav~g~~~~   76 (85)
T cd03689           1 GFVFKIQANMDPAHRDRIAFVRVCSGKFERGMKVKHVRLGKEVRLSNPQQFFAQDRETVDEAYPGDI----IGLVNPGNF   76 (85)
T ss_pred             CEEEEEECCCCCCCCCEEEEEEEEEEEECCCCEEEECCCCCEEEECCHHHHHHCCCEEECEEECCCE----EEEECCCCC
T ss_conf             9489985379910077189999987298689999971279678835445332277008034938989----998279987


Q ss_pred             CCCCEECC
Q ss_conf             45420004
Q gi|254780321|r  278 RVGDTITD  285 (606)
Q Consensus       278 ~vGDTl~~  285 (606)
                      ++|||||+
T Consensus        77 ~tGDTL~~   84 (85)
T cd03689          77 QIGDTLTE   84 (85)
T ss_pred             EECCCCCC
T ss_conf             31465137


No 140
>cd04151 Arl1 Arl1 subfamily.  Arl1 (Arf-like 1) localizes to the Golgi complex, where it is believed to recruit effector proteins to the trans-Golgi network.  Like most members of the Arf family, Arl1 is myristoylated at its N-terminal helix and mutation of the myristoylation site disrupts Golgi targeting.  In humans, the Golgi-localized proteins golgin-97 and golgin-245 have been identified as Arl1 effectors.  Golgins are large coiled-coil proteins found in the Golgi, and these golgins contain a C-terminal GRIP domain, which is the site of Arl1 binding.  Additional Arl1 effectors include the GARP (Golgi-associated retrograde protein)/VFT (Vps53) vesicle-tethering complex and Arfaptin 2.  Arl1 is not required for exocytosis, but appears necessary for trafficking from the endosomes to the Golgi.  In Drosophila zygotes, mutation of Arl1 is lethal, and in the host-bloodstream form of Trypanosoma brucei, Arl1 is essential for viability.
Probab=99.48  E-value=4.7e-13  Score=107.11  Aligned_cols=146  Identities=22%  Similarity=0.269  Sum_probs=97.1

Q ss_pred             EEEECCCCCCHHHHHHHHHHHCCCCCCCCCCCEEECCCHHHHHHCCEEEEEEEEEEEECCCCCEEEEEEEECCCCCHHHH
Q ss_conf             99980138987788999999829805444431130586779871950523279999743788438999961787300279
Q gi|254780321|r   14 FSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVRLNYTSTDAKDYQLNLIDTPGHVDFTY   93 (606)
Q Consensus        14 ~~IiaHvDhGKTTL~d~lL~~tg~i~~~~~~~~vlD~~~~EreRGITIka~~~~~~~~~~~~~~y~iNlIDTPGH~DF~~   93 (606)
                      +.++|--+.|||||..|+.  .|.+....                -||......+.|     +++.+++.||+||..|..
T Consensus         2 il~lG~~~~GKTsll~~~~--~~~~~~~~----------------pTig~~~~~i~~-----~~~~~~iwD~~G~e~~r~   58 (158)
T cd04151           2 ILILGLDNAGKTTILYRLQ--LGEVVTTI----------------PTIGFNVETVTY-----KNLKFQVWDLGGQTSIRP   58 (158)
T ss_pred             EEEECCCCCCHHHHHHHHH--CCCCCCCC----------------CCCCCCEEEEEE-----CCEEEEEEECCCCCCCCH
T ss_conf             9999999998999999997--09967757----------------848824699998-----988999996798624462


Q ss_pred             HHHHHHHHCCEEEEEEECCCCCCHHHH-HHHHHHH----HCCCCEEEEECCCCCCCCCCCCHHHHHHHHHHHHH-----H
Q ss_conf             999999730268999986878865589-9999999----70996799832678875321133888775553223-----2
Q gi|254780321|r   94 EVSRSLSACEGSLLVVDATQGVEAQTL-ANVYQAI----DNNHEIITVLNKADLPSADPDRVKKQIEETIGIST-----E  163 (606)
Q Consensus        94 EV~r~l~a~dgaiLvVdA~~Gvq~QT~-~~~~~A~----~~~l~~I~viNKiD~~~A~~e~v~~ei~~~~g~~~-----~  163 (606)
                      -...-.+-|+|+|+|+|+++--.-+.. ..++..+    ..+.|++++.||+|++++..+   .++.+.++++.     -
T Consensus        59 ~~~~y~~~~~~ii~VvD~sd~~~~~~~~~~l~~~l~~~~~~~~piliv~NK~Dl~~~~~~---~~i~~~l~l~~~~~~~~  135 (158)
T cd04151          59 YWRCYYSNTDAIIYVVDSTDRDRLGTAKEELHAMLEEEELKGAVLLVFANKQDMPGALSE---AEISEKLGLSELKDRTW  135 (158)
T ss_pred             HHHHHCCCCCEEEEEEECCCHHHHHHHHHHHHHHHHHHHHCCCCEEEEEECCCCCCCCCH---HHHHHHHHHHHHHCCCC
T ss_conf             788746678899999745787899999999999983465369819999976677657799---99999985987416996


Q ss_pred             HHHHHHHHCCCCCCHHHHHHHH
Q ss_conf             1000111002232006787763
Q gi|254780321|r  164 DALLVSAKTGEGIPLLLERIVQ  185 (606)
Q Consensus       164 ~ii~vSAktG~GV~~LLd~Iv~  185 (606)
                      .++++||++|.||++.++-+++
T Consensus       136 ~~~~tSA~tG~gV~e~f~wL~~  157 (158)
T cd04151         136 SIFKTSAIKGEGLDEGMDWLVN  157 (158)
T ss_pred             EEEEEECCCCCCHHHHHHHHHC
T ss_conf             8999678789399999999856


No 141
>cd04156 ARLTS1 ARLTS1 subfamily.  ARLTS1 (Arf-like tumor suppressor gene 1), also known as Arl11, is a member of the Arf family of small GTPases that is believed to play a major role in apoptotic signaling.  ARLTS1 is widely expressed and functions as a tumor suppressor gene in several human cancers.  ARLTS1 is a low-penetrance suppressor that accounts for a small percentage of familial melanoma or familial chronic lymphocytic leukemia (CLL).  ARLTS1 inactivation seems to occur most frequently through biallelic down-regulation by hypermethylation of the promoter.  In breast cancer, ARLTS1 alterations were typically a combination of a hypomorphic polymorphism plus loss of heterozygosity.  In a case of thyroid adenoma, ARLTS1 alterations were polymorphism plus promoter hypermethylation.  The nonsense polymorphism Trp149Stop occurs with significantly greater frequency in familial cancer cases than in sporadic cancer cases, and the Cys148Arg polymorphism is associated with an increase in h
Probab=99.48  E-value=2.2e-12  Score=102.61  Aligned_cols=147  Identities=20%  Similarity=0.249  Sum_probs=98.8

Q ss_pred             EEEECCCCCCHHHHHHHHHHHCCCCCCCCCCCEEECCCHHHHHHCCEEEEEEEEEEEECCCCCEEEEEEEECCCCCHHHH
Q ss_conf             99980138987788999999829805444431130586779871950523279999743788438999961787300279
Q gi|254780321|r   14 FSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVRLNYTSTDAKDYQLNLIDTPGHVDFTY   93 (606)
Q Consensus        14 ~~IiaHvDhGKTTL~d~lL~~tg~i~~~~~~~~vlD~~~~EreRGITIka~~~~~~~~~~~~~~y~iNlIDTPGH~DF~~   93 (606)
                      +.++|--..|||||..|+.  .+.+...                --||......+.+   + +++.+++.||.|...|..
T Consensus         2 ivilG~~~~GKTsil~r~~--~~~~~~~----------------~pTig~~~~~~~~---~-~~~~l~iwD~~G~e~~~~   59 (160)
T cd04156           2 VLLLGLDSAGKSTLLYKLK--HAELVTT----------------IPTVGFNVEMLQL---E-KHLSLTVWDVGGQEKMRT   59 (160)
T ss_pred             EEEECCCCCCHHHHHHHHH--CCCCCCC----------------CCCCCEEEEEEEE---C-CEEEEEEEECCCCCCCCH
T ss_conf             9999999999999999995--6987775----------------7761503899998---9-989999997898624741


Q ss_pred             HHHHHHHHCCEEEEEEECCCCCCH-HHHHHHHHHHH----CCCCEEEEECCCCCCCCCCCCHHHHHHHHHHHH------H
Q ss_conf             999999730268999986878865-58999999997----099679983267887532113388877555322------3
Q gi|254780321|r   94 EVSRSLSACEGSLLVVDATQGVEA-QTLANVYQAID----NNHEIITVLNKADLPSADPDRVKKQIEETIGIS------T  162 (606)
Q Consensus        94 EV~r~l~a~dgaiLvVdA~~Gvq~-QT~~~~~~A~~----~~l~~I~viNKiD~~~A~~e~v~~ei~~~~g~~------~  162 (606)
                      -...-++-+||+|+|+|+++--.- +.+..+...+.    .++|++++.||+|+|++..   .+|+.+.++++      .
T Consensus        60 ~~~~y~~~a~~iI~V~D~td~~~~~~~~~~~~~~l~~~~~~~~pili~~NK~Dl~~~~~---~~ei~~~l~~~~~~~~~~  136 (160)
T cd04156          60 VWKCYLENTDGLVYVVDSSDEARLDESQKELKHILKNEHIKGVPVVLLANKQDLPGALT---AEEITRRFKLKKYCSDRD  136 (160)
T ss_pred             HHHHHHCCCCEEEEEEECCCHHHHHHHHHHHHHHHHHHCCCCCEEEEEEECCCCCCCCC---HHHHHHHHHHHHHHHCCC
T ss_conf             58877456778999985686788787999999998663537874999998633656679---999999986999985399


Q ss_pred             HHHHHHHHHCCCCCCHHHHHHHH
Q ss_conf             21000111002232006787763
Q gi|254780321|r  163 EDALLVSAKTGEGIPLLLERIVQ  185 (606)
Q Consensus       163 ~~ii~vSAktG~GV~~LLd~Iv~  185 (606)
                      -.+.+|||+||.||+++++.+..
T Consensus       137 ~~i~~~SAktGegi~e~f~~la~  159 (160)
T cd04156         137 WYVQPCSAVTGEGLAEAFRKLAS  159 (160)
T ss_pred             CEEEEEECCCCCCHHHHHHHHHC
T ss_conf             99998668849599999999857


No 142
>cd01863 Rab18 Rab18 subfamily.  Mammalian Rab18 is implicated in endocytic transport and is expressed most highly in polarized epithelial cells. However, trypanosomal Rab, TbRAB18, is upregulated in the BSF (Blood Stream Form) stage and localized predominantly to elements of the Golgi complex.  In human and mouse cells, Rab18 has been identified in lipid droplets, organelles that store neutral lipids. GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state.  Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilitate Rab recycling by masking C-terminal lipid binding and promoting cytosolic localization. Most Rab GTPases contain a lipid modification site at the C-terminus, with sequence motifs CC, CXC, or CCX. Lipid binding is essential for membrane attachment, a key feature of mos
Probab=99.47  E-value=1.2e-12  Score=104.30  Aligned_cols=153  Identities=23%  Similarity=0.293  Sum_probs=103.1

Q ss_pred             EEEECCCCCCHHHHHHHHHHHCCCCCCCCCCCEEECCCHHHHHHCCEEEEEEEEEEEECCCCCEEEEEEEECCCCCHHHH
Q ss_conf             99980138987788999999829805444431130586779871950523279999743788438999961787300279
Q gi|254780321|r   14 FSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVRLNYTSTDAKDYQLNLIDTPGHVDFTY   93 (606)
Q Consensus        14 ~~IiaHvDhGKTTL~d~lL~~tg~i~~~~~~~~vlD~~~~EreRGITIka~~~~~~~~~~~~~~y~iNlIDTPGH~DF~~   93 (606)
                      ++++|.-+.|||||..|++  .|.+...- .          ..-|+....+  .+.   .+++.+.++|.||||+.+|..
T Consensus         3 ivvvG~~~vGKTsli~r~~--~~~f~~~~-~----------~ti~~~~~~~--~~~---~~~~~~~l~iwDt~g~~~~~~   64 (161)
T cd01863           3 ILLIGDSGVGKSSLLLRFT--DDTFDPDL-A----------ATIGVDFKVK--TLT---VDGKKVKLAIWDTAGQERFRT   64 (161)
T ss_pred             EEEECCCCCCHHHHHHHHH--HCCCCCCC-C----------CCCCCCCEEE--EEE---ECCEEEEEEEEECCCCCCCCC
T ss_conf             9999979957999999996--39999984-8----------7313342389--999---999999999999999842353


Q ss_pred             HHHHHHHHCCEEEEEEECCCCCCHHHHHHHHHHHH-----CCCCEEEEECCCCCCCCCCC-CHHHHHHHHHHHHHHHHHH
Q ss_conf             99999973026899998687886558999999997-----09967998326788753211-3388877555322321000
Q gi|254780321|r   94 EVSRSLSACEGSLLVVDATQGVEAQTLANVYQAID-----NNHEIITVLNKADLPSADPD-RVKKQIEETIGISTEDALL  167 (606)
Q Consensus        94 EV~r~l~a~dgaiLvVdA~~Gvq~QT~~~~~~A~~-----~~l~~I~viNKiD~~~A~~e-~v~~ei~~~~g~~~~~ii~  167 (606)
                      -....++-+|++++|.|.++----+....|+..+.     .++++++|-||.|+++..+. +...+.....++   ..+.
T Consensus        65 ~~~~~~~~a~~~ilvfd~~~~~Sf~~i~~~~~~i~~~~~~~~~~~ilVgnK~D~~~~~v~~~~~~~~a~~~~~---~y~e  141 (161)
T cd01863          65 LTSSYYRGAQGVILVYDVTRRDTFTNLETWLNELETYSTNNDIVKMLVGNKIDKENREVTREEGLKFARKHNM---LFIE  141 (161)
T ss_pred             CHHHHHHHCCEEEEEEECCCHHHHHHHHHHHHHHHHHCCCCCCEEEEEEECCCCCCCCCCHHHHHHHHHHCCC---EEEE
T ss_conf             4224413215348997678265699999999999985688887378873104400068999999999998699---9999


Q ss_pred             HHHHCCCCCCHHHHHHHHHH
Q ss_conf             11100223200678776321
Q gi|254780321|r  168 VSAKTGEGIPLLLERIVQQL  187 (606)
Q Consensus       168 vSAktG~GV~~LLd~Iv~~i  187 (606)
                      +|||+|.||+++++.|++.+
T Consensus       142 ~Sak~g~nV~~~F~~l~~~i  161 (161)
T cd01863         142 TSAKTRDGVQQAFEELVEKI  161 (161)
T ss_pred             ECCCCCCCHHHHHHHHHHHC
T ss_conf             71586815999999999709


No 143
>cd00876 Ras Ras family.  The Ras family of the Ras superfamily includes classical N-Ras, H-Ras, and K-Ras, as well as R-Ras, Rap, Ral, Rheb, Rhes, ARHI, RERG, Rin/Rit, RSR1, RRP22, Ras2, Ras-dva, and RGK proteins.  Ras proteins regulate cell growth, proliferation and differentiation.  Ras is activated by guanine nucleotide exchange factors (GEFs) that release GDP and allow GTP binding.  Many RasGEFs have been identified.  These are sequestered in the cytosol until activation by growth factors triggers recruitment to the plasma membrane or Golgi, where the GEF colocalizes with Ras.  Active GTP-bound Ras interacts with several effector proteins: among the best characterized are the Raf kinases, phosphatidylinositol 3-kinase (PI3K), RalGEFs and NORE/MST1.  Most Ras proteins contain a lipid modification site at the C-terminus, with a typical sequence motif CaaX, where a = an aliphatic amino acid and X = any amino acid.  Lipid binding is essential for membrane attachment, a key feature of m
Probab=99.46  E-value=3.7e-12  Score=101.13  Aligned_cols=154  Identities=19%  Similarity=0.244  Sum_probs=101.8

Q ss_pred             EEEECCCCCCHHHHHHHHHHHCCCCCCCCCCCEEECCCHHHHHHCCEEEEEEEEEEEECCCCCEEEEEEEECCCCCHHHH
Q ss_conf             99980138987788999999829805444431130586779871950523279999743788438999961787300279
Q gi|254780321|r   14 FSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVRLNYTSTDAKDYQLNLIDTPGHVDFTY   93 (606)
Q Consensus        14 ~~IiaHvDhGKTTL~d~lL~~tg~i~~~~~~~~vlD~~~~EreRGITIka~~~~~~~~~~~~~~y~iNlIDTPGH~DF~~   93 (606)
                      ++|+|--+.|||+|..|++.  +.+..... .+.          |-+.   ...+.   .+++.+.++|+||+|+.+|..
T Consensus         2 i~ivG~~~vGKTsli~r~~~--~~f~~~~~-pTi----------~~~~---~~~~~---~~~~~~~l~i~Dt~g~~~~~~   62 (160)
T cd00876           2 VVVLGAGGVGKSAITIQFVK--GTFVEEYD-PTI----------EDSY---RKTIV---VDGETYTLDILDTAGQEEFSA   62 (160)
T ss_pred             EEEECCCCCCHHHHHHHHHH--CCCCCCCC-CCE----------EEEE---EEEEE---ECCEEEEEEEEECCCCHHHHH
T ss_conf             99999699679999999961--95998778-830----------0489---99999---766999999997999623557


Q ss_pred             HHHHHHHHCCEEEEEEECCCCCCHHHHHHHHHHH-----HCCCCEEEEECCCCCCCCCCCCHHHHHHHHHHHHHHHHHHH
Q ss_conf             9999997302689999868788655899999999-----70996799832678875321133888775553223210001
Q gi|254780321|r   94 EVSRSLSACEGSLLVVDATQGVEAQTLANVYQAI-----DNNHEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLV  168 (606)
Q Consensus        94 EV~r~l~a~dgaiLvVdA~~Gvq~QT~~~~~~A~-----~~~l~~I~viNKiD~~~A~~e~v~~ei~~~~g~~~~~ii~v  168 (606)
                      -....++-+|++++|.|.++----+....|+.-+     ...+|+++|-||.|++..+. -..++++++..--....+.+
T Consensus        63 ~~~~~~~~a~~~ilvfd~~~~~Sf~~i~~~~~~i~~~~~~~~~piilvgnK~Dl~~~~~-V~~~e~~~~a~~~~~~y~e~  141 (160)
T cd00876          63 MRDLYIRQGDGFILVYSITDRESFEEIKGYREQILRVKDDEDIPIVLVGNKCDLENERQ-VSKEEGKALAKEWGCPFIET  141 (160)
T ss_pred             HHHHHHHHCCEEEEEECCCCHHHHHHHHHHHHHHHHHHCCCCCEEEEEEECCCCHHCCC-CCHHHHHHHHHHCCCEEEEE
T ss_conf             88999764368999732898789999999999999972878862999997456223078-99999999999849979998


Q ss_pred             HHHCCCCCCHHHHHHHHHH
Q ss_conf             1100223200678776321
Q gi|254780321|r  169 SAKTGEGIPLLLERIVQQL  187 (606)
Q Consensus       169 SAktG~GV~~LLd~Iv~~i  187 (606)
                      |||+|.||+++++.|++.+
T Consensus       142 Sak~g~nV~e~F~~i~~~i  160 (160)
T cd00876         142 SAKDNINIDEVFKLLVREI  160 (160)
T ss_pred             CCCCCCCHHHHHHHHHHHC
T ss_conf             4798949899999999729


No 144
>cd04112 Rab26 Rab26 subfamily.  First identified in rat pancreatic acinar cells, Rab26 is believed to play a role in recruiting mature granules to the plasma membrane upon beta-adrenergic stimulation.  Rab26 belongs to the Rab functional group III, which are considered key regulators of intracellular vesicle transport during exocytosis. GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state.  Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilitate Rab recycling by masking C-terminal lipid binding and promoting cytosolic localization.  Most Rab GTPases contain a lipid modification site at the C-terminus, with sequence motifs CC, CXC, or CCX. Lipid binding is essential for membrane attachment, a key feature of most Rab proteins.
Probab=99.45  E-value=3.5e-12  Score=101.23  Aligned_cols=159  Identities=19%  Similarity=0.269  Sum_probs=103.9

Q ss_pred             EEEEECCCCCCHHHHHHHHHHHCCCCCCCCCCCEEECCCHHHHHHCCEEEEEEEEEEEECCCCCEEEEEEEECCCCCHHH
Q ss_conf             79998013898778899999982980544443113058677987195052327999974378843899996178730027
Q gi|254780321|r   13 NFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVRLNYTSTDAKDYQLNLIDTPGHVDFT   92 (606)
Q Consensus        13 N~~IiaHvDhGKTTL~d~lL~~tg~i~~~~~~~~vlD~~~~EreRGITIka~~~~~~~~~~~~~~y~iNlIDTPGH~DF~   92 (606)
                      -+.++|...-|||+|+-|+.  .+.+-...-..          .-|+....+.+     ..+++.+.++|.||+|...|.
T Consensus         2 KIv~vGd~~VGKTsli~r~~--~~~f~~~~~~~----------Ti~~~~~~k~~-----~~~~~~v~l~iwDtaG~e~~~   64 (191)
T cd04112           2 KVMLLGDSGVGKTCLLVRFK--DGAFLNGNFIA----------TVGIDFRNKVV-----TVDGVKVKLQIWDTAGQERFR   64 (191)
T ss_pred             EEEEECCCCCCHHHHHHHHH--HCCCCCCCCCC----------CCCEEEEEEEE-----EECCEEEEEEEEECCCCCCCC
T ss_conf             89999949987999999999--59789998677----------65247799999-----999999999999799863346


Q ss_pred             HHHHHHHHHCCEEEEEEECCCCCCHHHHHHHHH-HHH---CCCCEEEEECCCCCCCCCCC--CHHHHHHHHHHHHHHHHH
Q ss_conf             999999973026899998687886558999999-997---09967998326788753211--338887755532232100
Q gi|254780321|r   93 YEVSRSLSACEGSLLVVDATQGVEAQTLANVYQ-AID---NNHEIITVLNKADLPSADPD--RVKKQIEETIGISTEDAL  166 (606)
Q Consensus        93 ~EV~r~l~a~dgaiLvVdA~~Gvq~QT~~~~~~-A~~---~~l~~I~viNKiD~~~A~~e--~v~~ei~~~~g~~~~~ii  166 (606)
                      .-....++-+|++|||.|.++=---+-...|.. ..+   .++++|+|-||+|+++-+.-  .-.+++...+++   ..+
T Consensus        65 ~l~~~~~~~a~~~ilvydit~~~Sf~~l~~w~~~i~~~~~~~~~iilVGNK~DL~~~r~V~~~e~~~~a~~~~~---~f~  141 (191)
T cd04112          65 SVTHAYYRDAHALLLLYDITNKASFDNIRAWLTEIKEYAQEDVVIMLLGNKADMSGERVVKREDGERLAKEYGV---PFM  141 (191)
T ss_pred             CCHHHHHHCCCEEEEEEECCCHHHHHHHHHHHHHHHHHCCCCCEEEEECCCCCCCCCCCCCHHHHHHHHHHCCC---EEE
T ss_conf             46477711777789997279889999999999999986667853898612465530267999999999998299---799


Q ss_pred             HHHHHCCCCCCHHHHHHHHHHHCCC
Q ss_conf             0111002232006787763210001
Q gi|254780321|r  167 LVSAKTGEGIPLLLERIVQQLPSPT  191 (606)
Q Consensus       167 ~vSAktG~GV~~LLd~Iv~~iP~P~  191 (606)
                      .+|||+|.||+++++.|+..+..-.
T Consensus       142 EtSAkt~~nI~e~F~~i~~~i~~~~  166 (191)
T cd04112         142 ETSAKTGLNVELAFTAVAKELKHRK  166 (191)
T ss_pred             EECCCCCCCHHHHHHHHHHHHHHHC
T ss_conf             9854898097999999999998742


No 145
>cd01860 Rab5_related Rab5-related subfamily.  This subfamily includes Rab5 and Rab22 of mammals, Ypt51/Ypt52/Ypt53 of yeast, and RabF of plants. The members of this subfamily are involved in endocytosis and endocytic-sorting pathways.  In mammals, Rab5 GTPases localize to early endosomes and regulate fusion of clathrin-coated vesicles to early endosomes and fusion between early endosomes. In yeast, Ypt51p family members similarly regulate membrane trafficking through prevacuolar compartments. GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state.  Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilitate Rab recycling by masking C-terminal lipid binding and promoting cytosolic localization.  Most Rab GTPases contain a lipid modification site at the C-terminus, with sequence mo
Probab=99.45  E-value=4.2e-12  Score=100.74  Aligned_cols=157  Identities=25%  Similarity=0.293  Sum_probs=100.8

Q ss_pred             EEEEECCCCCCHHHHHHHHHHHCCCCCCCCCCCEEECCCHHHHHHCCEEEEEEEEEEEECCCCCEEEEEEEECCCCCHHH
Q ss_conf             79998013898778899999982980544443113058677987195052327999974378843899996178730027
Q gi|254780321|r   13 NFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVRLNYTSTDAKDYQLNLIDTPGHVDFT   92 (606)
Q Consensus        13 N~~IiaHvDhGKTTL~d~lL~~tg~i~~~~~~~~vlD~~~~EreRGITIka~~~~~~~~~~~~~~y~iNlIDTPGH~DF~   92 (606)
                      .++++|-.+.|||+|.-|++  .+.+.+.. ..+          =|.....+.+     ..+++.++++|.||+|+..|.
T Consensus         3 KivviGd~~vGKTsli~r~~--~~~f~~~~-~~T----------ig~~~~~k~i-----~~~~~~v~l~iwDtaG~e~~~   64 (163)
T cd01860           3 KLVLLGDSSVGKSSLVLRFV--KNEFSENQ-EST----------IGAAFLTQTV-----NLDDTTVKFEIWDTAGQERYR   64 (163)
T ss_pred             EEEEECCCCCCHHHHHHHHH--HCCCCCCC-CCC----------CCEEEEEEEE-----EECCEEEEEEEEECCCCHHHH
T ss_conf             99999959968999999994--39899986-886----------6678899999-----999999999999799971002


Q ss_pred             HHHHHHHHHCCEEEEEEECCCCCCHHHHHHHHHHHH----CCCCEEEEECCCCCCCCCCCCHHHHHHHHHHHHHHHHHHH
Q ss_conf             999999973026899998687886558999999997----0996799832678875321133888775553223210001
Q gi|254780321|r   93 YEVSRSLSACEGSLLVVDATQGVEAQTLANVYQAID----NNHEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLV  168 (606)
Q Consensus        93 ~EV~r~l~a~dgaiLvVdA~~Gvq~QT~~~~~~A~~----~~l~~I~viNKiD~~~A~~e~v~~ei~~~~g~~~~~ii~v  168 (606)
                      .-....++-+|++|||.|.++=---+....|...+.    ..+++++|-||+|+..-+. --.++.+++..-..-..+.+
T Consensus        65 ~~~~~~~~~a~~~ilvydit~~~Sf~~~~~w~~~i~~~~~~~~~iilVgnK~DL~~~r~-V~~~e~~~~a~~~~~~~~E~  143 (163)
T cd01860          65 SLAPMYYRGAAAAIVVYDITSEESFEKAKSWVKELQRNASPNIIIALVGNKADLESKRQ-VSTEEAQEYADENGLLFFET  143 (163)
T ss_pred             HHHHHHHCCCCCEEEEEECCCHHHHHHHHHHHHHHHHHCCCCCEEEEEEECCCHHHCCC-CCHHHHHHHHHHCCCEEEEE
T ss_conf             78898851677149998189979999999999999985598723677553357565089-99999999999829979998


Q ss_pred             HHHCCCCCCHHHHHHHHHHH
Q ss_conf             11002232006787763210
Q gi|254780321|r  169 SAKTGEGIPLLLERIVQQLP  188 (606)
Q Consensus       169 SAktG~GV~~LLd~Iv~~iP  188 (606)
                      |||+|.||+++++.|++.+|
T Consensus       144 SAk~~~nV~e~F~~l~~~i~  163 (163)
T cd01860         144 SAKTGENVNELFTEIAKKLP  163 (163)
T ss_pred             CCCCCCCHHHHHHHHHHHCC
T ss_conf             62659078999999998583


No 146
>TIGR00231 small_GTP small GTP-binding protein domain; InterPro: IPR005225   Proteins with a small GTP-binding domain include Ras, RhoA, Rab11, translation elongation factor G, translation initiation factor IF-2, tetratcycline resistance protein TetM, CDC42, Era, ADP-ribosylation factors, tdhF, and many others . In some proteins the domain occurs more than once. Among them there is a large number of small GTP-binding proteins and related domains in larger proteins. Note that the alpha chains of heterotrimeric G proteins are larger proteins in which the NKXD motif is separated from the GxxxxGK[ST] motif (P-loop) by a long insert and are not easily detected by this model.; GO: 0005525 GTP binding.
Probab=99.45  E-value=3.7e-13  Score=107.79  Aligned_cols=166  Identities=30%  Similarity=0.329  Sum_probs=128.6

Q ss_pred             HCEEEEEECCCCCCHHHHHHHHHHHCCCCCCCCC--CCEEECCCHHHHHHCCEEEEEEEEEEEECCCCCEEEEEEEECCC
Q ss_conf             5317999801389877889999998298054444--31130586779871950523279999743788438999961787
Q gi|254780321|r   10 RIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREM--SSQVLDNMDIERERGITIKAQTVRLNYTSTDAKDYQLNLIDTPG   87 (606)
Q Consensus        10 ~IRN~~IiaHvDhGKTTL~d~lL~~tg~i~~~~~--~~~vlD~~~~EreRGITIka~~~~~~~~~~~~~~y~iNlIDTPG   87 (606)
                      ...++.++||.++|||||..+++...+.+.....  .....+.....+++|.+|. .     .. ..| .+++|++||||
T Consensus         2 ~~~~~~~~g~~~~Gk~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~-~-----~~-~~w-~~~~~~~d~~G   73 (186)
T TIGR00231         2 KDIKIGIVGDPNVGKSTLLNRLLGNKGSITESGPTDGTTRDYVTESIEEDGKTIT-G-----AT-FQW-GYKFNLLDTPG   73 (186)
T ss_pred             CCEEEEEEECCCCCHHHHHHHHHHCCCCEEECCCCCCCCHHHHEEEEEECCEEEE-E-----EE-EEC-CEEEEEEECCC
T ss_conf             7505899734776604555445410120010232333200000011345580234-3-----43-102-42789862577


Q ss_pred             ---CCHH-------HHHHHHHHHHCCEEEEEEECCCCCCHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCCHHHHH---
Q ss_conf             ---3002-------799999997302689999868788655899999999709967998326788753211338887---
Q gi|254780321|r   88 ---HVDF-------TYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQAIDNNHEIITVLNKADLPSADPDRVKKQI---  154 (606)
Q Consensus        88 ---H~DF-------~~EV~r~l~a~dgaiLvVdA~~Gvq~QT~~~~~~A~~~~l~~I~viNKiD~~~A~~e~v~~ei---  154 (606)
                         |.+|       ..++.+++..+|.+++++++.++++.|+...+..+...+.+++++.||+|+....++.+....   
T Consensus        74 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~d~~~~~~~~~~~~~~~~  153 (186)
T TIGR00231        74 LHRQEDYDALRRLYYPEVLSSLEVLDLVILVLDVEDGLEKDTKEIIHHADKYGVPILLVGNKIDLKDEKPGYFVDLKPHL  153 (186)
T ss_pred             CHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHCCCCEEEEEECCCCCCCCCCCEEEHHHHH
T ss_conf             11355554454332234454443333333222111001025677875322127416998513365546754010000345


Q ss_pred             -HHHHHHHHHH-HHHHHHHCCCCCCHHHHHH
Q ss_conf             -7555322321-0001110022320067877
Q gi|254780321|r  155 -EETIGISTED-ALLVSAKTGEGIPLLLERI  183 (606)
Q Consensus       155 -~~~~g~~~~~-ii~vSAktG~GV~~LLd~I  183 (606)
                       .......... .++.|+.++.|++.+.+.+
T Consensus       154 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  184 (186)
T TIGR00231       154 ASLFAKLNGEPHFIPLSAETGKGIDSLFGLV  184 (186)
T ss_pred             HHHHHHHCCCCCEEECCHHHHCCHHHHHHHH
T ss_conf             5555542366401111001110045566654


No 147
>cd04124 RabL2 RabL2 subfamily.  RabL2 (Rab-like2) subfamily.  RabL2s are novel Rab proteins identified recently which display features that are distinct from other Rabs, and have been termed Rab-like. RabL2 contains RabL2a and RabL2b, two very similar Rab proteins that share  98% sequence identity in humans. RabL2b maps to the subtelomeric region of chromosome 22q13.3 and RabL2a maps to 2q13, a region that suggests it is also a subtelomeric gene. Both genes are believed to be expressed ubiquitously, suggesting that RabL2s are the first example of duplicated genes in human proximal subtelomeric regions that are both expressed actively. Like other Rab-like proteins, RabL2s lack a prenylation site at the C-terminus. The specific functions of RabL2a and RabL2b remain unknown.  GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-b
Probab=99.44  E-value=7.4e-12  Score=99.08  Aligned_cols=153  Identities=21%  Similarity=0.304  Sum_probs=101.2

Q ss_pred             EEEECCCCCCHHHHHHHHHHHCCCCCCCCCCCEEECCCHHHHHHCCEEEEEEEEEEEECCCCCEEEEEEEECCCCCHHHH
Q ss_conf             99980138987788999999829805444431130586779871950523279999743788438999961787300279
Q gi|254780321|r   14 FSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVRLNYTSTDAKDYQLNLIDTPGHVDFTY   93 (606)
Q Consensus        14 ~~IiaHvDhGKTTL~d~lL~~tg~i~~~~~~~~vlD~~~~EreRGITIka~~~~~~~~~~~~~~y~iNlIDTPGH~DF~~   93 (606)
                      ++++|...-|||+|.-|++  .+.+...... +          =|++...+..     ..+++.+.++|.||||+..|..
T Consensus         3 ivllGd~~VGKTsli~r~~--~~~f~~~~~~-T----------ig~~~~~~~~-----~~~~~~~~l~iwDtaG~e~f~~   64 (161)
T cd04124           3 IILLGDSAVGKSKLVERFL--MDGYEPQQLS-T----------YALTLYKHNA-----KFEGKTILVDFWDTAGQERFQT   64 (161)
T ss_pred             EEEECCCCCCHHHHHHHHH--HCCCCCCCCC-C----------CCEEEEEEEE-----EECCEEEEEEEEECCCCCCCCH
T ss_conf             9999989967899999998--0977997266-5----------4157999999-----9999999999997999843432


Q ss_pred             HHHHHHHHCCEEEEEEECCCCCCHHHHHHHHHHH---HCCCCEEEEECCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             9999997302689999868788655899999999---7099679983267887532113388877555322321000111
Q gi|254780321|r   94 EVSRSLSACEGSLLVVDATQGVEAQTLANVYQAI---DNNHEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSA  170 (606)
Q Consensus        94 EV~r~l~a~dgaiLvVdA~~Gvq~QT~~~~~~A~---~~~l~~I~viNKiD~~~A~~e~v~~ei~~~~g~~~~~ii~vSA  170 (606)
                      -....++-++|+|||.|.+.=--=+....|..-+   ...+|+|+|-||+|++..    +.++-.++..-..-..+.+||
T Consensus        65 ~~~~y~~~a~~~ilvfDit~~~Sf~~~~~w~~~i~~~~~~~p~ilVgNK~DL~~~----~~~~~~~~a~~~~~~f~etSA  140 (161)
T cd04124          65 MHASYYHKAHACILVFDVTRKITYKNLSKWYEELREYRPEIPCIVVANKIDLDPS----VTQKKFNFAEKHNLPLYYVSA  140 (161)
T ss_pred             HHHHHHCCCCEEEEEEECCCHHHHHHHHHHHHHHHHHCCCCCEEEEEECCCCCCH----HHHHHHHHHHHCCCEEEEEEC
T ss_conf             4699735687679999689778899999999999986869989999997117742----589999999986991999907


Q ss_pred             HCCCCCCHHHHHHHHHHH
Q ss_conf             002232006787763210
Q gi|254780321|r  171 KTGEGIPLLLERIVQQLP  188 (606)
Q Consensus       171 ktG~GV~~LLd~Iv~~iP  188 (606)
                      |+|.||+++++.++..+-
T Consensus       141 k~g~nV~e~F~~l~~~~i  158 (161)
T cd04124         141 ADGTNVVKLFQDAIKLAV  158 (161)
T ss_pred             CCCCCHHHHHHHHHHHHH
T ss_conf             838097999999999998


No 148
>cd01867 Rab8_Rab10_Rab13_like Rab8/Sec4/Ypt2.  Rab8/Sec4/Ypt2 are known or suspected to be involved in post-Golgi transport to the plasma membrane. It is likely that these Rabs have functions that are specific to the mammalian lineage and have no orthologs in plants. Rab8 modulates polarized membrane transport through reorganization of actin and microtubules, induces the formation of new surface extensions, and has an important role in directed membrane transport to cell surfaces. The Ypt2 gene of the fission yeast Schizosaccharomyces pombe encodes a member of the Ypt/Rab family of small GTP-binding proteins, related in sequence to Sec4p of Saccharomyces cerevisiae but closer to mammalian Rab8.  GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state.  Rabs are further regulated by guanine nucleotide dissociation inhi
Probab=99.44  E-value=6.8e-12  Score=99.34  Aligned_cols=156  Identities=23%  Similarity=0.249  Sum_probs=102.0

Q ss_pred             EEEEECCCCCCHHHHHHHHHHHCCCCCCCCCCCEEECCCHHHHHHCCEEEEEEEEEEEECCCCCEEEEEEEECCCCCHHH
Q ss_conf             79998013898778899999982980544443113058677987195052327999974378843899996178730027
Q gi|254780321|r   13 NFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVRLNYTSTDAKDYQLNLIDTPGHVDFT   92 (606)
Q Consensus        13 N~~IiaHvDhGKTTL~d~lL~~tg~i~~~~~~~~vlD~~~~EreRGITIka~~~~~~~~~~~~~~y~iNlIDTPGH~DF~   92 (606)
                      -++++|..+.|||+|..|++  .+.+...-. .+          -|+....+.+     ..+++.+.++|.||+|+..|.
T Consensus         5 KivlvGd~~vGKTsli~r~~--~~~f~~~~~-~T----------ig~~~~~k~v-----~~~~~~i~l~iwDt~G~e~~~   66 (167)
T cd01867           5 KLLLIGDSGVGKSCLLLRFS--EDSFNPSFI-ST----------IGIDFKIRTI-----ELDGKKIKLQIWDTAGQERFR   66 (167)
T ss_pred             EEEEECCCCCCHHHHHHHHH--HCCCCCCCC-CC----------CCEEEEEEEE-----EECCEEEEEEEEECCCCCCHH
T ss_conf             99999999978899999996--099999868-98----------6468899999-----999999999999899970011


Q ss_pred             HHHHHHHHHCCEEEEEEECCCCCCHHHHHHHHHHH-H---CCCCEEEEECCCCCCCCCCCCHHHHHHHHHHHHHHHHHHH
Q ss_conf             99999997302689999868788655899999999-7---0996799832678875321133888775553223210001
Q gi|254780321|r   93 YEVSRSLSACEGSLLVVDATQGVEAQTLANVYQAI-D---NNHEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLV  168 (606)
Q Consensus        93 ~EV~r~l~a~dgaiLvVdA~~Gvq~QT~~~~~~A~-~---~~l~~I~viNKiD~~~A~~e~v~~ei~~~~g~~~~~ii~v  168 (606)
                      .-....++-++++|||.|.++=---+....|..-. +   .++++|+|-||+|+++.+.- ..++.+++..--.-..+.+
T Consensus        67 ~~~~~y~~~a~~~ilvfdit~~~Sf~~~~~w~~~i~~~~~~~~~~ilVgNK~Dl~~~r~v-~~~e~~~~a~~~~~~~~e~  145 (167)
T cd01867          67 TITTAYYRGAMGIILVYDITDEKSFENIRNWMRNIEEHASEDVERMLVGNKCDMEEKRVV-SKEEGEALADEYGIKFLET  145 (167)
T ss_pred             HHHHHHHHHCCEEEEECCCCCHHHHHHHHHHHHHHHHHCCCCCCEEEECCCCCCHHCCCC-CHHHHHHHHHHHCCEEEEE
T ss_conf             667998565058899556898799999999999999866999705764212450230779-9999999999809969998


Q ss_pred             HHHCCCCCCHHHHHHHHHH
Q ss_conf             1100223200678776321
Q gi|254780321|r  169 SAKTGEGIPLLLERIVQQL  187 (606)
Q Consensus       169 SAktG~GV~~LLd~Iv~~i  187 (606)
                      |||+|.||+++++.|++.+
T Consensus       146 SAktg~nI~e~F~~l~~~i  164 (167)
T cd01867         146 SAKANINVEEAFFTLAKDI  164 (167)
T ss_pred             CCCCCCCHHHHHHHHHHHH
T ss_conf             2257907899999999999


No 149
>smart00175 RAB Rab subfamily of small GTPases. Rab GTPases are implicated in vesicle trafficking.
Probab=99.43  E-value=4.8e-12  Score=100.33  Aligned_cols=156  Identities=25%  Similarity=0.317  Sum_probs=99.9

Q ss_pred             EEEEECCCCCCHHHHHHHHHHHCCCCCCCCCCCEEECCCHHHHHHCCEEEEEEEEEEEECCCCCEEEEEEEECCCCCHHH
Q ss_conf             79998013898778899999982980544443113058677987195052327999974378843899996178730027
Q gi|254780321|r   13 NFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVRLNYTSTDAKDYQLNLIDTPGHVDFT   92 (606)
Q Consensus        13 N~~IiaHvDhGKTTL~d~lL~~tg~i~~~~~~~~vlD~~~~EreRGITIka~~~~~~~~~~~~~~y~iNlIDTPGH~DF~   92 (606)
                      -++++|....|||+|..|++  .+.+.... ..+          -|+....+  .+.   .+++.+.++|.||+|+.+|.
T Consensus         2 Ki~vvG~~~vGKTsli~r~~--~~~f~~~~-~~T----------i~~~~~~~--~i~---~~~~~~~l~iwDt~G~e~~~   63 (164)
T smart00175        2 KIILIGDSGVGKSSLLSRFT--DGKFSEQY-KST----------IGVDFKTK--TIE---VDGKRVKLQIWDTAGQERFR   63 (164)
T ss_pred             EEEEECCCCCCHHHHHHHHH--HCCCCCCC-CCC----------CCEEEEEE--EEE---ECCEEEEEEEEECCCCHHHH
T ss_conf             89999989977999999994--19999986-884----------56666779--999---99999999999679944664


Q ss_pred             HHHHHHHHHCCEEEEEEECCCCCCHHHHHHHHHHH-H---CCCCEEEEECCCCCCCCCCCCHHHHHHHHHHHHHHHHHHH
Q ss_conf             99999997302689999868788655899999999-7---0996799832678875321133888775553223210001
Q gi|254780321|r   93 YEVSRSLSACEGSLLVVDATQGVEAQTLANVYQAI-D---NNHEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLV  168 (606)
Q Consensus        93 ~EV~r~l~a~dgaiLvVdA~~Gvq~QT~~~~~~A~-~---~~l~~I~viNKiD~~~A~~e~v~~ei~~~~g~~~~~ii~v  168 (606)
                      .-....++-+|+++||.|.++----+....|.... .   .+.|+++|-||+|++..+.- -.++.+++..-..-..+.+
T Consensus        64 ~l~~~~~~~~~~~ilvfdi~~~~Sf~~i~~w~~~i~~~~~~~~piilvgnK~Dl~~~r~V-~~~e~~~~a~~~~~~~~e~  142 (164)
T smart00175       64 SITSSYYRGAVGALLVYDITNRESFENLKNWLKELREYADPNVVIMLVGNKSDLEDQRQV-SREEAEAFAEEHGLPFFET  142 (164)
T ss_pred             HHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHHHHCCCCCCEEECCCCCCHHHHCCC-CHHHHHHHHHHCCCEEEEE
T ss_conf             779988336653688436899899999999999999867999825511645685651879-9999999999849979998


Q ss_pred             HHHCCCCCCHHHHHHHHHH
Q ss_conf             1100223200678776321
Q gi|254780321|r  169 SAKTGEGIPLLLERIVQQL  187 (606)
Q Consensus       169 SAktG~GV~~LLd~Iv~~i  187 (606)
                      ||++|.||+++++.+++.+
T Consensus       143 SAk~~~~v~e~F~~l~~~i  161 (164)
T smart00175      143 SAKTNTNVEEAFEELAREI  161 (164)
T ss_pred             CCCCCCCHHHHHHHHHHHH
T ss_conf             3166908899999999999


No 150
>cd00154 Rab Rab family.  Rab GTPases form the largest family within the Ras superfamily.  There are at least 60 Rab genes in the human genome, and a number of Rab GTPases are conserved from yeast to humans. Rab GTPases are small, monomeric proteins that function as molecular switches to regulate vesicle trafficking pathways.  The different Rab GTPases are localized to the cytosolic face of specific intracellular membranes, where they regulate distinct steps in membrane traffic pathways. In the GTP-bound form, Rab GTPases recruit specific sets of effector proteins onto membranes. Through their effectors, Rab GTPases regulate vesicle formation, actin- and tubulin-dependent vesicle movement, and membrane fusion.  GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state.  Rabs are further regulated by guanine nucleotide di
Probab=99.43  E-value=6.1e-12  Score=99.64  Aligned_cols=151  Identities=25%  Similarity=0.331  Sum_probs=97.0

Q ss_pred             EEEEECCCCCCHHHHHHHHHHHCCCCCCCCCCCEEECCCHHHHHHCCEEEEEEEEEEEECCCCCEEEEEEEECCCCCHHH
Q ss_conf             79998013898778899999982980544443113058677987195052327999974378843899996178730027
Q gi|254780321|r   13 NFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVRLNYTSTDAKDYQLNLIDTPGHVDFT   92 (606)
Q Consensus        13 N~~IiaHvDhGKTTL~d~lL~~tg~i~~~~~~~~vlD~~~~EreRGITIka~~~~~~~~~~~~~~y~iNlIDTPGH~DF~   92 (606)
                      .++++|.-..|||||..|++.  +.+.... ..+          -|....  ...+.   .+++.+.+++.||||+..|.
T Consensus         2 Ki~vvG~~~vGKTsli~~~~~--~~f~~~~-~~T----------ig~d~~--~~~~~---~~~~~~~l~iwDt~G~e~~~   63 (159)
T cd00154           2 KIVLIGDSGVGKTSLLLRFVD--GKFDENY-KST----------IGVDFK--SKTIE---IDGKTVKLQIWDTAGQERFR   63 (159)
T ss_pred             EEEEECCCCCCHHHHHHHHHH--CCCCCCC-CCC----------CCEEEE--EEEEE---ECCEEEEEEEEECCCCHHHH
T ss_conf             899999699689999999970--9999984-886----------664799--99999---99999999999789826577


Q ss_pred             HHHHHHHHHCCEEEEEEECCCCCCHHHHHH---HHH-HHH---CCCCEEEEECCCCCCCCCCCCHHHHHHHHHHHHHHHH
Q ss_conf             999999973026899998687886558999---999-997---0996799832678875321133888775553223210
Q gi|254780321|r   93 YEVSRSLSACEGSLLVVDATQGVEAQTLAN---VYQ-AID---NNHEIITVLNKADLPSADPDRVKKQIEETIGISTEDA  165 (606)
Q Consensus        93 ~EV~r~l~a~dgaiLvVdA~~Gvq~QT~~~---~~~-A~~---~~l~~I~viNKiD~~~A~~e~v~~ei~~~~g~~~~~i  165 (606)
                      .-....++-+|++|+|.|.++   +++..+   |+. ..+   .+.|+++|-||+|++..+. --.++.+++..--.-..
T Consensus        64 ~l~~~~~~~~d~~ilv~d~~~---~~Sf~~~~~~~~~i~~~~~~~~~iilvgnK~DL~~~~~-v~~~~~~~~a~~~~~~~  139 (159)
T cd00154          64 SITPSYYRGAHGAILVYDITN---RESFENLDKWLKELKEYAPENIPIILVGNKIDLEDQRQ-VSTEEAQQFAKENGLLF  139 (159)
T ss_pred             HHHHHHHHHCCEEEEECCCCC---HHHHHHHHHHHHHHHHHCCCCCCEEEEEECCCCHHCCC-CCHHHHHHHHHHCCCEE
T ss_conf             889999754127567244898---89999999999999986898882699997456301168-99999999999869979


Q ss_pred             HHHHHHCCCCCCHHHHHHHH
Q ss_conf             00111002232006787763
Q gi|254780321|r  166 LLVSAKTGEGIPLLLERIVQ  185 (606)
Q Consensus       166 i~vSAktG~GV~~LLd~Iv~  185 (606)
                      +.+||++|.||+++++.|++
T Consensus       140 ~e~SAk~~~~i~~~F~~i~~  159 (159)
T cd00154         140 FETSAKTGENVEELFQSLAE  159 (159)
T ss_pred             EEECCCCCCCHHHHHHHHHC
T ss_conf             99876888198999999869


No 151
>cd01881 Obg_like The Obg-like subfamily consists of five well-delimited, ancient subfamilies, namely Obg, DRG, YyaF/YchF, Ygr210, and NOG1.  Four of these groups (Obg, DRG, YyaF/YchF, and Ygr210) are characterized by a distinct glycine-rich motif immediately following the Walker B motif (G3 box).  Obg/CgtA is an essential gene that is involved in the initiation of sporulation and DNA replication in the bacteria Caulobacter and Bacillus, but its exact molecular role is unknown.  Furthermore, several OBG family members possess a C-terminal RNA-binding domain, the TGS domain, which is also present in threonyl-tRNA synthetase and in bacterial guanosine polyphosphatase SpoT.  Nog1 is a nucleolar protein that might function in ribosome assembly.  The DRG and Nog1 subfamilies are ubiquitous in archaea and eukaryotes, the Ygr210 subfamily is present in archaea and fungi, and the Obg and YyaF/YchF subfamilies are ubiquitous in bacteria and eukaryotes. The Obg/Nog1 and DRG subfamilies appear to 
Probab=99.43  E-value=2.8e-12  Score=101.87  Aligned_cols=151  Identities=23%  Similarity=0.310  Sum_probs=90.2

Q ss_pred             EECCCCCCHHHHHHHHHHHCCCCCCCCCCCEEECCCHHHHHHCCEEEEEEEEEEEECCCCCEEEEEEEECCCCCH-----
Q ss_conf             980138987788999999829805444431130586779871950523279999743788438999961787300-----
Q gi|254780321|r   16 IVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVRLNYTSTDAKDYQLNLIDTPGHVD-----   90 (606)
Q Consensus        16 IiaHvDhGKTTL~d~lL~~tg~i~~~~~~~~vlD~~~~EreRGITIka~~~~~~~~~~~~~~y~iNlIDTPGH~D-----   90 (606)
                      |||--.+|||||.-+|   ||.  +..    +.+      .-|-|.....-.+.|  .+  ..++.|+||||-.+     
T Consensus         1 ivG~PNvGKSTL~N~L---t~~--~~~----v~~------~pgTTr~~~~g~~~~--~~--~~~i~~~DtpGi~~~~~~~   61 (176)
T cd01881           1 LVGLPNVGKSTLLNAL---TNA--KPK----VAN------YPFTTLEPNLGVVEV--PD--GARIQVADIPGLIEGASEG   61 (176)
T ss_pred             CCCCCCCCHHHHHHHH---HCC--CCE----EEC------CCCCEEEEEEEEEEE--CC--CCEEEEEECCCCCCCCHHH
T ss_conf             9699988899999999---689--960----307------899676124679994--79--9669999578754573378


Q ss_pred             H--HHHHHHHHHHCCEEEEEEECCCCCCHHHHH----------HHHH-------HHHCCCCEEEEECCCCCCCCCCCCHH
Q ss_conf             2--799999997302689999868788655899----------9999-------99709967998326788753211338
Q gi|254780321|r   91 F--TYEVSRSLSACEGSLLVVDATQGVEAQTLA----------NVYQ-------AIDNNHEIITVLNKADLPSADPDRVK  151 (606)
Q Consensus        91 F--~~EV~r~l~a~dgaiLvVdA~~Gvq~QT~~----------~~~~-------A~~~~l~~I~viNKiD~~~A~~e~v~  151 (606)
                      -  .....+.++-||..++|+||.+....+...          .+..       ....+.|+++|+||+|+...+  +..
T Consensus        62 ~~~~~~~l~~~~~~d~il~vvD~~~~~~~~~~~~~~~~~~i~~el~~~~~~~~~~~~~~kp~i~v~NK~Dl~~~~--~~~  139 (176)
T cd01881          62 RGLGNQFLAHIRRADAILHVVDASEDDDIGGVDPLEDYEILNAELKLYDLETILGLLTAKPVIYVLNKIDLDDAE--ELE  139 (176)
T ss_pred             HHHHHHHHHHHHCCCEEEEEEECCCCCCCCCCCHHHHHHHHHHHHHHCCHHHHHHHHCCCCEEEEEECEECCCHH--HHH
T ss_conf             789999998741088999999898765545445899999999999971156655543269719999686034700--315


Q ss_pred             HHHHHHH-HHHHHHHHHHHHHCCCCCCHHHHHHHHHH
Q ss_conf             8877555-32232100011100223200678776321
Q gi|254780321|r  152 KQIEETI-GISTEDALLVSAKTGEGIPLLLERIVQQL  187 (606)
Q Consensus       152 ~ei~~~~-g~~~~~ii~vSAktG~GV~~LLd~Iv~~i  187 (606)
                      ..+...+ .....+++++||++|.|+++|+++|.+.+
T Consensus       140 ~~~~~~~~~~~~~~ii~iSA~~~~gi~~L~~~i~~~L  176 (176)
T cd01881         140 EELVRELALEEGAEVVPISAKTEEGLDELIRAIYELL  176 (176)
T ss_pred             HHHHHHHHHCCCCCEEEEECCCCCCHHHHHHHHHHHC
T ss_conf             9999999746899589997778879999999999659


No 152
>cd04128 Spg1 Spg1p.  Spg1p (septum-promoting GTPase) was first identified in the fission yeast S. pombe, where it regulates septum formation in the septation initiation network (SIN) through the cdc7 protein kinase.  Spg1p is an essential gene that localizes to the spindle pole bodies.  When GTP-bound, it binds cdc7 and causes it to translocate to spindle poles. Sid4p (septation initiation defective) is required for localization of Spg1p to the spindle pole body, and the ability of Spg1p to promote septum formation from any point in the cell cycle depends on Sid4p.  Spg1p is negatively regulated by Byr4 and cdc16, which form a two-component GTPase activating protein (GAP) for Spg1p.  The existence of a SIN-related pathway in plants has been proposed.  GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP.  Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state.  Rabs are
Probab=99.43  E-value=1.2e-11  Score=97.75  Aligned_cols=157  Identities=14%  Similarity=0.217  Sum_probs=102.0

Q ss_pred             EEEECCCCCCHHHHHHHHHHHCCCCCCCCCCCEEECCCHHHHHHCCEEEEEEEEEEEECCCCCEEEEEEEECCCCCHHHH
Q ss_conf             99980138987788999999829805444431130586779871950523279999743788438999961787300279
Q gi|254780321|r   14 FSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVRLNYTSTDAKDYQLNLIDTPGHVDFTY   93 (606)
Q Consensus        14 ~~IiaHvDhGKTTL~d~lL~~tg~i~~~~~~~~vlD~~~~EreRGITIka~~~~~~~~~~~~~~y~iNlIDTPGH~DF~~   93 (606)
                      ++++|....|||+|.-|++  .+.+.+....           .-|+....+.+.     .+++.+.++|.||+|...|..
T Consensus         3 ivlvGd~~VGKTsLi~rf~--~~~F~~~y~~-----------Tig~d~~~k~i~-----v~~~~v~l~iwDtaGqe~f~~   64 (182)
T cd04128           3 IGLLGDAQIGKTSLMVKYV--EGEFDEDYIQ-----------TLGVNFMEKTIS-----IRGTEITFSIWDLGGQREFIN   64 (182)
T ss_pred             EEEECCCCCCHHHHHHHHH--CCCCCCCCCC-----------CCEEEEEEEEEE-----ECCEEEEEEEEECCCCHHHHH
T ss_conf             9999999989899999995--3999999888-----------733898999999-----999999999986776487899


Q ss_pred             HHHHHHHHCCEEEEEEECCCCCCHHHHHHHHH-HHHC--CCCEEEEECCCCCCCC----CCCCHHHHHHHHHHHHHHHHH
Q ss_conf             99999973026899998687886558999999-9970--9967998326788753----211338887755532232100
Q gi|254780321|r   94 EVSRSLSACEGSLLVVDATQGVEAQTLANVYQ-AIDN--NHEIITVLNKADLPSA----DPDRVKKQIEETIGISTEDAL  166 (606)
Q Consensus        94 EV~r~l~a~dgaiLvVdA~~Gvq~QT~~~~~~-A~~~--~l~~I~viNKiD~~~A----~~e~v~~ei~~~~g~~~~~ii  166 (606)
                      -+...++-+++++||.|.++=---+....|+. ....  ...+|+|-||+|+..-    +-+.+.++-+++..--.-..+
T Consensus        65 ~~~~y~~~a~~~ilvfDit~~~Sf~~~~~w~~~i~~~~~~~~~ilVGnK~DL~~~~~~~~~~~~~~~~~~~a~~~~~~f~  144 (182)
T cd04128          65 MLPLVCNDAVAILFMFDLTRKSTLNSIKEWYRQARGFNKTAIPILVGTKYDLFADLPPEEQEEITKQARKYAKAMKAPLI  144 (182)
T ss_pred             HHHHHHCCCCEEEEEEECCCHHHHHHHHHHHHHHHHHCCCCCEEEEEECCCCCCCCCCHHEEHHHHHHHHHHHHCCCEEE
T ss_conf             99998647878999997899899998999999999768999889999866355655622310248999999998499899


Q ss_pred             HHHHHCCCCCCHHHHHHHHHHH
Q ss_conf             0111002232006787763210
Q gi|254780321|r  167 LVSAKTGEGIPLLLERIVQQLP  188 (606)
Q Consensus       167 ~vSAktG~GV~~LLd~Iv~~iP  188 (606)
                      .+|||+|.||+++++.|+..+=
T Consensus       145 etSAk~~~nV~e~F~~i~~~i~  166 (182)
T cd04128         145 FCSTSHSINVQKIFKIVLAKAF  166 (182)
T ss_pred             EEECCCCCCHHHHHHHHHHHHH
T ss_conf             9947999798999999999996


No 153
>cd04123 Rab21 Rab21 subfamily.  The localization and function of Rab21 are not clearly defined, with conflicting data reported.  Rab21 has been reported to localize in the ER in human intestinal epithelial cells, with partial colocalization with alpha-glucosidase, a late endosomal/lysosomal marker.  More recently, Rab21 was shown to colocalize with and affect the morphology of early endosomes. In Dictyostelium, GTP-bound Rab21, together with two novel LIM domain proteins, LimF and ChLim, has been shown to regulate phagocytosis. GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state.  Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilitate Rab recycling by masking C-terminal lipid binding and promoting cytosolic localization.  Most Rab GTPases contain a lipid modification site
Probab=99.43  E-value=3.6e-12  Score=101.15  Aligned_cols=156  Identities=22%  Similarity=0.281  Sum_probs=101.8

Q ss_pred             EEEEECCCCCCHHHHHHHHHHHCCCCCCCCCCCEEECCCHHHHHHCCEEEEEEEEEEEECCCCCEEEEEEEECCCCCHHH
Q ss_conf             79998013898778899999982980544443113058677987195052327999974378843899996178730027
Q gi|254780321|r   13 NFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVRLNYTSTDAKDYQLNLIDTPGHVDFT   92 (606)
Q Consensus        13 N~~IiaHvDhGKTTL~d~lL~~tg~i~~~~~~~~vlD~~~~EreRGITIka~~~~~~~~~~~~~~y~iNlIDTPGH~DF~   92 (606)
                      .++++|..+.|||||..|++  .+.+.+... .++          |.+...+  .+   ..+++.+.+++.||||+.+|.
T Consensus         2 Ki~vvG~~~vGKTsli~r~~--~~~f~~~~~-~ti----------~~~~~~k--~i---~~~~~~~~l~iwDt~G~~~~~   63 (162)
T cd04123           2 KVVLLGEGRVGKTSLVLRYV--ENKFNEKHE-STT----------QASFFQK--TV---NIGGKRIDLAIWDTAGQERYH   63 (162)
T ss_pred             EEEEECCCCCCHHHHHHHHH--HCCCCCCCC-CCC----------EEEEEEE--EE---EECCEEEEEEEEECCCCCCCC
T ss_conf             89999999967999999998--398998767-752----------6479999--99---999999999999589973035


Q ss_pred             HHHHHHHHHCCEEEEEEECCCCCCHHHHHHHHHHH----HCCCCEEEEECCCCCCCCCCCCHHHHHHHHHHHHHHHHHHH
Q ss_conf             99999997302689999868788655899999999----70996799832678875321133888775553223210001
Q gi|254780321|r   93 YEVSRSLSACEGSLLVVDATQGVEAQTLANVYQAI----DNNHEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLV  168 (606)
Q Consensus        93 ~EV~r~l~a~dgaiLvVdA~~Gvq~QT~~~~~~A~----~~~l~~I~viNKiD~~~A~~e~v~~ei~~~~g~~~~~ii~v  168 (606)
                      .-....++-+|+.+||.|.++=---+....|+.-+    ....++|+|-||+|++..+.- -.+|..++..--.-..+.+
T Consensus        64 ~~~~~~~~~a~~~ilv~d~t~~~Sf~~i~~~~~~i~~~~~~~~~iilvgnK~Dl~~~r~v-~~~e~~~~a~~~~~~y~e~  142 (162)
T cd04123          64 ALGPIYYRDADGAILVYDITDADSFQKVKKWIKELKQMRGNNISLVIVGNKIDLERQRVV-SKSEAEEYAKSVGAKHFET  142 (162)
T ss_pred             CCCHHHEECCCEEEEEEECCCHHHHHHHHHHHHHHHHHCCCCCCEEEECCCCCCHHHCCC-CHHHHHHHHHHCCCEEEEE
T ss_conf             563133011445799963899899999999999999876999746866332132540888-9999999999829989998


Q ss_pred             HHHCCCCCCHHHHHHHHHH
Q ss_conf             1100223200678776321
Q gi|254780321|r  169 SAKTGEGIPLLLERIVQQL  187 (606)
Q Consensus       169 SAktG~GV~~LLd~Iv~~i  187 (606)
                      ||++|.||+++++.|+..+
T Consensus       143 Sak~g~nV~e~F~~l~~~i  161 (162)
T cd04123         143 SAKTGKGIEELFLSLAKRM  161 (162)
T ss_pred             ECCCCCCHHHHHHHHHHHH
T ss_conf             1278819899999999986


No 154
>cd04139 RalA_RalB RalA/RalB subfamily.  The Ral (Ras-like) subfamily consists of the highly homologous RalA and RalB.  Ral proteins are believed to play a crucial role in tumorigenesis, metastasis, endocytosis, and actin cytoskeleton dynamics.  Despite their high sequence similarity (80% sequence identity), nonoverlapping and opposing functions have been assigned to RalA and RalBs in tumor migration.  In human bladder and prostate cancer cells, RalB promotes migration while RalA inhibits it.  A Ral-specific set of GEFs has been identified that are activated by Ras binding.  This RalGEF activity is enhanced by Ras binding to another of its target proteins, phosphatidylinositol 3-kinase (PI3K).   Ral effectors include RLIP76/RalBP1, a Rac/cdc42 GAP, and the exocyst (Sec6/8) complex, a heterooctomeric protein complex that is involved in tethering vesicles to specific sites on the plasma membrane prior to exocytosis.  In rat kidney cells, RalB is required for functional assembly of the exo
Probab=99.43  E-value=8.7e-12  Score=98.61  Aligned_cols=154  Identities=22%  Similarity=0.240  Sum_probs=100.0

Q ss_pred             EEEECCCCCCHHHHHHHHHHHCCCCCCCCCCCEEECCCHHHHHHCCEEEEEEEEEEEECCCCCEEEEEEEECCCCCHHHH
Q ss_conf             99980138987788999999829805444431130586779871950523279999743788438999961787300279
Q gi|254780321|r   14 FSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVRLNYTSTDAKDYQLNLIDTPGHVDFTY   93 (606)
Q Consensus        14 ~~IiaHvDhGKTTL~d~lL~~tg~i~~~~~~~~vlD~~~~EreRGITIka~~~~~~~~~~~~~~y~iNlIDTPGH~DF~~   93 (606)
                      ++++|-..-|||+|.-|++  .+.+.+.- ..++          |-.. .+  .+   ..+++.+.+++.||+|+.+|..
T Consensus         3 vvlvGd~~VGKTsli~r~~--~~~F~~~y-~pTi----------~~~~-~~--~~---~~~~~~v~l~iwDtaG~e~~~~   63 (164)
T cd04139           3 VIVVGAGGVGKSALTLQFM--YDEFVEDY-EPTK----------ADSY-RK--KV---VLDGEDVQLNILDTAGQEDYAA   63 (164)
T ss_pred             EEEECCCCCCHHHHHHHHH--HCCCCCCC-CCCC----------CCEE-EE--EE---EECCEEEEEEEEECCCCHHHHH
T ss_conf             9999999988999999997--19898774-8854----------4168-99--99---9999999999998988662488


Q ss_pred             HHHHHHHHCCEEEEEEECCCCCCHHHHHHHHHH-HH----CCCCEEEEECCCCCCCCCCCCHHHHHHHHHHHHHHHHHHH
Q ss_conf             999999730268999986878865589999999-97----0996799832678875321133888775553223210001
Q gi|254780321|r   94 EVSRSLSACEGSLLVVDATQGVEAQTLANVYQA-ID----NNHEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLV  168 (606)
Q Consensus        94 EV~r~l~a~dgaiLvVdA~~Gvq~QT~~~~~~A-~~----~~l~~I~viNKiD~~~A~~e~v~~ei~~~~g~~~~~ii~v  168 (606)
                      -....++-+||+|||.|.+.----+....|+.- ..    ..+|+|+|-||+|+.+.+. --.+|.+++..--.-..+.+
T Consensus        64 l~~~~~~~a~~~ilvydvt~~~Sf~~~~~~~~~~~~~~~~~~~piilVgNK~DL~~~r~-v~~~e~~~~a~~~~~~~~E~  142 (164)
T cd04139          64 IRDNYHRSGEGFLLVFSITDMESFTATAEFREQILRVKDDDNVPLLLVGNKCDLEDKRQ-VSSEEAANLARQWGVPYVET  142 (164)
T ss_pred             HHHHHHHHCCEEEEEEECCCHHHHHHHHHHHHHHHHHHCCCCCCEEEEEEEHHHHHCCC-CCHHHHHHHHHHCCCEEEEE
T ss_conf             99998863768899997797788999999999999860878863698733032334177-89999999999839989998


Q ss_pred             HHHCCCCCCHHHHHHHHHH
Q ss_conf             1100223200678776321
Q gi|254780321|r  169 SAKTGEGIPLLLERIVQQL  187 (606)
Q Consensus       169 SAktG~GV~~LLd~Iv~~i  187 (606)
                      |||+|.||+++++.+++.+
T Consensus       143 SAk~g~nV~~~F~~l~~~i  161 (164)
T cd04139         143 SAKTRQNVEKAFYDLVREI  161 (164)
T ss_pred             CCCCCCCHHHHHHHHHHHH
T ss_conf             2687908899999999999


No 155
>cd01893 Miro1 Miro1 subfamily.  Miro (mitochondrial Rho) proteins have tandem GTP-binding domains separated by a linker region containing putative calcium-binding EF hand motifs.  Genes encoding Miro-like proteins were found in several eukaryotic organisms.  This CD represents the N-terminal GTPase domain of Miro proteins.  These atypical Rho GTPases have roles in mitochondrial homeostasis and apoptosis.  Most Rho proteins contain a lipid modification site at the C-terminus; however, Miro is one of few Rho subfamilies that lack this feature.
Probab=99.43  E-value=1.2e-11  Score=97.66  Aligned_cols=157  Identities=17%  Similarity=0.185  Sum_probs=101.7

Q ss_pred             EEEECCCCCCHHHHHHHHHHHCCCCCCCCCCCEEECCCHHHHHHCCEEEEEEEEEEEECCCCCEEEEEEEECCCCCHHHH
Q ss_conf             99980138987788999999829805444431130586779871950523279999743788438999961787300279
Q gi|254780321|r   14 FSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVRLNYTSTDAKDYQLNLIDTPGHVDFTY   93 (606)
Q Consensus        14 ~~IiaHvDhGKTTL~d~lL~~tg~i~~~~~~~~vlD~~~~EreRGITIka~~~~~~~~~~~~~~y~iNlIDTPGH~DF~~   93 (606)
                      ++++|..+-|||+|.-|++  .|.+.+..  .+..+        -+|+     ...   .+++.+.++|.||+|..+|..
T Consensus         3 iv~vGd~~VGKTsli~r~~--~~~F~~~~--~~t~~--------~~~~-----~~~---~~~~~v~l~i~DtaG~e~~~~   62 (166)
T cd01893           3 IVLIGDEGVGKSSLIMSLV--SEEFPENV--PRVLP--------EITI-----PAD---VTPERVPTTIVDTSSRPQDRA   62 (166)
T ss_pred             EEEECCCCCCHHHHHHHHH--HCCCCCCC--CCCCC--------CEEE-----EEE---ECCEEEEEEEEECCCCCCCCH
T ss_conf             9999999989999999998--49788877--76345--------6899-----999---889099999998998723024


Q ss_pred             HHHHHHHHCCEEEEEEECCCCCCHHHHHHHHH----HHHCCCCEEEEECCCCCCCCCCCCHHHHH-HHHH-HHH-HHHHH
Q ss_conf             99999973026899998687886558999999----99709967998326788753211338887-7555-322-32100
Q gi|254780321|r   94 EVSRSLSACEGSLLVVDATQGVEAQTLANVYQ----AIDNNHEIITVLNKADLPSADPDRVKKQI-EETI-GIS-TEDAL  166 (606)
Q Consensus        94 EV~r~l~a~dgaiLvVdA~~Gvq~QT~~~~~~----A~~~~l~~I~viNKiD~~~A~~e~v~~ei-~~~~-g~~-~~~ii  166 (606)
                      -....++-+++++||-|.+.---=+-...+|.    ....+.|+|+|-||+|+.+.+.....++- .... .+. ....+
T Consensus        63 ~~~~~~~~a~~~ilvydit~~~Sf~~i~~~w~~~i~~~~~~~piilvGNK~DL~~~r~~~~~e~~~~~~~~~~~~~~~~~  142 (166)
T cd01893          63 NLAAEIRKANVICLVYSVDRPSTLERIRTKWLPLIRRLGVKVPIILVGNKSDLRDGSSQAGLEEEMLPIMNEFREIETCV  142 (166)
T ss_pred             HHHHHHCCCCEEEEEECCCCHHHHHHHHHHHHHHHHHHCCCCCEEEEEECCCCCCCCCCCHHHHHHHHHHHHHCCCCEEE
T ss_conf             57987368988999970898778999999999999986899968999988654002503358899999999730748899


Q ss_pred             HHHHHCCCCCCHHHHHHHHHHHCC
Q ss_conf             011100223200678776321000
Q gi|254780321|r  167 LVSAKTGEGIPLLLERIVQQLPSP  190 (606)
Q Consensus       167 ~vSAktG~GV~~LLd~Iv~~iP~P  190 (606)
                      .+|||+|.||+++++.+...+=.|
T Consensus       143 EtSAktg~nV~e~F~~~~k~~l~p  166 (166)
T cd01893         143 ECSAKTLINVSEVFYYAQKAVLHP  166 (166)
T ss_pred             EECCCCCCCHHHHHHHHHHHHHCC
T ss_conf             906588919899999999998098


No 156
>cd04116 Rab9 Rab9 subfamily.  Rab9 is found in late endosomes, together with mannose 6-phosphate receptors (MPRs) and the tail-interacting protein of 47 kD (TIP47).  Rab9 is a key mediator of vesicular transport from late endosomes to the trans-Golgi network (TGN) by redirecting the MPRs.  Rab9 has been identified as a key component for the replication of several viruses, including HIV1, Ebola, Marburg, and measles, making it a potential target for inhibiting a variety of viruses.  GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state.  Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilitate Rab recycling by masking C-terminal lipid binding and promoting cytosolic localization.  Most Rab GTPases contain a lipid modification site at the C-terminus, with sequence motifs CC, CX
Probab=99.42  E-value=4.6e-12  Score=100.46  Aligned_cols=157  Identities=17%  Similarity=0.244  Sum_probs=101.5

Q ss_pred             CEEEEEECCCCCCHHHHHHHHHHHCCCCCCCCCCCEEECCCHHHHHHCCEEEEEEEEEEEECCCCCEEEEEEEECCCCCH
Q ss_conf             31799980138987788999999829805444431130586779871950523279999743788438999961787300
Q gi|254780321|r   11 IRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVRLNYTSTDAKDYQLNLIDTPGHVD   90 (606)
Q Consensus        11 IRN~~IiaHvDhGKTTL~d~lL~~tg~i~~~~~~~~vlD~~~~EreRGITIka~~~~~~~~~~~~~~y~iNlIDTPGH~D   90 (606)
                      +=-++++|...-|||+|.-|++  .+.+..... .++          |+....+.+.     .+++.+.++|.||+|+.+
T Consensus         5 ~~KivvlGd~~VGKTsli~r~~--~~~f~~~~~-~Ti----------g~~~~~k~i~-----~~~~~v~l~iwDtaG~e~   66 (170)
T cd04116           5 LLKVILLGDGGVGKSSLMNRYV--TNKFDTQLF-HTI----------GVEFLNKDLE-----VDGHFVTLQIWDTAGQER   66 (170)
T ss_pred             EEEEEEECCCCCCHHHHHHHHH--HCCCCCCCC-CCC----------EEEEEEEEEE-----ECCEEEEEEEEECCCCCC
T ss_conf             8999999999978999999997--398999888-876----------0798999999-----999999999998999724


Q ss_pred             HHHHHHHHHHHCCEEEEEEECCCCCCHHHHHHHHHHH--------HCCCCEEEEECCCCCCCCCCCCHHHHHHHHHH-HH
Q ss_conf             2799999997302689999868788655899999999--------70996799832678875321133888775553-22
Q gi|254780321|r   91 FTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQAI--------DNNHEIITVLNKADLPSADPDRVKKQIEETIG-IS  161 (606)
Q Consensus        91 F~~EV~r~l~a~dgaiLvVdA~~Gvq~QT~~~~~~A~--------~~~l~~I~viNKiD~~~A~~e~v~~ei~~~~g-~~  161 (606)
                      |..-....++-+|++|||.|.++=--=+....|+.-+        ...+|+|+|-||+|++...+  ..++.+.+.. ..
T Consensus        67 ~~~l~~~~~~~a~~~ilvydit~~~Sf~~~~~w~~~~~~~~~~~~~~~~piilvgnK~Dl~~r~v--~~~e~~~~a~~~~  144 (170)
T cd04116          67 FRSLRTPFYRGSDCCLLTFAVDDSQSFQNLSNWKKEFIYYADVKEPESFPFVVLGNKNDIPERQV--STEEAQAWCRENG  144 (170)
T ss_pred             CCCCHHHHEECCCEEEEEEECCCHHHHHHHHHHHHHHHHHHCCCCCCCCEEEEEECCCHHHHCCC--CHHHHHHHHHHCC
T ss_conf             35241766004773399997888799999999999999971445788840999961111303788--9999999999859


Q ss_pred             HHHHHHHHHHCCCCCCHHHHHHHHHH
Q ss_conf             32100011100223200678776321
Q gi|254780321|r  162 TEDALLVSAKTGEGIPLLLERIVQQL  187 (606)
Q Consensus       162 ~~~ii~vSAktG~GV~~LLd~Iv~~i  187 (606)
                      ....+.+|||+|.||+++++.++..+
T Consensus       145 ~~~~~E~SAk~g~nV~~~F~~l~~~i  170 (170)
T cd04116         145 DYPYFETSAKDATNVAAAFEEAVRRV  170 (170)
T ss_pred             CCEEEEECCCCCCCHHHHHHHHHHCC
T ss_conf             97899988888818899999999539


No 157
>PTZ00132 GTP-binding nuclear protein; Provisional
Probab=99.42  E-value=5.3e-12  Score=100.07  Aligned_cols=154  Identities=18%  Similarity=0.233  Sum_probs=101.5

Q ss_pred             EEEEECCCCCCHHHHHHHHHHHCCCCCCCCCCCEEECCCHHHHHHCCEEEEEEEEEEEECCCCCEEEEEEEECCCCCHHH
Q ss_conf             79998013898778899999982980544443113058677987195052327999974378843899996178730027
Q gi|254780321|r   13 NFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVRLNYTSTDAKDYQLNLIDTPGHVDFT   92 (606)
Q Consensus        13 N~~IiaHvDhGKTTL~d~lL~~tg~i~~~~~~~~vlD~~~~EreRGITIka~~~~~~~~~~~~~~y~iNlIDTPGH~DF~   92 (606)
                      -+.++|-..-|||+|+-|++  .|.+.+... .++          |+..+.  ..+   ..+++.+.++|.||+|+..|.
T Consensus         8 KIvllGd~~VGKTsLi~r~~--~~~F~~~y~-pTi----------g~d~~~--~~~---~~~~~~i~l~IwDTaGqe~f~   69 (209)
T PTZ00132          8 KLILVGDGGVGKTTFVKRHL--TGEFEKKYI-ATL----------GVEVHP--LKF---YTNRGKICFNVWDTAGQEKFG   69 (209)
T ss_pred             EEEEECCCCCCHHHHHHHHH--HCCCCCCCC-CCC----------CEEEEE--EEE---EECCEEEEEEEEECCCCCCCC
T ss_conf             99999999967899999997--199699877-760----------279899--999---999999999999899974455


Q ss_pred             HHHHHHHHHCCEEEEEEECCCCCCHHHHHHHHHHHH---CCCCEEEEECCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHH
Q ss_conf             999999973026899998687886558999999997---09967998326788753211338887755532232100011
Q gi|254780321|r   93 YEVSRSLSACEGSLLVVDATQGVEAQTLANVYQAID---NNHEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVS  169 (606)
Q Consensus        93 ~EV~r~l~a~dgaiLvVdA~~Gvq~QT~~~~~~A~~---~~l~~I~viNKiD~~~A~~e~v~~ei~~~~g~~~~~ii~vS  169 (606)
                      .-.....+-++|+|||.|.+.=---+-...|+..+.   .++++|+|=||+|+.+..   |..+-.++-.-..-..+-+|
T Consensus        70 sl~~~yyr~a~~~ilVfDit~~~SF~~l~~W~~ei~~~~~~ipivLVGNK~DL~~r~---V~~~~~~~a~~~~~~f~EtS  146 (209)
T PTZ00132         70 GLRDGYYIKGQCAIIMFDVTSRITYKNVPNWHRDITRVCENIPIVLVGNKVDVKDRQ---VKAKQITFHRKKNLQYYDIS  146 (209)
T ss_pred             CCCCHHHCCCCEEEEEECCCCHHHHHHHHHHHHHHHHHCCCCCEEEEEECCCCCCCC---CCHHHHHHHHHCCCEEEEEE
T ss_conf             665144248988999843788789999999999999868998789997623224135---57999999998799899972


Q ss_pred             HHCCCCCCHHHHHHHHHH
Q ss_conf             100223200678776321
Q gi|254780321|r  170 AKTGEGIPLLLERIVQQL  187 (606)
Q Consensus       170 AktG~GV~~LLd~Iv~~i  187 (606)
                      ||+|.||+++++.+...+
T Consensus       147 AKtg~NV~e~F~~Lar~i  164 (209)
T PTZ00132        147 AKSNYNFEKPFLWLARRL  164 (209)
T ss_pred             CCCCCCHHHHHHHHHHHH
T ss_conf             689939799999999998


No 158
>cd01868 Rab11_like Rab11-like.  Rab11a, Rab11b, and Rab25 are closely related, evolutionary conserved Rab proteins that are differentially expressed. Rab11a is ubiquitously synthesized, Rab11b is enriched in brain and heart and Rab25 is only found in epithelia. Rab11/25 proteins seem to regulate recycling pathways from endosomes to the plasma membrane and to the trans-Golgi network. Furthermore, Rab11a is thought to function in the histamine-induced fusion of tubulovesicles containing H+, K+ ATPase with the plasma membrane in gastric parietal cells and in insulin-stimulated insertion of GLUT4 in the plasma membrane of cardiomyocytes. Overexpression of Rab25 has recently been observed in ovarian cancer and breast cancer, and has been correlated with worsened outcomes in both diseases. In addition, Rab25 overexpression has also been observed in prostate cancer, transitional cell carcinoma of the bladder, and invasive breast tumor cells. GTPase activating proteins (GAPs) interact with GTP
Probab=99.42  E-value=9.6e-12  Score=98.33  Aligned_cols=156  Identities=20%  Similarity=0.270  Sum_probs=99.8

Q ss_pred             EEEEECCCCCCHHHHHHHHHHHCCCCCCCCCCCEEECCCHHHHHHCCEEEEEEEEEEEECCCCCEEEEEEEECCCCCHHH
Q ss_conf             79998013898778899999982980544443113058677987195052327999974378843899996178730027
Q gi|254780321|r   13 NFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVRLNYTSTDAKDYQLNLIDTPGHVDFT   92 (606)
Q Consensus        13 N~~IiaHvDhGKTTL~d~lL~~tg~i~~~~~~~~vlD~~~~EreRGITIka~~~~~~~~~~~~~~y~iNlIDTPGH~DF~   92 (606)
                      -++++|....|||+|..|++  .|.+.... ..+          -|+....+  .+.   .+++.++++|.||+|...|.
T Consensus         5 Kiv~iGd~~VGKTsli~r~~--~~~f~~~~-~~T----------ig~~~~~k--~i~---~~~~~~~l~iwDtaG~e~~~   66 (165)
T cd01868           5 KIVLIGDSGVGKSNLLSRFT--RNEFNLDS-KST----------IGVEFATR--SIQ---IDGKTIKAQIWDTAGQERYR   66 (165)
T ss_pred             EEEEECCCCCCHHHHHHHHH--HCCCCCCC-CCC----------CCEEEEEE--EEE---ECCEEEEEEEEECCCCHHHH
T ss_conf             99999999978999999997--29899988-987----------44787899--999---99999999999899972126


Q ss_pred             HHHHHHHHHCCEEEEEEECCCCCCHHHHHHHHHHH-H---CCCCEEEEECCCCCCCCCCCCHHHHHHHHHHHHHHHHHHH
Q ss_conf             99999997302689999868788655899999999-7---0996799832678875321133888775553223210001
Q gi|254780321|r   93 YEVSRSLSACEGSLLVVDATQGVEAQTLANVYQAI-D---NNHEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLV  168 (606)
Q Consensus        93 ~EV~r~l~a~dgaiLvVdA~~Gvq~QT~~~~~~A~-~---~~l~~I~viNKiD~~~A~~e~v~~ei~~~~g~~~~~ii~v  168 (606)
                      .-....++-++++++|.|.++----+-...|..-+ +   .++|+++|-||+|+++.+. --.+|..++..-..-..+.+
T Consensus        67 ~~~~~~~~~a~~~ilvydit~~~Sf~~i~~w~~~i~~~~~~~~~iilVgnK~DL~~~r~-Vs~~e~~~~a~~~~~~~~E~  145 (165)
T cd01868          67 AITSAYYRGAVGALLVYDITKKQTFENVERWLKELRDHADSNIVIMLVGNKSDLRHLRA-VPTEEAKAFAEKNGLSFIET  145 (165)
T ss_pred             HHHHHHHHHCCCEEEEEECCCHHHHHHHHHHHHHHHHHCCCCCEEEEECCCCCHHHHCC-CCHHHHHHHHHHCCCEEEEE
T ss_conf             78998733205148986269889999999999999985557735987023478688578-88999999999859979996


Q ss_pred             HHHCCCCCCHHHHHHHHHH
Q ss_conf             1100223200678776321
Q gi|254780321|r  169 SAKTGEGIPLLLERIVQQL  187 (606)
Q Consensus       169 SAktG~GV~~LLd~Iv~~i  187 (606)
                      |||+|.||+++++.|++.+
T Consensus       146 SAk~g~nV~e~F~~l~~~i  164 (165)
T cd01868         146 SALDGTNVEEAFKQLLTEI  164 (165)
T ss_pred             CCCCCCCHHHHHHHHHHHH
T ss_conf             7888929899999999986


No 159
>KOG0463 consensus
Probab=99.42  E-value=5.3e-13  Score=106.75  Aligned_cols=269  Identities=20%  Similarity=0.276  Sum_probs=168.3

Q ss_pred             EEEEECCCCCCHHHHHHHHHHHCCCCCC-CCCCCEEECCCHHHHHHCCEE-------------------EEEEEEEEEEC
Q ss_conf             7999801389877889999998298054-444311305867798719505-------------------23279999743
Q gi|254780321|r   13 NFSIVAHIDHGKSTLADRFIQHCRGLTE-REMSSQVLDNMDIERERGITI-------------------KAQTVRLNYTS   72 (606)
Q Consensus        13 N~~IiaHvDhGKTTL~d~lL~~tg~i~~-~~~~~~vlD~~~~EreRGITI-------------------ka~~~~~~~~~   72 (606)
                      -+|++|.||+|||||..-|-  -|.++. |+..-|-|=...-|-|-|-|-                   .++.-.+.|..
T Consensus       135 RVAVVGNVDAGKSTLLGVLT--HgeLDnGRG~ARqkLFRHKHEiESGRTSSVGNDILGFD~~GNvVNKPD~Hg~~LdWvk  212 (641)
T KOG0463         135 RVAVVGNVDAGKSTLLGVLT--HGELDNGRGAARQKLFRHKHEIESGRTSSVGNDILGFDVHGNVVNKPDPHGHNLDWVK  212 (641)
T ss_pred             EEEEEECCCCCCCEEEEEEE--ECCCCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCEEECCCCCCCCCCCCCCCCCCCEE
T ss_conf             98997122477221676653--0443467227788776522310367544556620200254642158898888643134


Q ss_pred             C-CCCEEEEEEEECCCCCHHHHHHHHHH--HHCCEEEEEEECCCCCCHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCC-
Q ss_conf             7-88438999961787300279999999--7302689999868788655899999999709967998326788753211-
Q gi|254780321|r   73 T-DAKDYQLNLIDTPGHVDFTYEVSRSL--SACEGSLLVVDATQGVEAQTLANVYQAIDNNHEIITVLNKADLPSADPD-  148 (606)
Q Consensus        73 ~-~~~~y~iNlIDTPGH~DF~~EV~r~l--~a~dgaiLvVdA~~Gvq~QT~~~~~~A~~~~l~~I~viNKiD~~~A~~e-  148 (606)
                      . +.-...|.|||--||.-+.--..=.+  .+-|-.+|.|-|..|+-..|.+|+-+|+...+|+.+|+.|||..-|++- 
T Consensus       213 Ice~saKviTFIDLAGHEkYLKTTvFGMTGH~PDf~MLMiGaNaGIiGmTKEHLgLALaL~VPVfvVVTKIDMCPANiLq  292 (641)
T KOG0463         213 ICEDSAKVITFIDLAGHEKYLKTTVFGMTGHMPDFTMLMIGANAGIIGMTKEHLGLALALHVPVFVVVTKIDMCPANILQ  292 (641)
T ss_pred             ECCCCCEEEEEEECCCHHHHHHEEEECCCCCCCCCEEEEECCCCCCEECCHHHHHHHHHHCCCEEEEEEEECCCCHHHHH
T ss_conf             31364226898861541552311441033678872589851666511144776545564268579999850558178999


Q ss_pred             CHHHHHHHHH---H--------------------HHHH---HHHHHHHHCCCCCCHHHHHHHHHHHCCCCHHHHHCCCCC
Q ss_conf             3388877555---3--------------------2232---100011100223200678776321000111122012331
Q gi|254780321|r  149 RVKKQIEETI---G--------------------ISTE---DALLVSAKTGEGIPLLLERIVQQLPSPTSPEGANAPLKA  202 (606)
Q Consensus       149 ~v~~ei~~~~---g--------------------~~~~---~ii~vSAktG~GV~~LLd~Iv~~iP~P~~~~~~~~Pl~a  202 (606)
                      +...-+..++   |                    +..+   .|+.+|-.+|.+.+ ||....+.+|.- -..+.+.|--.
T Consensus       293 EtmKll~rllkS~gcrK~PvlVrs~DDVv~~A~NF~Ser~CPIFQvSNVtG~NL~-LLkmFLNlls~R-~~~~E~~PAeF  370 (641)
T KOG0463         293 ETMKLLTRLLKSPGCRKLPVLVRSMDDVVHAAVNFPSERVCPIFQVSNVTGTNLP-LLKMFLNLLSLR-RQLNENDPAEF  370 (641)
T ss_pred             HHHHHHHHHHCCCCCCCCCEEEECCCCEEEEECCCCCCCCCCEEEECCCCCCCHH-HHHHHHHHCCCC-CCCCCCCCCCE
T ss_conf             9999999986287765075788515644786135862123540786156677838-999998643744-56665797303


Q ss_pred             CCCCEEECCCCCEEEEEEECCCCCCCCCEEEEECC-CCCCCCCCCCCCCCCEEEEHHCCCCCHHHHHHCCCCC--CCCCC
Q ss_conf             01210114757259999816987355845887335-5642101222335541240101247123322011002--44445
Q gi|254780321|r  203 LLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGT-NAKYQVERIGILTPKMIDIEALYPGEIGVMIASIKEV--SHTRV  279 (606)
Q Consensus       203 lVfds~~D~~~G~I~~~RV~sG~lk~Gd~I~~~~~-g~~~~v~~ig~~~~~~~~v~~l~aGdVG~ii~gik~l--~~~~v  279 (606)
                      .|-|.++-|.+|.|+.+...+|+++-+|.+.+-.. ...+-.--+...+-++.++..+.+|+-.  -..+|++  .+++-
T Consensus       371 QIDD~Y~VpGVGTvvSGT~L~GtIrLND~LlLGPd~~G~F~pI~iKSIHRKRMpV~~VrcGQtA--SFALKKIkr~~vRK  448 (641)
T KOG0463         371 QIDDIYWVPGVGTVVSGTLLSGTIRLNDILLLGPDSNGDFMPIPIKSIHRKRMPVGIVRCGQTA--SFALKKIKRKDVRK  448 (641)
T ss_pred             EECCEEECCCCCEEEECCEEEEEEEECCEEEECCCCCCCEEEEEHHHHHHCCCCCEEEECCCHH--HHHHHHCCHHHHHC
T ss_conf             5222485178522764225521577522788667888876453456645403661487526404--36766354666536


Q ss_pred             CCEECCCC
Q ss_conf             42000466
Q gi|254780321|r  280 GDTITDDS  287 (606)
Q Consensus       280 GDTl~~~~  287 (606)
                      |-.+.+++
T Consensus       449 GMVmVsp~  456 (641)
T KOG0463         449 GMVMVSPK  456 (641)
T ss_pred             CEEEECCC
T ss_conf             41886687


No 160
>smart00173 RAS Ras subfamily of RAS small GTPases. Similar in fold and function to the bacterial EF-Tu GTPase. p21Ras couples receptor Tyr kinases and G protein receptors  to protein kinase cascades
Probab=99.41  E-value=1.2e-11  Score=97.64  Aligned_cols=150  Identities=23%  Similarity=0.253  Sum_probs=99.3

Q ss_pred             EEEECCCCCCHHHHHHHHHHHCCCCCCCCCCCEEECCCHHHHHHCCEEEE-EEEEEEEECCCCCEEEEEEEECCCCCHHH
Q ss_conf             99980138987788999999829805444431130586779871950523-27999974378843899996178730027
Q gi|254780321|r   14 FSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKA-QTVRLNYTSTDAKDYQLNLIDTPGHVDFT   92 (606)
Q Consensus        14 ~~IiaHvDhGKTTL~d~lL~~tg~i~~~~~~~~vlD~~~~EreRGITIka-~~~~~~~~~~~~~~y~iNlIDTPGH~DF~   92 (606)
                      ++++|....|||+|.-|++  +|.+.+.- .              -||.. ..-.+   ..+++.+.++|.||+|+.+|.
T Consensus         3 iv~vGd~~vGKTsli~r~~--~~~f~~~y-~--------------~Ti~~~~~k~i---~~~~~~~~l~iwDt~G~e~~~   62 (164)
T smart00173        3 LVVLGSGGVGKSALTIQFV--QGHFVDDY-D--------------PTIEDSYRKQI---EIDGEVCLLDILDTAGQEEFS   62 (164)
T ss_pred             EEEECCCCCCHHHHHHHHH--HCCCCCCC-C--------------CCEEEEEEEEE---EECCEEEEEEEEECCCCCCHH
T ss_conf             9999999978999999997--29799877-8--------------81367899999---999999999999899971035


Q ss_pred             HHHHHHHHHCCEEEEEEECCCCCCHHHH---HHHHHHH-H----CCCCEEEEECCCCCCCCCCCCHHHHHHHHHHHHHHH
Q ss_conf             9999999730268999986878865589---9999999-7----099679983267887532113388877555322321
Q gi|254780321|r   93 YEVSRSLSACEGSLLVVDATQGVEAQTL---ANVYQAI-D----NNHEIITVLNKADLPSADPDRVKKQIEETIGISTED  164 (606)
Q Consensus        93 ~EV~r~l~a~dgaiLvVdA~~Gvq~QT~---~~~~~A~-~----~~l~~I~viNKiD~~~A~~e~v~~ei~~~~g~~~~~  164 (606)
                      .-....++-+|++|||.|.++   .+|.   ..|+.-+ +    .++|+|+|-||+|+++.+.- -.+|.+++..--.-.
T Consensus        63 ~~~~~~~~~a~~~ilvydi~~---~~Sf~~~~~~~~~i~~~~~~~~~piilvgnK~DL~~~r~V-~~~e~~~~a~~~~~~  138 (164)
T smart00173       63 AMRDQYMRTGEGFLLVYSITD---RQSFEEIKKFREQILRVKDRDDVPIVLVGNKCDLESERVV-STEEGKELARQWGCP  138 (164)
T ss_pred             HHHHHHCCCCCEEEEEEECCC---HHHHHHHHHHHHHHHHHCCCCCCCEEEEEECCCCHHCCCC-CHHHHHHHHHHCCCE
T ss_conf             677775379877999830798---8999999999999998618888866877753463011789-999999999983998


Q ss_pred             HHHHHHHCCCCCCHHHHHHHHHH
Q ss_conf             00011100223200678776321
Q gi|254780321|r  165 ALLVSAKTGEGIPLLLERIVQQL  187 (606)
Q Consensus       165 ii~vSAktG~GV~~LLd~Iv~~i  187 (606)
                      .+.+||++|.||+++++.++..+
T Consensus       139 ~~E~SAk~g~nV~~~F~~l~~~i  161 (164)
T smart00173      139 FLETSAKERVNVDEAFYDLVREI  161 (164)
T ss_pred             EEEECCCCCCCHHHHHHHHHHHH
T ss_conf             99985898817899999999999


No 161
>cd01869 Rab1_Ypt1 Rab1/Ypt1 subfamily.  Rab1 is found in every eukaryote and is a key regulatory component for the transport of vesicles from the ER to the Golgi apparatus. Studies on mutations of Ypt1, the yeast homolog of Rab1, showed that this protein is necessary for the budding of vesicles of the ER as well as for their transport to, and fusion with, the Golgi apparatus. GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state.  Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilitate Rab recycling by masking C-terminal lipid binding and promoting cytosolic localization.  Most Rab GTPases contain a lipid modification site at the C-terminus, with sequence motifs CC, CXC, or CCX. Lipid binding is essential for membrane attachment, a key feature of most Rab proteins.  Due to t
Probab=99.41  E-value=1.1e-11  Score=98.04  Aligned_cols=156  Identities=24%  Similarity=0.255  Sum_probs=101.1

Q ss_pred             EEEEECCCCCCHHHHHHHHHHHCCCCCCCCCCCEEECCCHHHHHHCCEEEEEEEEEEEECCCCCEEEEEEEECCCCCHHH
Q ss_conf             79998013898778899999982980544443113058677987195052327999974378843899996178730027
Q gi|254780321|r   13 NFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVRLNYTSTDAKDYQLNLIDTPGHVDFT   92 (606)
Q Consensus        13 N~~IiaHvDhGKTTL~d~lL~~tg~i~~~~~~~~vlD~~~~EreRGITIka~~~~~~~~~~~~~~y~iNlIDTPGH~DF~   92 (606)
                      -++++|..+.|||+|.-|++  .+.+...-. .+          =|+....+.+.     .+++.+.+++.||+|+..|.
T Consensus         4 Kiv~vGd~~vGKTsli~r~~--~~~f~~~y~-~T----------ig~~~~~~~i~-----~~~~~~~l~iwDtaG~e~~~   65 (166)
T cd01869           4 KLLLIGDSGVGKSCLLLRFA--DDTYTESYI-ST----------IGVDFKIRTIE-----LDGKTIKLQIWDTAGQERFR   65 (166)
T ss_pred             EEEEECCCCCCHHHHHHHHH--CCCCCCCCC-CC----------CCEEEEEEEEE-----ECCEEEEEEEEECCCCCCCC
T ss_conf             99999999978999999994--399998747-85----------44048999999-----99999999999899982346


Q ss_pred             HHHHHHHHHCCEEEEEEECCCCCCHHHHHHHHHHH-H---CCCCEEEEECCCCCCCCCCCCHHHHHHHHHHHHHHHHHHH
Q ss_conf             99999997302689999868788655899999999-7---0996799832678875321133888775553223210001
Q gi|254780321|r   93 YEVSRSLSACEGSLLVVDATQGVEAQTLANVYQAI-D---NNHEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLV  168 (606)
Q Consensus        93 ~EV~r~l~a~dgaiLvVdA~~Gvq~QT~~~~~~A~-~---~~l~~I~viNKiD~~~A~~e~v~~ei~~~~g~~~~~ii~v  168 (606)
                      .-....++-+|++|||.|.++=---+....|..-. .   .+.++|+|-||+|+++.+.- -.++.+++..--.-..+.+
T Consensus        66 ~~~~~~~~~a~~~ilvfdit~~~Sf~~i~~w~~~i~~~~~~~~~~ilvgNK~DL~~~r~v-~~~~~~~~a~~~~~~~~E~  144 (166)
T cd01869          66 TITSSYYRGAHGIIIVYDVTDQESFNNVKQWLQEIDRYASENVNKLLVGNKCDLTDKRVV-DYSEAQEFADELGIPFLET  144 (166)
T ss_pred             CCHHHHHHHCCEEEEEECCCCHHHHHHHHHHHHHHHHHCCCCCCEEEEEEEECCCCCCCC-CHHHHHHHHHHCCCEEEEE
T ss_conf             267888563267799711799899999999999999867877744886132011314667-9999999999839969998


Q ss_pred             HHHCCCCCCHHHHHHHHHH
Q ss_conf             1100223200678776321
Q gi|254780321|r  169 SAKTGEGIPLLLERIVQQL  187 (606)
Q Consensus       169 SAktG~GV~~LLd~Iv~~i  187 (606)
                      |||+|.||+++++.|+..+
T Consensus       145 SAk~g~nI~e~F~~l~~~i  163 (166)
T cd01869         145 SAKNATNVEQAFMTMAREI  163 (166)
T ss_pred             CCCCCCCHHHHHHHHHHHH
T ss_conf             7687806899999999999


No 162
>cd04101 RabL4 RabL4 (Rab-like4) subfamily.  RabL4s are novel proteins that have high sequence similarity with Rab family members, but display features that are distinct from Rabs, and have been termed Rab-like.  As in other Rab-like proteins, RabL4 lacks a prenylation site at the C-terminus.  The specific function of RabL4 remains unknown.
Probab=99.41  E-value=3e-11  Score=94.96  Aligned_cols=157  Identities=17%  Similarity=0.181  Sum_probs=101.3

Q ss_pred             EEEECCCCCCHHHHHHHHHHHCCCCCCCCCCCEEECCCHHHHHHCCEEEEEEEEEEEECCCCCEEEEEEEECCCCCHHHH
Q ss_conf             99980138987788999999829805444431130586779871950523279999743788438999961787300279
Q gi|254780321|r   14 FSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVRLNYTSTDAKDYQLNLIDTPGHVDFTY   93 (606)
Q Consensus        14 ~~IiaHvDhGKTTL~d~lL~~tg~i~~~~~~~~vlD~~~~EreRGITIka~~~~~~~~~~~~~~y~iNlIDTPGH~DF~~   93 (606)
                      ++++|-.+-|||+|+.|++...+.+.+... .          --|+....+.+.+    .+++.+.++|.||+|...|..
T Consensus         3 ivllGd~gVGKTsli~r~~~~~~~f~~~y~-~----------Tig~~~~~k~~~~----~~~~~i~l~iwDtaG~e~~~~   67 (164)
T cd04101           3 CAVVGDPAVGKTAFVQMFHSNGAVFPKNYL-M----------TTGCDFVVKEVPV----DTDNTVELFIFDSAGQELYSD   67 (164)
T ss_pred             EEEECCCCCCHHHHHHHHHHCCCCCCCCCC-C----------CCCEEEEEEEEEE----CCCCEEEEEEEECCCCCCHHH
T ss_conf             999995995889999999978886688888-8----------6457889999997----899799999997999840067


Q ss_pred             HHHHHHHHCCEEEEEEECCCCCCHHHHHHHHHHHH---CCCCEEEEECCCCCCCCCCCCH-HHHHHHHHHHHHHHHHHHH
Q ss_conf             99999973026899998687886558999999997---0996799832678875321133-8887755532232100011
Q gi|254780321|r   94 EVSRSLSACEGSLLVVDATQGVEAQTLANVYQAID---NNHEIITVLNKADLPSADPDRV-KKQIEETIGISTEDALLVS  169 (606)
Q Consensus        94 EV~r~l~a~dgaiLvVdA~~Gvq~QT~~~~~~A~~---~~l~~I~viNKiD~~~A~~e~v-~~ei~~~~g~~~~~ii~vS  169 (606)
                      -....++-+++++||-|.++---=+....|.....   .+.|+|+|-||+|+.+-+  .| .+|.+++..-..-..+.+|
T Consensus        68 l~~~~~~~a~~~ilvydit~~~Sf~~~~~w~~~i~~~~~~~p~ilVgNK~DL~~~r--~V~~~e~~~~a~~~~~~~~E~S  145 (164)
T cd04101          68 MVSNYWESPSVFILVYDVSNKASFENCSRWVNKVRTASKHMPGVLVGNKMDLADKA--EVTDAQAQAFAQANQLKFFKTS  145 (164)
T ss_pred             HHHHHHHHCCEEEEEEECCCHHHHHHHHHHHHHHHHHCCCCCEEEEEECCCCCCCC--CCCHHHHHHHHHHCCCEEEEEC
T ss_conf             89999764268999970774668999999999999766898689998722445245--5699999999998899899986


Q ss_pred             HHCCCCCCHHHHHHHHHH
Q ss_conf             100223200678776321
Q gi|254780321|r  170 AKTGEGIPLLLERIVQQL  187 (606)
Q Consensus       170 AktG~GV~~LLd~Iv~~i  187 (606)
                      ||+|.||+++++.|+..+
T Consensus       146 Ak~g~nV~e~F~~lar~~  163 (164)
T cd04101         146 ALRGVGYEEPFESLARAF  163 (164)
T ss_pred             CCCCCCHHHHHHHHHHHH
T ss_conf             688909899999999986


No 163
>cd04121 Rab40 Rab40 subfamily.  This subfamily contains Rab40a, Rab40b, and Rab40c, which are all highly homologous.  In rat, Rab40c is localized to the perinuclear recycling compartment (PRC), and is distributed in a tissue-specific manor, with high expression in brain, heart, kidney, and testis, low expression in lung and liver, and no expression in spleen and skeletal muscle.  Rab40c is highly expressed in differentiated oligodendrocytes but minimally expressed in oligodendrocyte progenitors, suggesting a role in the vesicular transport of myelin components.  Unlike most other Ras-superfamily proteins, Rab40c was shown to have a much lower affinity for GTP, and an affinity for GDP that is lower than for GTP. GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state.  Rabs are further regulated by guanine nucleotide d
Probab=99.41  E-value=1.5e-11  Score=97.02  Aligned_cols=158  Identities=20%  Similarity=0.171  Sum_probs=105.1

Q ss_pred             CEEEEEECCCCCCHHHHHHHHHHHCCCCCCCCCCCEEECCCHHHHHHCCEEEEEEEEEEEECCCCCEEEEEEEECCCCCH
Q ss_conf             31799980138987788999999829805444431130586779871950523279999743788438999961787300
Q gi|254780321|r   11 IRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVRLNYTSTDAKDYQLNLIDTPGHVD   90 (606)
Q Consensus        11 IRN~~IiaHvDhGKTTL~d~lL~~tg~i~~~~~~~~vlD~~~~EreRGITIka~~~~~~~~~~~~~~y~iNlIDTPGH~D   90 (606)
                      +=.+.++|-..-|||+|+-|++  .|.+...-.. +          -|.....+.+     ..+++.++++|.||+|+..
T Consensus         6 ~~KivllGd~~VGKTsl~~r~~--~~~f~~~y~~-T----------ig~~~~~k~~-----~~~~~~v~l~iwDtaGqe~   67 (189)
T cd04121           6 LLKFLLVGDSDVGKGEILASLQ--DGSTESPYGY-N----------MGIDYKTTTI-----LLDGRRVKLQLWDTSGQGR   67 (189)
T ss_pred             EEEEEEECCCCCCHHHHHHHHH--CCCCCCCCCC-C----------CCEEEEEEEE-----EECCEEEEEEEECCCCCCC
T ss_conf             9999999989978999999997--4997898687-6----------5379899999-----9999999999981788622


Q ss_pred             HHHHHHHHHHHCCEEEEEEECCCCCCHHHHHHHHHHHH---CCCCEEEEECCCCCCCCCCCCHHHHHHHHHHHHHHHHHH
Q ss_conf             27999999973026899998687886558999999997---099679983267887532113388877555322321000
Q gi|254780321|r   91 FTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQAID---NNHEIITVLNKADLPSADPDRVKKQIEETIGISTEDALL  167 (606)
Q Consensus        91 F~~EV~r~l~a~dgaiLvVdA~~Gvq~QT~~~~~~A~~---~~l~~I~viNKiD~~~A~~e~v~~ei~~~~g~~~~~ii~  167 (606)
                      |..-...-++-++|+|||-|.+.=--=+....|..-+.   -++|+|+|-||+|++.-+ .--.+|.+++-.-..-..+.
T Consensus        68 f~~l~~~y~r~a~~~ilvyDvt~~~Sf~~l~~w~~~i~~~~~~~p~iLVGNK~DL~~~r-~V~~ee~~~~A~~~~~~f~E  146 (189)
T cd04121          68 FCTIFRSYSRGAQGIILVYDITNRWSFDGIDRWIKEIDEHAPGVPKILVGNRLHLAFKR-QVATEQAQAYAERNGMTFFE  146 (189)
T ss_pred             HHHHHHHHHHHCCCEEEEECCCCHHHHHHHHHHHHHHHHHCCCCCEEEEEECCCHHHCC-CCCHHHHHHHHHHCCCEEEE
T ss_conf             11678988663370489822798899999999999999976898789961325503308-89999999999988999999


Q ss_pred             HHHHCCCCCCHHHHHHHHHH
Q ss_conf             11100223200678776321
Q gi|254780321|r  168 VSAKTGEGIPLLLERIVQQL  187 (606)
Q Consensus       168 vSAktG~GV~~LLd~Iv~~i  187 (606)
                      +|||+|.||+++++.+...+
T Consensus       147 tSAk~g~nV~e~F~~l~~~i  166 (189)
T cd04121         147 VSPLCNFNITESFTELARIV  166 (189)
T ss_pred             ECCCCCCCHHHHHHHHHHHH
T ss_conf             60067939899999999999


No 164
>cd04138 H_N_K_Ras_like H-Ras/N-Ras/K-Ras subfamily.  H-Ras, N-Ras, and K-Ras4A/4B are the prototypical members of the Ras family.  These isoforms generate distinct signal outputs despite interacting with a common set of activators and effectors, and are strongly associated with oncogenic progression in tumor initiation.  Mutated versions of Ras that are insensitive to GAP stimulation (and are therefore constitutively active) are found in a significant fraction of human cancers.  Many Ras guanine nucleotide exchange factors (GEFs) have been identified.  They are sequestered in the cytosol until activation by growth factors triggers recruitment to the plasma membrane or Golgi, where the GEF colocalizes with Ras.  Active (GTP-bound) Ras interacts with several effector proteins that stimulate a variety of diverse cytoplasmic signaling activities.  Some are known to positively mediate the oncogenic properties of Ras, including Raf, phosphatidylinositol 3-kinase (PI3K), RalGEFs, and Tiam1.  
Probab=99.41  E-value=9.6e-12  Score=98.31  Aligned_cols=151  Identities=22%  Similarity=0.305  Sum_probs=99.8

Q ss_pred             EEEEECCCCCCHHHHHHHHHHHCCCCCCCCCCCEEECCCHHHHHHCCEEEEEEEEEEEECCCCCEEEEEEEECCCCCHHH
Q ss_conf             79998013898778899999982980544443113058677987195052327999974378843899996178730027
Q gi|254780321|r   13 NFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVRLNYTSTDAKDYQLNLIDTPGHVDFT   92 (606)
Q Consensus        13 N~~IiaHvDhGKTTL~d~lL~~tg~i~~~~~~~~vlD~~~~EreRGITIka~~~~~~~~~~~~~~y~iNlIDTPGH~DF~   92 (606)
                      .++++|-.+-|||+|.-|++  .+.+...-               --||-.. ..-. ...+++.+.++|.||+|+.+|.
T Consensus         3 KvvlvGd~~VGKTsli~r~~--~~~F~~~y---------------~~Ti~~~-~~k~-~~i~~~~~~l~iwDtaG~e~~~   63 (162)
T cd04138           3 KLVVVGAGGVGKSALTIQLI--QNHFVDEY---------------DPTIEDS-YRKQ-VVIDGETCLLDILDTAGQEEYS   63 (162)
T ss_pred             EEEEECCCCCCHHHHHHHHH--HCCCCCCC---------------CCCCCCE-EEEE-EEECCEEEEEEEEECCCCCCCC
T ss_conf             99998999988999999998--39288756---------------8855527-9999-9999999999999799860111


Q ss_pred             HHHHHHHHHCCEEEEEEECCCCCCHHHHHHHHHHHH-----CCCCEEEEECCCCCCCCCCCCHHHHHH---HHHHHHHHH
Q ss_conf             999999973026899998687886558999999997-----099679983267887532113388877---555322321
Q gi|254780321|r   93 YEVSRSLSACEGSLLVVDATQGVEAQTLANVYQAID-----NNHEIITVLNKADLPSADPDRVKKQIE---ETIGISTED  164 (606)
Q Consensus        93 ~EV~r~l~a~dgaiLvVdA~~Gvq~QT~~~~~~A~~-----~~l~~I~viNKiD~~~A~~e~v~~ei~---~~~g~~~~~  164 (606)
                      .-....++-+|++|||-|.++---=+....|+.-+.     ..+|+|+|-||+|+++-.+.  .+|.+   .-+++   .
T Consensus        64 ~l~~~~~~~a~~~ilvydvt~~~Sf~~v~~w~~~i~~~~~~~~~piilVgNK~Dl~~r~V~--~~e~~~~a~~~~~---~  138 (162)
T cd04138          64 AMRDQYMRTGEGFLCVFAINSRKSFEDIHTYREQIKRVKDSDDVPMVLVGNKCDLAARTVS--SRQGQDLAKSYGI---P  138 (162)
T ss_pred             HHHHHHHCCCCEEEEEEECCCHHHHHHHHHHHHHHHHHCCCCCCEEEEEEEECCHHHCCCC--HHHHHHHHHHCCC---E
T ss_conf             4789871578779999617988999989999999998548888549999765356455588--9999999998099---8


Q ss_pred             HHHHHHHCCCCCCHHHHHHHHHH
Q ss_conf             00011100223200678776321
Q gi|254780321|r  165 ALLVSAKTGEGIPLLLERIVQQL  187 (606)
Q Consensus       165 ii~vSAktG~GV~~LLd~Iv~~i  187 (606)
                      .+.+||++|.||+++++.++..+
T Consensus       139 f~E~SAk~~~nV~e~F~~l~~~I  161 (162)
T cd04138         139 YIETSAKTRQGVEEAFYTLVREI  161 (162)
T ss_pred             EEEECCCCCCCHHHHHHHHHHHC
T ss_conf             99973899859899999999963


No 165
>cd04137 RheB Rheb (Ras Homolog Enriched in Brain) subfamily.  Rheb was initially identified in rat brain, where its expression is elevated by seizures or by long-term potentiation.  It is expressed ubiquitously, with elevated levels in muscle and brain.  Rheb functions as an important mediator between the tuberous sclerosis complex proteins, TSC1 and TSC2, and the mammalian target of rapamycin (TOR) kinase to stimulate cell growth.  TOR kinase regulates cell growth by controlling nutrient availability, growth factors, and the energy status of the cell.  TSC1 and TSC2 form a dimeric complex that has tumor suppressor activity, and TSC2 is a GTPase activating protein (GAP) for Rheb.  The TSC1/TSC2 complex inhibits the activation of TOR kinase through Rheb.  Rheb has also been shown to induce the formation of large cytoplasmic vacuoles in a process that is dependent on the GTPase cycle of Rheb, but independent of the TOR kinase, suggesting Rheb plays a role in endocytic trafficking that le
Probab=99.40  E-value=1.3e-11  Score=97.50  Aligned_cols=155  Identities=22%  Similarity=0.344  Sum_probs=101.6

Q ss_pred             EEEEEECCCCCCHHHHHHHHHHHCCCCCCCCCCCEEECCCHHHHHHCCEEEEEEEEEEEECCCCCEEEEEEEECCCCCHH
Q ss_conf             17999801389877889999998298054444311305867798719505232799997437884389999617873002
Q gi|254780321|r   12 RNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVRLNYTSTDAKDYQLNLIDTPGHVDF   91 (606)
Q Consensus        12 RN~~IiaHvDhGKTTL~d~lL~~tg~i~~~~~~~~vlD~~~~EreRGITIka~~~~~~~~~~~~~~y~iNlIDTPGH~DF   91 (606)
                      |-++++|-.+-|||+|.-|++  .+.+.+.- ..++          |-.. .+  .+.   .+++.|.++|.||+|+.+|
T Consensus         2 ~KIvlvGd~~VGKTsli~r~~--~~~f~~~y-~~Ti----------~~~~-~k--~i~---~~~~~~~l~iwDtaG~e~~   62 (180)
T cd04137           2 RKIAVLGSRSVGKSSLTVQFV--EGHFVESY-YPTI----------ENTF-SK--IIR---YKGQDYHLEIVDTAGQDEY   62 (180)
T ss_pred             CEEEEECCCCCCHHHHHHHHH--CCCCCCCC-CCCC----------CCCC-CE--EEE---ECCEEEEEEEEECCCCCCC
T ss_conf             889999989988999999997--09789985-8812----------4411-37--999---9999999999989987010


Q ss_pred             HHHHHHHHHHCCEEEEEEECCCCCCHHHHHHHHHHH-----HCCCCEEEEECCCCCCCCCCCC--HHHHHHHHHHHHHHH
Q ss_conf             799999997302689999868788655899999999-----7099679983267887532113--388877555322321
Q gi|254780321|r   92 TYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQAI-----DNNHEIITVLNKADLPSADPDR--VKKQIEETIGISTED  164 (606)
Q Consensus        92 ~~EV~r~l~a~dgaiLvVdA~~Gvq~QT~~~~~~A~-----~~~l~~I~viNKiD~~~A~~e~--v~~ei~~~~g~~~~~  164 (606)
                      ..-.....+-++|+|||.|.++=---+....|+...     ..++|+|+|-||+|++.-+.-.  -.+++..-+++   .
T Consensus        63 ~~~~~~~~~~a~~~ilvydvt~~~Sf~~~~~~~~~~~~~~~~~~~piilVgNK~DL~~~r~V~~~e~~~~a~~~~~---~  139 (180)
T cd04137          63 SILPQKYSIGIHGYILVYSVTSRKSFEVVKVIYDKILDMLGKESVPIVLVGNKSDLHTQRQVSTEEGKELAESWGA---A  139 (180)
T ss_pred             CHHHHHHHHHCCEEEEEEECCCHHHHHHHHHHHHHHHHHHCCCCCCEEEEEECCCCHHHCCCCHHHHHHHHHHCCC---E
T ss_conf             0667999863557899974388788999999999999975888886797765346244078899999999998399---8


Q ss_pred             HHHHHHHCCCCCCHHHHHHHHHHH
Q ss_conf             000111002232006787763210
Q gi|254780321|r  165 ALLVSAKTGEGIPLLLERIVQQLP  188 (606)
Q Consensus       165 ii~vSAktG~GV~~LLd~Iv~~iP  188 (606)
                      .+.+|||+|.||+++++.+++.+-
T Consensus       140 f~EtSAk~g~nV~e~F~~l~~~i~  163 (180)
T cd04137         140 FLESSARENENVEEAFELLIEEIE  163 (180)
T ss_pred             EEEECCCCCCCHHHHHHHHHHHHH
T ss_conf             999776889198999999999998


No 166
>cd04113 Rab4 Rab4 subfamily.  Rab4 has been implicated in numerous functions within the cell.  It helps regulate endocytosis through the sorting, recycling, and degradation of early endosomes. Mammalian Rab4 is involved in the regulation of many surface proteins including G-protein-coupled receptors, transferrin receptor, integrins, and surfactant protein A.  Experimental data implicate Rab4 in regulation of the recycling of internalized receptors back to the plasma membrane.  It is also believed to influence receptor-mediated antigen processing in B-lymphocytes, in calcium-dependent exocytosis in platelets, in alpha-amylase secretion in pancreatic cells, and in insulin-induced translocation of Glut4 from internal vesicles to the cell surface. Rab4 is known to share effector proteins with Rab5 and Rab11.  GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to p
Probab=99.40  E-value=1.4e-11  Score=97.31  Aligned_cols=155  Identities=25%  Similarity=0.290  Sum_probs=99.8

Q ss_pred             EEEECCCCCCHHHHHHHHHHHCCCCCCCCCCCEEECCCHHHHHHCCEEEEEEEEEEEECCCCCEEEEEEEECCCCCHHHH
Q ss_conf             99980138987788999999829805444431130586779871950523279999743788438999961787300279
Q gi|254780321|r   14 FSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVRLNYTSTDAKDYQLNLIDTPGHVDFTY   93 (606)
Q Consensus        14 ~~IiaHvDhGKTTL~d~lL~~tg~i~~~~~~~~vlD~~~~EreRGITIka~~~~~~~~~~~~~~y~iNlIDTPGH~DF~~   93 (606)
                      ++++|....|||+|.-|++  .+.+.... ..++          |+....+.+.     .+++.+.++|.||+|...|..
T Consensus         3 ivl~Gd~~vGKTsli~r~~--~~~f~~~~-~~Ti----------g~~~~~k~~~-----~~~~~~~l~iwDtaG~e~~~~   64 (161)
T cd04113           3 FIIIGSSGTGKSCLLHRFV--ENKFKEDS-QHTI----------GVEFGSKIIR-----VGGKRVKLQIWDTAGQERFRS   64 (161)
T ss_pred             EEEECCCCCCHHHHHHHHH--HCCCCCCC-CCCC----------CEEEEEEEEE-----ECCEEEEEEEEECCCCHHHHH
T ss_conf             9999949967999999997--29899987-9976----------4578999999-----999999999998999701226


Q ss_pred             HHHHHHHHCCEEEEEEECCCCCCHHHHHHHHH-HHH---CCCCEEEEECCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHH
Q ss_conf             99999973026899998687886558999999-997---09967998326788753211338887755532232100011
Q gi|254780321|r   94 EVSRSLSACEGSLLVVDATQGVEAQTLANVYQ-AID---NNHEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVS  169 (606)
Q Consensus        94 EV~r~l~a~dgaiLvVdA~~Gvq~QT~~~~~~-A~~---~~l~~I~viNKiD~~~A~~e~v~~ei~~~~g~~~~~ii~vS  169 (606)
                      -....++-++++|||.|.++----+....|.. ...   .++++++|-||+|+..-+. --.+|.+++..-..-..+.+|
T Consensus        65 ~~~~~~~~a~~~ilvydit~~~Sf~~~~~w~~~i~~~~~~~~~iilVgNK~Dl~~~r~-V~~~e~~~~a~~~~~~~~E~S  143 (161)
T cd04113          65 VTRSYYRGAAGALLVYDITNRTSFEALPTWLSDARALASPNIVVILVGNKSDLADQRE-VTFLEASRFAQENGLLFLETS  143 (161)
T ss_pred             HHHHHHHCCCEEEEECCCCCHHHHHHHHHHHHHHHHHCCCCCEEEEECCCCCCHHCCC-CCHHHHHHHHHHCCCEEEEEC
T ss_conf             7899840577789953689889999999999999986799964986034344000378-899999999998599799974


Q ss_pred             HHCCCCCCHHHHHHHHHH
Q ss_conf             100223200678776321
Q gi|254780321|r  170 AKTGEGIPLLLERIVQQL  187 (606)
Q Consensus       170 AktG~GV~~LLd~Iv~~i  187 (606)
                      ||+|.||+++++.++..+
T Consensus       144 Ak~~~nV~e~F~~la~~i  161 (161)
T cd04113         144 ALTGENVEEAFLKCARSI  161 (161)
T ss_pred             CCCCCCHHHHHHHHHHHC
T ss_conf             156905899999999709


No 167
>cd04110 Rab35 Rab35 subfamily.  Rab35 is one of several Rab proteins to be found to participate in the regulation of osteoclast cells in rats. In addition, Rab35 has been identified as a protein that interacts with nucleophosmin-anaplastic lymphoma kinase (NPM-ALK) in human cells.  Overexpression of NPM-ALK is a key oncogenic event in some anaplastic large-cell lymphomas; since Rab35 interacts with N|PM-ALK, it may provide a target for cancer treatments. GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state.  Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilitate Rab recycling by masking C-terminal lipid binding and promoting cytosolic localization.  Most Rab GTPases contain a lipid modification site at the C-terminus, with sequence motifs CC, CXC, or CCX. Lipid binding is 
Probab=99.40  E-value=9.4e-12  Score=98.38  Aligned_cols=161  Identities=21%  Similarity=0.248  Sum_probs=106.0

Q ss_pred             HHCEEEEEECCCCCCHHHHHHHHHHHCCCCCCCCCCCEEECCCHHHHHHCCEEEEEEEEEEEECCCCCEEEEEEEECCCC
Q ss_conf             25317999801389877889999998298054444311305867798719505232799997437884389999617873
Q gi|254780321|r    9 SRIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVRLNYTSTDAKDYQLNLIDTPGH   88 (606)
Q Consensus         9 ~~IRN~~IiaHvDhGKTTL~d~lL~~tg~i~~~~~~~~vlD~~~~EreRGITIka~~~~~~~~~~~~~~y~iNlIDTPGH   88 (606)
                      +.+=-+.++|-..-|||+|.-|++  .+.+..... .+          -|+....+.+.     .+++.+.++|.||+|.
T Consensus         4 d~~~KIvlvGd~~VGKTSli~r~~--~~~F~~~~~-~T----------ig~d~~~k~v~-----i~~~~v~l~iwDtaGq   65 (199)
T cd04110           4 DHLFKLLIIGDSGVGKSSLLLRFA--DNTFSGSYI-TT----------IGVDFKIRTVE-----INGERVKLQIWDTAGQ   65 (199)
T ss_pred             CEEEEEEEECCCCCCHHHHHHHHH--CCCCCCCCC-CC----------CCEEEEEEEEE-----ECCEEEEEEEEECCCC
T ss_conf             757799999979988899999995--099999868-97----------55587899999-----9999999999989998


Q ss_pred             CHHHHHHHHHHHHCCEEEEEEECCCCCCHHHHHHHHHHHH---CCCCEEEEECCCCCCCCCCCCHHHHHHHHHHHHHHHH
Q ss_conf             0027999999973026899998687886558999999997---0996799832678875321133888775553223210
Q gi|254780321|r   89 VDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQAID---NNHEIITVLNKADLPSADPDRVKKQIEETIGISTEDA  165 (606)
Q Consensus        89 ~DF~~EV~r~l~a~dgaiLvVdA~~Gvq~QT~~~~~~A~~---~~l~~I~viNKiD~~~A~~e~v~~ei~~~~g~~~~~i  165 (606)
                      ..|..-....++-++++|||.|.+.----+-...|..-+.   ..+++|+|-||+|++.-+.-. .++.+++..-..-..
T Consensus        66 e~~~~l~~~~~~~a~~~ilvyDit~~~Sf~~l~~w~~~i~~~~~~~~~ilVGNK~Dl~~~r~v~-~~e~~~~a~~~~~~f  144 (199)
T cd04110          66 ERFRTITSTYYRGTHGVIVVYDVTNGESFVNVKRWLQEIEQNCDDVCKVLVGNKNDDPERKVVE-TEDAYKFAGQMGISL  144 (199)
T ss_pred             CCCCCCHHHHHHCCCCCEEEEECCCHHHHHHHHHHHHHHHHHCCCCCEEEEEECCCHHHHCCCC-HHHHHHHHHHCCCEE
T ss_conf             1235352666424654238971798899999999999999759987579998855447546999-999999999869979


Q ss_pred             HHHHHHCCCCCCHHHHHHHHHHH
Q ss_conf             00111002232006787763210
Q gi|254780321|r  166 LLVSAKTGEGIPLLLERIVQQLP  188 (606)
Q Consensus       166 i~vSAktG~GV~~LLd~Iv~~iP  188 (606)
                      +.+|||+|.||+++++.|++.+-
T Consensus       145 ~E~SAktg~nV~e~F~~i~~~i~  167 (199)
T cd04110         145 FETSAKENINVEEMFNCITELVL  167 (199)
T ss_pred             EEEECCCCCCHHHHHHHHHHHHH
T ss_conf             99868999298999999999999


No 168
>cd04147 Ras_dva Ras-dva subfamily.  Ras-dva (Ras - dorsal-ventral anterior localization) subfamily consists of a set of proteins characterized only in Xenopus leavis, to date.  In Xenopus Ras-dva expression is activated by the transcription factor Otx2 and begins during gastrulation throughout the anterior ectoderm.  Ras-dva expression is inhibited in the anterior neural plate by factor Xanf1.  Downregulation of Ras-dva results in head development abnormalities through the inhibition of several regulators of the anterior neural plate and folds patterning, including Otx2, BF-1, Xag2, Pax6, Slug, and Sox9.  Downregulation of Ras-dva also interferes with the FGF-8a signaling within the anterior ectoderm.  Most Ras proteins contain a lipid modification site at the C-terminus, with a typical sequence motif CaaX, where a = an aliphatic amino acid and X = any amino acid.  Lipid binding is essential for membrane attachment, a key feature of most Ras proteins.
Probab=99.39  E-value=1.3e-11  Score=97.45  Aligned_cols=158  Identities=19%  Similarity=0.262  Sum_probs=102.0

Q ss_pred             EEEECCCCCCHHHHHHHHHHHCCCCCCCCCCCEEECCCHHHHHHCCEEEEEEEEEEEECCCCCEEEEEEEECCCCCHHHH
Q ss_conf             99980138987788999999829805444431130586779871950523279999743788438999961787300279
Q gi|254780321|r   14 FSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVRLNYTSTDAKDYQLNLIDTPGHVDFTY   93 (606)
Q Consensus        14 ~~IiaHvDhGKTTL~d~lL~~tg~i~~~~~~~~vlD~~~~EreRGITIka~~~~~~~~~~~~~~y~iNlIDTPGH~DF~~   93 (606)
                      ++++|...-|||+|+-|++  .+.+...- ..++      +     ....+  .+   ..+++.+.++|.||+|...|..
T Consensus         2 IvvlGd~~VGKTSLi~rf~--~~~F~~~y-~~Ti------~-----~~~~k--~~---~v~~~~v~l~i~DtaG~e~~~~   62 (198)
T cd04147           2 LVFMGAAGVGKTALIQRFL--YDTFEPKY-RRTV------E-----EMHRK--EY---EVGGVSLTLDILDTSGSYSFPA   62 (198)
T ss_pred             EEEECCCCCCHHHHHHHHH--HCCCCCCC-CCCH------H-----HEEEE--EE---EECCEEEEEEEEECCCCCCCHH
T ss_conf             8999989977999999998--59899888-8872------5-----41889--99---9899799999997877513014


Q ss_pred             HHHHHHHHCCEEEEEEECCCCCCHHHHHHHHHHH-H----CCCCEEEEECCCCCCCCCCCCHHHHHHHHHHHH-HHHHHH
Q ss_conf             9999997302689999868788655899999999-7----099679983267887532113388877555322-321000
Q gi|254780321|r   94 EVSRSLSACEGSLLVVDATQGVEAQTLANVYQAI-D----NNHEIITVLNKADLPSADPDRVKKQIEETIGIS-TEDALL  167 (606)
Q Consensus        94 EV~r~l~a~dgaiLvVdA~~Gvq~QT~~~~~~A~-~----~~l~~I~viNKiD~~~A~~e~v~~ei~~~~g~~-~~~ii~  167 (606)
                      -....++-+|++|||-|-++=--=+....|+.-+ +    ..+|+|+|-||+|+..-.-.--.+|.+++.... .-..+.
T Consensus        63 l~~~~~r~a~~~ilVyDit~~~Sf~~l~~w~~~i~~~~~~~~ipiilVGNK~Dll~~~R~V~~~e~~~~a~~~~~~~f~E  142 (198)
T cd04147          63 MRKLSIQNSDAFALVYAVDDPESFEEVERLREEILEVKEDKFVPIVVVGNKADSLEEERQVPAKDALSTVELDWNCGFVE  142 (198)
T ss_pred             HHHHHCCCCCEEEEEEECCCHHHHHHHHHHHHHHHHHCCCCCCCEEEEEECCCCCCCCCCCCHHHHHHHHHHCCCCEEEE
T ss_conf             55554158866899961697799999999999999962888982899987876501047848999999998559978998


Q ss_pred             HHHHCCCCCCHHHHHHHHHHHCC
Q ss_conf             11100223200678776321000
Q gi|254780321|r  168 VSAKTGEGIPLLLERIVQQLPSP  190 (606)
Q Consensus       168 vSAktG~GV~~LLd~Iv~~iP~P  190 (606)
                      +||++|.||+++++.++..+--|
T Consensus       143 tSAktg~nV~e~F~~l~r~i~~~  165 (198)
T cd04147         143 TSAKDNENVLEVFKELLRQANLP  165 (198)
T ss_pred             CCCCCCCCHHHHHHHHHHHHCCH
T ss_conf             77999949899999999997735


No 169
>cd04127 Rab27A Rab27a subfamily.  The Rab27a subfamily consists of Rab27a and its highly homologous isoform, Rab27b.  Unlike most Rab proteins whose functions remain poorly defined, Rab27a has many known functions.  Rab27a has multiple effector proteins, and depending on which effector it binds, Rab27a has different functions as well as tissue distribution and/or cellular localization. Putative functions have been assigned to Rab27a when associated with the effector proteins Slp1, Slp2, Slp3, Slp4, Slp5, DmSlp, rabphilin, Dm/Ce-rabphilin, Slac2-a, Slac2-b, Slac2-c, Noc2, JFC1, and Munc13-4. Rab27a has been associated with several human diseases, including hemophagocytic syndrome (Griscelli syndrome or GS), Hermansky-Pudlak syndrome, and choroidermia. In the case of GS, a rare, autosomal recessive disease, a Rab27a mutation is directly responsible for the disorder.  When Rab27a is localized to the secretory granules of pancreatic beta cells, it is believed to mediate glucose-stimulated 
Probab=99.39  E-value=2.5e-11  Score=95.55  Aligned_cols=162  Identities=21%  Similarity=0.257  Sum_probs=100.2

Q ss_pred             EEEEEECCCCCCHHHHHHHHHHHCCCCCCCCCCCEEECCCHHHHHHCCEEEEEEEEEEEEC-----CCCCEEEEEEEECC
Q ss_conf             1799980138987788999999829805444431130586779871950523279999743-----78843899996178
Q gi|254780321|r   12 RNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVRLNYTS-----TDAKDYQLNLIDTP   86 (606)
Q Consensus        12 RN~~IiaHvDhGKTTL~d~lL~~tg~i~~~~~~~~vlD~~~~EreRGITIka~~~~~~~~~-----~~~~~y~iNlIDTP   86 (606)
                      =-++++|..+-|||+|.-|++  .|.+...- ..++          |+....+.+......     ..++...++|.||+
T Consensus         5 ~KivvvGd~~VGKTsli~r~~--~~~f~~~y-~~Ti----------g~~~~~k~i~~~~~~~~~~~~~~~~v~l~iwDta   71 (180)
T cd04127           5 IKFLALGDSGVGKTSFLYQYT--DNKFNPKF-ITTV----------GIDFREKRVVYNSSGPGGTLGRGQRIHLQLWDTA   71 (180)
T ss_pred             EEEEEECCCCCCHHHHHHHHH--CCCCCCCC-CCCC----------CEEEEEEEEEECCCCCCCCCCCCCEEEEEEEECC
T ss_conf             899999999988899999996--19589986-8843----------2268899999847655444578858999999898


Q ss_pred             CCCHHHHHHHHHHHHCCEEEEEEECCCCCCHHHHHHHHHHH-H----CCCCEEEEECCCCCCCCCCCCHHHHHHHHHHHH
Q ss_conf             73002799999997302689999868788655899999999-7----099679983267887532113388877555322
Q gi|254780321|r   87 GHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQAI-D----NNHEIITVLNKADLPSADPDRVKKQIEETIGIS  161 (606)
Q Consensus        87 GH~DF~~EV~r~l~a~dgaiLvVdA~~Gvq~QT~~~~~~A~-~----~~l~~I~viNKiD~~~A~~e~v~~ei~~~~g~~  161 (606)
                      |+..|..-....++-++|+|||.|.++---=+-...|..-+ .    .+.++++|-||+|+++-+. --.++.+++..--
T Consensus        72 Gqe~~~~l~~~~~~~a~~~ilvydit~~~Sf~~l~~w~~~i~~~~~~~~~~iilVGNK~DL~~~r~-V~~~e~~~~a~~~  150 (180)
T cd04127          72 GQERFRSLTTAFFRDAMGFLLIFDLTNEQSFLNVRNWMSQLQTHAYCENPDIVLCGNKADLEDQRQ-VSEEQAKALADKY  150 (180)
T ss_pred             CCHHHHHHHHHHHHHHCEEEEEEECCCHHHHHHHHHHHHHHHHHCCCCCCCEEEECCCCCHHHCCC-CCHHHHHHHHHHC
T ss_conf             863047888999875436589996898899998999999999854668985787503236675088-8999999999984


Q ss_pred             HHHHHHHHHHCCCCCCHHHHHHHHHH
Q ss_conf             32100011100223200678776321
Q gi|254780321|r  162 TEDALLVSAKTGEGIPLLLERIVQQL  187 (606)
Q Consensus       162 ~~~ii~vSAktG~GV~~LLd~Iv~~i  187 (606)
                      .-..+.+|||+|.||+++++.+++.+
T Consensus       151 ~~~~~E~SAk~g~nV~e~F~~l~~~i  176 (180)
T cd04127         151 GIPYFETSAATGTNVEKAVERLLDLV  176 (180)
T ss_pred             CCEEEEECCCCCCCHHHHHHHHHHHH
T ss_conf             99799980377919899999999999


No 170
>cd04119 RJL RJL (RabJ-Like) subfamily.  RJLs are found in many protists and as chimeras with C-terminal DNAJ domains in deuterostome metazoa. They are not found in plants, fungi, and protostome metazoa, suggesting a horizontal gene transfer between protists and deuterostome metazoa.  RJLs lack any known membrane targeting signal and contain a degenerate phosphate/magnesium-binding 3 (PM3) motif, suggesting an impaired ability to hydrolyze GTP.  GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state.  Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilitate Rab recycling by masking C-terminal lipid binding and promoting cytosolic localization.
Probab=99.39  E-value=3.4e-11  Score=94.65  Aligned_cols=153  Identities=20%  Similarity=0.311  Sum_probs=101.0

Q ss_pred             EEEECCCCCCHHHHHHHHHHHCCCCCCCCCCCEEECCCHHHHHHCCEEEEEEEEEEEECCCCCEEEEEEEECCCCCHHHH
Q ss_conf             99980138987788999999829805444431130586779871950523279999743788438999961787300279
Q gi|254780321|r   14 FSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVRLNYTSTDAKDYQLNLIDTPGHVDFTY   93 (606)
Q Consensus        14 ~~IiaHvDhGKTTL~d~lL~~tg~i~~~~~~~~vlD~~~~EreRGITIka~~~~~~~~~~~~~~y~iNlIDTPGH~DF~~   93 (606)
                      ++++|-...|||+|..|++  .|.....-.. +          -|+....+  ++.+   ++..+.++|.||+|+.+|..
T Consensus         3 ivvvG~~~vGKTSLi~r~~--~~~f~~~y~p-T----------ig~~~~~k--~~~~---~~~~~~l~iwDt~G~~~~~~   64 (168)
T cd04119           3 VISMGNSGVGKSCIIKRYC--EGRFVSKYLP-T----------IGIDYGVK--KVSV---RNKEVRVNFFDLSGHPEYLE   64 (168)
T ss_pred             EEEECCCCCCHHHHHHHHH--HCCCCCCCCC-C----------CCEEEEEE--EEEE---CCEEEEEEEEECCCCHHHHH
T ss_conf             9999959956899999996--3999998589-7----------65577799--9999---99999999998999764789


Q ss_pred             HHHHHHHHCCEEEEEEECCCCCCHHHHHHHHHHHH---------CCCCEEEEECCCCCCCCCCCCH--HHHHHHHHHHHH
Q ss_conf             99999973026899998687886558999999997---------0996799832678875321133--888775553223
Q gi|254780321|r   94 EVSRSLSACEGSLLVVDATQGVEAQTLANVYQAID---------NNHEIITVLNKADLPSADPDRV--KKQIEETIGIST  162 (606)
Q Consensus        94 EV~r~l~a~dgaiLvVdA~~Gvq~QT~~~~~~A~~---------~~l~~I~viNKiD~~~A~~e~v--~~ei~~~~g~~~  162 (606)
                      -....++-+|++|||-|.++----+....|+.-..         ...++++|=||+|++..+.-..  .++.....++  
T Consensus        65 ~~~~~~~~ad~~ilvydit~~~Sf~~l~~w~~~~~~~~~~~~~~~~~~~ilvgnK~Dl~~~r~v~~~~~~~~a~~~~~--  142 (168)
T cd04119          65 VRNEFYKDTQGVLLVYDVTDRQSFEALDSWLKEMKQEGGPHGNMENIVVVVCANKIDLTKHRAVSEDEGRLWAESKGF--  142 (168)
T ss_pred             HHHHHHHHCCEEEEEECCCCHHHHHHHHHHHHHHHHHHCCCCCCCCCEEEEEEEECCCCCCCCCCHHHHHHHHHHCCC--
T ss_conf             999998747788999508974448999999999999824534566862999854034442578899999999998699--


Q ss_pred             HHHHHHHHHCCCCCCHHHHHHHHHH
Q ss_conf             2100011100223200678776321
Q gi|254780321|r  163 EDALLVSAKTGEGIPLLLERIVQQL  187 (606)
Q Consensus       163 ~~ii~vSAktG~GV~~LLd~Iv~~i  187 (606)
                       ..+.+|||+|.||+++++.|+..+
T Consensus       143 -~~~E~Sak~g~~V~e~F~~l~~~i  166 (168)
T cd04119         143 -KYFETSACTGEGVNEMFQTLFSSI  166 (168)
T ss_pred             -EEEEECCCCCCCHHHHHHHHHHHH
T ss_conf             -899988577908899999999997


No 171
>cd04120 Rab12 Rab12 subfamily.  Rab12 was first identified in canine cells, where it was localized to the Golgi complex.  The specific function of Rab12 remains unknown, and inconsistent results about its cellular localization have been reported.  More recent studies have identified Rab12 associated with post-Golgi vesicles, or with other small vesicle-like structures but not with the Golgi complex.  Most Rab GTPases contain a lipid modification site at the C-terminus, with sequence motifs CC, CXC, or CCX. Lipid binding is essential for membrane attachment, a key feature of most Rab proteins. GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state.  Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilitate Rab recycling by masking C-terminal lipid binding and promoting cytosolic
Probab=99.39  E-value=1.7e-11  Score=96.66  Aligned_cols=155  Identities=25%  Similarity=0.296  Sum_probs=103.2

Q ss_pred             EEEECCCCCCHHHHHHHHHHHCCCCCCCCCCCEEECCCHHHHHHCCEEEEEEEEEEEECCCCCEEEEEEEECCCCCHHHH
Q ss_conf             99980138987788999999829805444431130586779871950523279999743788438999961787300279
Q gi|254780321|r   14 FSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVRLNYTSTDAKDYQLNLIDTPGHVDFTY   93 (606)
Q Consensus        14 ~~IiaHvDhGKTTL~d~lL~~tg~i~~~~~~~~vlD~~~~EreRGITIka~~~~~~~~~~~~~~y~iNlIDTPGH~DF~~   93 (606)
                      +.++|-.+-|||+|+.|+.  .+.+.+... .+          -|+....+.+.     .+++.++++|.||+|+..|..
T Consensus         3 IvllGd~gVGKTsLi~rf~--~~~F~~~y~-~T----------ig~d~~~k~i~-----~~~~~v~l~IWDTaGqe~f~s   64 (202)
T cd04120           3 VIIIGSRGVGKTSLMRRFT--DDTFCEACK-SG----------VGVDFKIKTVE-----LRGKKIRLQIWDTAGQERFNS   64 (202)
T ss_pred             EEEECCCCCCHHHHHHHHH--CCCCCCCCC-CC----------CCEEEEEEEEE-----ECCEEEEEEEEECCCCCCCCC
T ss_conf             9999979972999999995--499999879-97----------64688999999-----999999999997988612452


Q ss_pred             HHHHHHHHCCEEEEEEECCCCCCHHHHHHHHHHHH----CCCCEEEEECCCCCCCCCCCCHHHHHHHHHH-HHHHHHHHH
Q ss_conf             99999973026899998687886558999999997----0996799832678875321133888775553-223210001
Q gi|254780321|r   94 EVSRSLSACEGSLLVVDATQGVEAQTLANVYQAID----NNHEIITVLNKADLPSADPDRVKKQIEETIG-ISTEDALLV  168 (606)
Q Consensus        94 EV~r~l~a~dgaiLvVdA~~Gvq~QT~~~~~~A~~----~~l~~I~viNKiD~~~A~~e~v~~ei~~~~g-~~~~~ii~v  168 (606)
                      -....++-++|+|||.|-+.----+....|+.-++    .+.++|+|=||+|+.+.+ +--.+|.+++-. +..-..+.+
T Consensus        65 l~~~yyr~a~~~ilVyDit~~~SF~~l~~W~~~i~~~~~~~~~iiLVGNK~DL~~~R-~Vs~~e~~~~A~~~~~~~f~Et  143 (202)
T cd04120          65 ITSAYYRSAKGIILVYDITKKETFDDLPKWMKMIDKYASEDAELLLVGNKLDCETDR-EISRQQGEKFAQQITGMRFCEA  143 (202)
T ss_pred             CHHHHHHHHCEEEEEEECCCHHHHHHHHHHHHHHHHHCCCCCEEEEEEECCCCHHHC-CCCHHHHHHHHHHCCCCEEEEC
T ss_conf             357887641445899856888999999999999997466887189876536505317-8799999999982799889992


Q ss_pred             HHHCCCCCCHHHHHHHHHH
Q ss_conf             1100223200678776321
Q gi|254780321|r  169 SAKTGEGIPLLLERIVQQL  187 (606)
Q Consensus       169 SAktG~GV~~LLd~Iv~~i  187 (606)
                      |||+|.||+++++.+++.+
T Consensus       144 SAkt~~nV~e~F~~l~~~i  162 (202)
T cd04120         144 SAKDNFNVDEIFLKLVDDI  162 (202)
T ss_pred             CCCCCCCHHHHHHHHHHHH
T ss_conf             5899969899999999999


No 172
>cd00877 Ran Ran (Ras-related nuclear proteins) /TC4 subfamily of small GTPases. Ran GTPase is involved in diverse biological functions, such as nuclear transport, spindle formation during mitosis, DNA replication, and cell division.  Among the Ras superfamily, Ran is a unique small G protein.  It does not have a lipid modification motif at the C-terminus to bind to the membrane, which is often observed within the Ras superfamily.  Ran may therefore interact with a wide range of proteins in various intracellular locations.  Like other GTPases, Ran exists in GTP- and GDP-bound conformations that interact differently with effectors.  Conversion between these forms and the assembly or disassembly of effector complexes requires the interaction of regulator proteins.  The intrinsic GTPase activity of Ran is very low, but it is greatly stimulated by a GTPase-activating protein (RanGAP1) located in the cytoplasm. By contrast, RCC1, a guanine nucleotide exchange factor that generates RanGTP, is
Probab=99.39  E-value=2.2e-11  Score=95.96  Aligned_cols=155  Identities=17%  Similarity=0.210  Sum_probs=102.9

Q ss_pred             EEEECCCCCCHHHHHHHHHHHCCCCCCCCCCCEEECCCHHHHHHCCEEEEEEEEEEEECCCCCEEEEEEEECCCCCHHHH
Q ss_conf             99980138987788999999829805444431130586779871950523279999743788438999961787300279
Q gi|254780321|r   14 FSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVRLNYTSTDAKDYQLNLIDTPGHVDFTY   93 (606)
Q Consensus        14 ~~IiaHvDhGKTTL~d~lL~~tg~i~~~~~~~~vlD~~~~EreRGITIka~~~~~~~~~~~~~~y~iNlIDTPGH~DF~~   93 (606)
                      ++++|-.+-|||+|.-|++  .|.+.+.. ..++          |+....  ..+.   .+++.+.++|.||+|+..|..
T Consensus         3 ivlvGd~~VGKTsli~r~~--~~~f~~~~-~~Ti----------g~~~~~--~~~~---~~~~~v~l~iwDtaGqe~~~~   64 (166)
T cd00877           3 LVLVGDGGTGKTTFVKRHL--TGEFEKKY-VATL----------GVEVHP--LDFH---TNRGKIRFNVWDTAGQEKFGG   64 (166)
T ss_pred             EEEECCCCCCHHHHHHHHH--HCCCCCCC-CCCC----------CEEEEE--EEEE---ECCEEEEEEEEECCCCHHHHH
T ss_conf             9999999988899999998--39999986-8732----------556799--9999---999799999997578715666


Q ss_pred             HHHHHHHHCCEEEEEEECCCCCCHHHHHHHHHHH---HCCCCEEEEECCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             9999997302689999868788655899999999---7099679983267887532113388877555322321000111
Q gi|254780321|r   94 EVSRSLSACEGSLLVVDATQGVEAQTLANVYQAI---DNNHEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSA  170 (606)
Q Consensus        94 EV~r~l~a~dgaiLvVdA~~Gvq~QT~~~~~~A~---~~~l~~I~viNKiD~~~A~~e~v~~ei~~~~g~~~~~ii~vSA  170 (606)
                      -....++-++|+|||.|.++=--=+....|+.-+   ..++|+|+|-||+|+.....   ..+..+...-..-..+.+||
T Consensus        65 l~~~y~~~a~~~ilvyDvt~~~Sf~~v~~w~~~i~~~~~~~piilVgNK~Dl~~~~~---~~~~~~~~~~~~~~~~EtSA  141 (166)
T cd00877          65 LRDGYYIGGQCAIIMFDVTSRVTYKNVPNWHRDLVRVCGNIPIVLCGNKVDIKDRKV---KAKQITFHRKKNLQYYEISA  141 (166)
T ss_pred             HHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHHHHCCCCCEEEEEECCCCCCCCC---CHHHHHHHHHCCCEEEEECC
T ss_conf             878874006579984378988899999999999998689998999998621750366---79999999978998999845


Q ss_pred             HCCCCCCHHHHHHHHHHHC
Q ss_conf             0022320067877632100
Q gi|254780321|r  171 KTGEGIPLLLERIVQQLPS  189 (606)
Q Consensus       171 ktG~GV~~LLd~Iv~~iP~  189 (606)
                      |+|.||+++++.|+..+..
T Consensus       142 k~~~nV~e~F~~la~~il~  160 (166)
T cd00877         142 KSNYNFEKPFLWLARKLLG  160 (166)
T ss_pred             CCCCCHHHHHHHHHHHHHC
T ss_conf             8990989999999999842


No 173
>cd04107 Rab32_Rab38 Rab38/Rab32 subfamily.  Rab32 and Rab38 are members of the Rab family of small GTPases.  Human Rab32 was first identified in platelets but it is expressed in a variety of cell types, where it functions as an A-kinase anchoring protein (AKAP). Rab38 has been shown to be melanocyte-specific.  GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state.  Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilitate Rab recycling by masking C-terminal lipid binding and promoting cytosolic localization.  Most Rab GTPases contain a lipid modification site at the C-terminus, with sequence motifs CC, CXC, or CCX. Lipid binding is essential for membrane attachment, a key feature of most Rab proteins.
Probab=99.39  E-value=1.9e-11  Score=96.38  Aligned_cols=157  Identities=15%  Similarity=0.225  Sum_probs=101.6

Q ss_pred             EEEECCCCCCHHHHHHHHHHHCCCCCCCCCCCEEECCCHHHHHHCCEEEEEEEEEEEECCCCCEEEEEEEECCCCCHHHH
Q ss_conf             99980138987788999999829805444431130586779871950523279999743788438999961787300279
Q gi|254780321|r   14 FSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVRLNYTSTDAKDYQLNLIDTPGHVDFTY   93 (606)
Q Consensus        14 ~~IiaHvDhGKTTL~d~lL~~tg~i~~~~~~~~vlD~~~~EreRGITIka~~~~~~~~~~~~~~y~iNlIDTPGH~DF~~   93 (606)
                      +.++|-.+-|||+|.-|++  .+.+.+.- ..++          |+....+  .+.+  .+++.+.++|.||+|+.+|..
T Consensus         3 vvllGd~gVGKTsLi~rf~--~~~F~~~y-~~Ti----------g~df~~k--~i~~--~~~~~v~l~iwDtaGqe~~~~   65 (201)
T cd04107           3 VLVIGDLGVGKTSIIKRYV--HGIFSQHY-KATI----------GVDFALK--VIEW--DPNTVVRLQLWDIAGQERFGG   65 (201)
T ss_pred             EEEECCCCCCHHHHHHHHH--HCCCCCCC-CCCC----------CEEEEEE--EEEE--CCCEEEEEEEEECCCCCCCCC
T ss_conf             9999999978999999998--29999988-8875----------6778998--9996--798199999986899832220


Q ss_pred             HHHHHHHHCCEEEEEEECCCCCCHHHHHHHHHHH--------HCCCCEEEEECCCCCCCCCCCCHHHHHHHHHHH-HHHH
Q ss_conf             9999997302689999868788655899999999--------709967998326788753211338887755532-2321
Q gi|254780321|r   94 EVSRSLSACEGSLLVVDATQGVEAQTLANVYQAI--------DNNHEIITVLNKADLPSADPDRVKKQIEETIGI-STED  164 (606)
Q Consensus        94 EV~r~l~a~dgaiLvVdA~~Gvq~QT~~~~~~A~--------~~~l~~I~viNKiD~~~A~~e~v~~ei~~~~g~-~~~~  164 (606)
                      -....++-++|+|||.|.+.---=+....|+.-+        ...+|+|+|-||+|+...+. -..+++.++..- ....
T Consensus        66 l~~~y~~~a~~~ilvydvt~~~Sf~~l~~w~~~i~~~~~~~~~~~ipiilVgNK~DL~~~~~-v~~ee~~~~a~~~~~~~  144 (201)
T cd04107          66 MTRVYYRGAVGAIIVFDVTRPSTFEAVLKWKADLDSKVTLPNGEPIPCLLLANKCDLKKRLA-KDGEQMDQFCKENGFIG  144 (201)
T ss_pred             CHHHHCCCCCEEEEEEECCCHHHHHHHHHHHHHHHHHHHCCCCCCCCEEEEEECCCCCCCCC-CCHHHHHHHHHHCCCCE
T ss_conf             03755557764799982798899998999999999986213789871899866556411256-89999999999779980


Q ss_pred             HHHHHHHCCCCCCHHHHHHHHHHH
Q ss_conf             000111002232006787763210
Q gi|254780321|r  165 ALLVSAKTGEGIPLLLERIVQQLP  188 (606)
Q Consensus       165 ii~vSAktG~GV~~LLd~Iv~~iP  188 (606)
                      .+.+|||+|.||+++++.++..+-
T Consensus       145 ~~EtSAktg~nV~e~F~~l~~~i~  168 (201)
T cd04107         145 WFETSAKEGINIEEAMRFLVKNIL  168 (201)
T ss_pred             EEEECCCCCCCHHHHHHHHHHHHH
T ss_conf             999779999498999999999998


No 174
>cd04158 ARD1 ARD1 subfamily.  ARD1 (ADP-ribosylation factor domain protein 1) is an unusual member of the Arf family.  In addition to the C-terminal Arf domain, ARD1 has an additional 46-kDa N-terminal domain that contains a RING finger domain, two predicted B-Boxes, and a coiled-coil protein interaction motif.  This domain belongs to the TRIM (tripartite motif) or RBCC (RING, B-Box, coiled-coil) family.  Like most Arfs, the ARD1 Arf domain lacks detectable GTPase activity.  However, unlike most Arfs, the full-length ARD1 protein has significant GTPase activity due to the GAP (GTPase-activating protein) activity exhibited by the 46-kDa N-terminal domain.  The GAP domain of ARD1 is specific for its own Arf domain and does not bind other Arfs.  The rate of GDP dissociation from the ARD1 Arf domain is slowed by the adjacent 15 amino acids, which act as a GDI (GDP-dissociation inhibitor) domain.  ARD1 is ubiquitously expressed in cells and localizes to the Golgi and to the lysosomal membra
Probab=99.39  E-value=1.2e-11  Score=97.57  Aligned_cols=149  Identities=15%  Similarity=0.187  Sum_probs=101.1

Q ss_pred             EEEECCCCCCHHHHHHHHHHHCCCCCCCCCCCEEECCCHHHHHHCCEEEEEEEEEEEECCCCCEEEEEEEECCCCCHHHH
Q ss_conf             99980138987788999999829805444431130586779871950523279999743788438999961787300279
Q gi|254780321|r   14 FSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVRLNYTSTDAKDYQLNLIDTPGHVDFTY   93 (606)
Q Consensus        14 ~~IiaHvDhGKTTL~d~lL~~tg~i~~~~~~~~vlD~~~~EreRGITIka~~~~~~~~~~~~~~y~iNlIDTPGH~DF~~   93 (606)
                      +.++|--++||||+..+|.  .+.+...         .       -|+-.+...+.|     +++.+++.|+.|+.-|..
T Consensus         2 IlilGl~~sGKTtil~~l~--~~~~~~~---------~-------pT~G~~~~~i~~-----~~~~l~iwD~gG~~~~r~   58 (169)
T cd04158           2 VVTLGLDGAGKTTILFKLK--QDEFMQP---------I-------PTIGFNVETVEY-----KNLKFTIWDVGGKHKLRP   58 (169)
T ss_pred             EEEECCCCCCHHHHHHHHH--CCCCCCC---------C-------CCCCCCEEEEEE-----CCEEEEEEECCCCCCCCH
T ss_conf             9999989998899999995--7996897---------7-------868816699998-----988999998999724463


Q ss_pred             HHHHHHHHCCEEEEEEECCCCCCH-HHHHHHHHHH----HCCCCEEEEECCCCCCCCCCCCHHHHHHHHHHHHH------
Q ss_conf             999999730268999986878865-5899999999----70996799832678875321133888775553223------
Q gi|254780321|r   94 EVSRSLSACEGSLLVVDATQGVEA-QTLANVYQAI----DNNHEIITVLNKADLPSADPDRVKKQIEETIGIST------  162 (606)
Q Consensus        94 EV~r~l~a~dgaiLvVdA~~Gvq~-QT~~~~~~A~----~~~l~~I~viNKiD~~~A~~e~v~~ei~~~~g~~~------  162 (606)
                      -...-.+-|+|+|+|||+++--.- .-+..++..+    ..+.|++++.||.|+++|..   .+++.+.++++.      
T Consensus        59 ~w~~Yy~~~~~iIfVvDssd~~~~~ea~~~l~~ll~~~~~~~~piLIlaNK~Dl~~~~~---~~ei~~~l~l~~~~~~~~  135 (169)
T cd04158          59 LWKHYYLNTQAVVFVVDSSHRDRVSEAHSELAKLLTEKELRDALLLIFANKQDVAGALS---VEEMTELLSLHKLCCGRS  135 (169)
T ss_pred             HHHHHCCCCCEEEEEEECCHHHHHHHHHHHHHHHHHHHHHCCCEEEEEEECCCCCCCCC---HHHHHHHHCCHHHCCCCC
T ss_conf             67875557627999998630677999999999997127537984999973556777989---999999857054526996


Q ss_pred             HHHHHHHHHCCCCCCHHHHHHHHHHH
Q ss_conf             21000111002232006787763210
Q gi|254780321|r  163 EDALLVSAKTGEGIPLLLERIVQQLP  188 (606)
Q Consensus       163 ~~ii~vSAktG~GV~~LLd~Iv~~iP  188 (606)
                      -.+.+|||+||.||++.|+-+.+.+=
T Consensus       136 ~~i~~~SA~tG~Gi~e~~~WL~~~ii  161 (169)
T cd04158         136 WYIQGCDARSGMGLYEGLDWLSRQLV  161 (169)
T ss_pred             EEEEEEECCCCCCHHHHHHHHHHHHH
T ss_conf             29995557279598999999999998


No 175
>cd04108 Rab36_Rab34 Rab34/Rab36 subfamily.  Rab34, found primarily in the Golgi, interacts with its effector, Rab-interacting lysosomal protein (RILP). This enables its participation in microtubular dynenin-dynactin-mediated repositioning of lysosomes from the cell periphery to the Golgi. A Rab34 (Rah) isoform that lacks the consensus GTP-binding region has been identified in mice.  This isoform is associated with membrane ruffles and promotes macropinosome formation.  Rab36 has been mapped to human chromosome 22q11.2, a region that is homozygously deleted in malignant rhabdoid tumors (MRTs). However, experimental assessments do not implicate Rab36 as a tumor suppressor that would enable tumor formation through a loss-of-function mechanism.  GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state.  Rabs are further re
Probab=99.38  E-value=2.4e-11  Score=95.68  Aligned_cols=156  Identities=19%  Similarity=0.247  Sum_probs=99.7

Q ss_pred             EEEECCCCCCHHHHHHHHHHHCCCCCCCCCCCEEECCCHHHHHHCCEEEEEEEEEEEECCCCCEEEEEEEECCCCCHHHH
Q ss_conf             99980138987788999999829805444431130586779871950523279999743788438999961787300279
Q gi|254780321|r   14 FSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVRLNYTSTDAKDYQLNLIDTPGHVDFTY   93 (606)
Q Consensus        14 ~~IiaHvDhGKTTL~d~lL~~tg~i~~~~~~~~vlD~~~~EreRGITIka~~~~~~~~~~~~~~y~iNlIDTPGH~DF~~   93 (606)
                      +.++|...-|||+|.-|++  .+.+.+.- ..++          |+....+.+.     .+++++.++|.||+|+..|..
T Consensus         3 ivlvGd~~VGKTsli~r~~--~~~f~~~y-~~Ti----------g~d~~~k~~~-----v~~~~~~l~iwDtaGqe~f~~   64 (170)
T cd04108           3 VIVVGDLSVGKTCLINRFC--KDVFDKNY-KATI----------GVDFEMERFE-----ILGVPFSLQLWDTAGQERFKC   64 (170)
T ss_pred             EEEECCCCCCHHHHHHHHH--CCCCCCCC-CCCC----------CEEEEEEEEE-----ECCEEEEEEEEECCCCCCCCC
T ss_conf             9999989989899999996--39889972-5634----------5058999999-----999999999998999974664


Q ss_pred             HHHHHHHHCCEEEEEEECCCCCCHHHHHHHHH-HHHC-C---CCEEEEECCCCCCCCCCCCH-HHHHHHHHHHHHHHHHH
Q ss_conf             99999973026899998687886558999999-9970-9---96799832678875321133-88877555322321000
Q gi|254780321|r   94 EVSRSLSACEGSLLVVDATQGVEAQTLANVYQ-AIDN-N---HEIITVLNKADLPSADPDRV-KKQIEETIGISTEDALL  167 (606)
Q Consensus        94 EV~r~l~a~dgaiLvVdA~~Gvq~QT~~~~~~-A~~~-~---l~~I~viNKiD~~~A~~e~v-~~ei~~~~g~~~~~ii~  167 (606)
                      -....++-+|++|||.|.++=---+....|+. ++.. .   .++++|-||+|+.+.+...+ .++..++-.--.-..+.
T Consensus        65 l~~~y~r~a~~~ilvyDvt~~~Sf~~~~~w~~~~~~~~~~~~~~i~LvgNK~DL~~~~~~~~~~~~~~~~a~~~~~~~~E  144 (170)
T cd04108          65 IASTYYRGAQAIIIVFDLTDVASLEHTRQWLEDALKENDPSSVLLFLVGTKKDLSSPAQYALMEQDAIKLAAEMQAEYWS  144 (170)
T ss_pred             CHHHHHCCCCEEEEEEECCCHHHHHHHHHHHHHHHHHCCCCCCCEEEEEECCCCCCCCEEEEEHHHHHHHHHHCCCEEEE
T ss_conf             43777327875899997898789999999999999850899982999998413798755764489999999877987999


Q ss_pred             HHHHCCCCCCHHHHHHHHHH
Q ss_conf             11100223200678776321
Q gi|254780321|r  168 VSAKTGEGIPLLLERIVQQL  187 (606)
Q Consensus       168 vSAktG~GV~~LLd~Iv~~i  187 (606)
                      +|||+|.||+++++.|...+
T Consensus       145 ~SAk~g~nV~e~F~~ia~~~  164 (170)
T cd04108         145 VSALSGENVREFFFRVAALT  164 (170)
T ss_pred             ECCCCCCCHHHHHHHHHHHH
T ss_conf             85578818799999999999


No 176
>cd04175 Rap1 Rap1 subgroup.  The Rap1 subgroup is part of the Rap subfamily of the Ras family.  It can be further divided into the Rap1a and Rap1b isoforms.  In humans, Rap1a and Rap1b share 95% sequence homology, but are products of two different genes located on chromosomes 1 and 12, respectively.  Rap1a is sometimes called smg p21 or Krev1 in the older literature.  Rap1 proteins are believed to perform different cellular functions, depending on the isoform, its subcellular localization, and the effector proteins it binds.  For example, in rat salivary gland, neutrophils, and platelets, Rap1 localizes to secretory granules and is believed to regulate exocytosis or the formation of secretory granules.  Rap1 has also been shown to localize in the Golgi of rat fibroblasts, zymogen granules, plasma membrane, and the microsomal membrane of pancreatic acini, as well as in the endocytic compartment of skeletal muscle cells and fibroblasts.  High expression of Rap1 has been observed in the n
Probab=99.37  E-value=2.6e-11  Score=95.37  Aligned_cols=154  Identities=23%  Similarity=0.235  Sum_probs=101.6

Q ss_pred             EEEEECCCCCCHHHHHHHHHHHCCCCCCCCCCCEEECCCHHHHHHCCEEEEE-EEEEEEECCCCCEEEEEEEECCCCCHH
Q ss_conf             7999801389877889999998298054444311305867798719505232-799997437884389999617873002
Q gi|254780321|r   13 NFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQ-TVRLNYTSTDAKDYQLNLIDTPGHVDF   91 (606)
Q Consensus        13 N~~IiaHvDhGKTTL~d~lL~~tg~i~~~~~~~~vlD~~~~EreRGITIka~-~~~~~~~~~~~~~y~iNlIDTPGH~DF   91 (606)
                      -++++|...-|||+|.-|++  .|.+.+.- .              -||... ...+   ..+++.+.++|.||+|+..|
T Consensus         3 KIvllGd~~VGKTsli~r~~--~~~f~~~y-~--------------pTi~~~~~k~i---~~~~~~~~l~iwDtaG~e~~   62 (164)
T cd04175           3 KLVVLGSGGVGKSALTVQFV--QGIFVEKY-D--------------PTIEDSYRKQV---EVDGQQCMLEILDTAGTEQF   62 (164)
T ss_pred             EEEEECCCCCCHHHHHHHHH--HCCCCCCC-C--------------CCEEEEEEEEE---EECCEEEEEEECCCCCCHHH
T ss_conf             99998999975999999997--09288656-8--------------84046899999---99999999985147754324


Q ss_pred             HHHHHHHHHHCCEEEEEEECCCCCCHHHHHHHHHHH-H----CCCCEEEEECCCCCCCCCCCCHHHHHHHHHHHHHHHHH
Q ss_conf             799999997302689999868788655899999999-7----09967998326788753211338887755532232100
Q gi|254780321|r   92 TYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQAI-D----NNHEIITVLNKADLPSADPDRVKKQIEETIGISTEDAL  166 (606)
Q Consensus        92 ~~EV~r~l~a~dgaiLvVdA~~Gvq~QT~~~~~~A~-~----~~l~~I~viNKiD~~~A~~e~v~~ei~~~~g~~~~~ii  166 (606)
                      ..-....++-+||+|||-|.+.---=+....|+.-. .    .++|+|+|-||+|+...+.- ..++.+++-.--.-..+
T Consensus        63 ~~l~~~y~~~a~~~ilvydvt~~~Sf~~~~~~~~~i~~~~~~~~~piilvgNK~DL~~~r~V-~~~~~~~~a~~~~~~~~  141 (164)
T cd04175          63 TAMRDLYMKNGQGFVLVYSITAQSTFNDLQDLREQILRVKDTEDVPMILVGNKCDLEDERVV-GKEQGQNLARQWGCAFL  141 (164)
T ss_pred             HHHHHHHHCCCCEEEEEEECCCHHHHHHHHHHHHHHHHHCCCCCCEEEEEECCCCCHHCCCC-CHHHHHHHHHHCCCEEE
T ss_conf             56788873578689999607877789999999999998628999639985214572220689-99999999998599999


Q ss_pred             HHHHHCCCCCCHHHHHHHHHH
Q ss_conf             011100223200678776321
Q gi|254780321|r  167 LVSAKTGEGIPLLLERIVQQL  187 (606)
Q Consensus       167 ~vSAktG~GV~~LLd~Iv~~i  187 (606)
                      .+|||+|.||+++++.++..+
T Consensus       142 E~SAk~~~nV~~~F~~l~~~i  162 (164)
T cd04175         142 ETSAKAKINVNEIFYDLVRQI  162 (164)
T ss_pred             EECCCCCCCHHHHHHHHHHHH
T ss_conf             966898817899999999986


No 177
>cd01862 Rab7 Rab7 subfamily.  Rab7 is a small Rab GTPase that regulates vesicular traffic from early to late endosomal stages of the endocytic pathway.  The yeast Ypt7 and mammalian Rab7 are both involved in transport to the vacuole/lysosome, whereas Ypt7 is also required for homotypic vacuole fusion.  Mammalian Rab7 is an essential participant in the autophagic pathway for sequestration and targeting of cytoplasmic components to the lytic compartment. Mammalian Rab7 is also proposed to function as a tumor suppressor. GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state.  Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilitate Rab recycling by masking C-terminal lipid binding and promoting cytosolic localization.  Most Rab GTPases contain a lipid modification site at the C-
Probab=99.37  E-value=3.9e-11  Score=94.25  Aligned_cols=155  Identities=19%  Similarity=0.241  Sum_probs=98.8

Q ss_pred             EEEECCCCCCHHHHHHHHHHHCCCCCCCCCCCEEECCCHHHHHHCCEEEEEEEEEEEECCCCCEEEEEEEECCCCCHHHH
Q ss_conf             99980138987788999999829805444431130586779871950523279999743788438999961787300279
Q gi|254780321|r   14 FSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVRLNYTSTDAKDYQLNLIDTPGHVDFTY   93 (606)
Q Consensus        14 ~~IiaHvDhGKTTL~d~lL~~tg~i~~~~~~~~vlD~~~~EreRGITIka~~~~~~~~~~~~~~y~iNlIDTPGH~DF~~   93 (606)
                      ++++|..+.|||+|.-|++  .+.+.+.- ..++          |.....+.+     ..+++.+.++|.||+|+..|..
T Consensus         3 ivlvGd~~VGKTsli~r~~--~~~f~~~y-~~Ti----------g~d~~~k~i-----~~~~~~~~l~iwDtaG~e~~~~   64 (172)
T cd01862           3 VIILGDSGVGKTSLMNQYV--NKKFSNQY-KATI----------GADFLTKEV-----TVDDKLVTLQIWDTAGQERFQS   64 (172)
T ss_pred             EEEECCCCCCHHHHHHHHH--CCCCCCCC-CCCC----------CEEEEEEEE-----EECCEEEEEEEEECCCCHHHHH
T ss_conf             9999989978999999995--29889875-7755----------516999999-----9999999999996999831106


Q ss_pred             HHHHHHHHCCEEEEEEECCCCCCHHHHHHHHHH-H-H------CCCCEEEEECCCCCCCCCCCCHHHHHHHHHH-HHHHH
Q ss_conf             999999730268999986878865589999999-9-7------0996799832678875321133888775553-22321
Q gi|254780321|r   94 EVSRSLSACEGSLLVVDATQGVEAQTLANVYQA-I-D------NNHEIITVLNKADLPSADPDRVKKQIEETIG-ISTED  164 (606)
Q Consensus        94 EV~r~l~a~dgaiLvVdA~~Gvq~QT~~~~~~A-~-~------~~l~~I~viNKiD~~~A~~e~v~~ei~~~~g-~~~~~  164 (606)
                      -.....+-+|+++||.|-+.---=+....|+.- . .      ..+|+|+|-||+|++.-+. -..++.+++.. ...-.
T Consensus        65 l~~~~~~~a~~~ilvydvt~~~Sf~~l~~w~~~~~~~~~~~~~~~~piilvgNK~Dl~~~r~-V~~~e~~~~a~~~~~~~  143 (172)
T cd01862          65 LGVAFYRGADCCVLVYDVTNPKSFESLDSWRDEFLIQASPSDPENFPFVVLGNKIDLEEKRQ-VSTKKAQQWCQSNGNIP  143 (172)
T ss_pred             HHHHHHHHCCEEEEEECCCCHHHHHHHHHHHHHHHHHCCCCCCCCCCEEEEEECCCHHHCCC-CCHHHHHHHHHHCCCCE
T ss_conf             88998652757999933899899999999999999972767765763899963368364189-99999999999769978


Q ss_pred             HHHHHHHCCCCCCHHHHHHHHHH
Q ss_conf             00011100223200678776321
Q gi|254780321|r  165 ALLVSAKTGEGIPLLLERIVQQL  187 (606)
Q Consensus       165 ii~vSAktG~GV~~LLd~Iv~~i  187 (606)
                      .+.+||++|.||+++++.++..+
T Consensus       144 ~~E~SAk~~~nV~e~F~~l~~~~  166 (172)
T cd01862         144 YFETSAKEAINVEQAFETIARKA  166 (172)
T ss_pred             EEEECCCCCCCHHHHHHHHHHHH
T ss_conf             99975267919899999999999


No 178
>cd04132 Rho4_like Rho4-like subfamily.  Rho4 is a GTPase that controls septum degradation by regulating secretion of Eng1 or Agn1 during cytokinesis.  Rho4 also plays a role in cell morphogenesis.  Rho4 regulates septation and cell morphology by controlling the actin cytoskeleton and cytoplasmic microtubules.  The localization of Rho4 is modulated by Rdi1, which may function as a GDI, and by Rga9, which is believed to function as a GAP.  In S. pombe, both Rho4 deletion and Rho4 overexpression result in a defective cell wall, suggesting a role for Rho4 in maintaining cell wall integrity.  Most Rho proteins contain a lipid modification site at the C-terminus, with a typical sequence motif CaaX, where a = an aliphatic amino acid and X = any amino acid.  Lipid binding is essential for membrane attachment, a key feature of most Rho proteins.
Probab=99.37  E-value=2.3e-11  Score=95.74  Aligned_cols=159  Identities=18%  Similarity=0.163  Sum_probs=102.3

Q ss_pred             EEEECCCCCCHHHHHHHHHHHCCCCCCCCCCCEEECCCHHHHHHCCEEEEEEEEEEEECCCCCEEEEEEEECCCCCHHHH
Q ss_conf             99980138987788999999829805444431130586779871950523279999743788438999961787300279
Q gi|254780321|r   14 FSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVRLNYTSTDAKDYQLNLIDTPGHVDFTY   93 (606)
Q Consensus        14 ~~IiaHvDhGKTTL~d~lL~~tg~i~~~~~~~~vlD~~~~EreRGITIka~~~~~~~~~~~~~~y~iNlIDTPGH~DF~~   93 (606)
                      ++++|-.+-|||+|.-|+.  .|.+.+.-               .-||... ........+++.+.++|.||+|+.+|..
T Consensus         3 ivlvGd~~VGKTsli~r~~--~~~F~~~~---------------~pTi~~~-~~~~~~~~~~~~v~l~iwDtaG~e~~~~   64 (187)
T cd04132           3 IVVVGDGGCGKTCLLIVYS--QGKFPEEY---------------VPTVFEN-YVTNIQGPNGKIIELALWDTAGQEEYDR   64 (187)
T ss_pred             EEEECCCCCCHHHHHHHHH--HCCCCCCC---------------CCCEEEE-EEEEEEEECCEEEEEEEEECCCCCCCCC
T ss_conf             9999949976999999996--39899975---------------8966479-9999995499899999996999711053


Q ss_pred             HHHHHHHHCCEEEEEEECCCCCCHHHHH-HHHHHHH---CCCCEEEEECCCCCCCCCC--CCH-HHHHHHHHH-HHHHHH
Q ss_conf             9999997302689999868788655899-9999997---0996799832678875321--133-888775553-223210
Q gi|254780321|r   94 EVSRSLSACEGSLLVVDATQGVEAQTLA-NVYQAID---NNHEIITVLNKADLPSADP--DRV-KKQIEETIG-ISTEDA  165 (606)
Q Consensus        94 EV~r~l~a~dgaiLvVdA~~Gvq~QT~~-~~~~A~~---~~l~~I~viNKiD~~~A~~--e~v-~~ei~~~~g-~~~~~i  165 (606)
                      -.....+-++++|||.|.+.=--=+-.. .|..-..   .++|+|+|-||.|+..-+.  ..+ .++.+++.. +.....
T Consensus        65 l~~~~~~~a~~~ilvydit~~~Sf~~i~~~W~~~i~~~~~~~piilVgnK~DL~~~~~~~~~v~~e~~~~~a~~~~~~~y  144 (187)
T cd04132          65 LRPLSYPDVDVLLICYAVDNPTSLDNVEDKWFPEVNHFCPGTPIMLVGLKTDLRKDKNLDRKVTPAQAESVAKKQGAFAY  144 (187)
T ss_pred             CHHHHHHHCCEEEEEECCCCHHHHHHHHHHHHHHHHHHCCCCCEEEEEECCHHHHHHCCCCCCCHHHHHHHHHHCCCCEE
T ss_conf             43445300348889503687677999999999999986899997999987221221223765789999999998599789


Q ss_pred             HHHHHHCCCCCCHHHHHHHHHHHCC
Q ss_conf             0011100223200678776321000
Q gi|254780321|r  166 LLVSAKTGEGIPLLLERIVQQLPSP  190 (606)
Q Consensus       166 i~vSAktG~GV~~LLd~Iv~~iP~P  190 (606)
                      +.+|||+|.||+++++.+++.+=-+
T Consensus       145 ~EtSAk~g~nV~e~F~~l~~~il~~  169 (187)
T cd04132         145 LECSAKTMENVEEVFDTAIEEALKK  169 (187)
T ss_pred             EEECCCCCCCHHHHHHHHHHHHHHH
T ss_conf             9957688929899999999999854


No 179
>cd04176 Rap2 Rap2 subgroup.  The Rap2 subgroup is part of the Rap subfamily of the Ras family.  It consists of Rap2a, Rap2b, and Rap2c.  Both isoform 3 of the human mitogen-activated protein kinase kinase kinase kinase 4 (MAP4K4) and Traf2- and Nck-interacting kinase (TNIK) are putative effectors of Rap2 in mediating the activation of c-Jun N-terminal kinase (JNK) to regulate the actin cytoskeleton.  In human platelets, Rap2 was shown to interact with the cytoskeleton by binding the actin filaments.  In embryonic Xenopus development, Rap2 is necessary for the Wnt/beta-catenin signaling pathway.  The Rap2 interacting protein 9 (RPIP9) is highly expressed in human breast carcinomas and correlates with a poor prognosis, suggesting a role for Rap2 in breast cancer oncogenesis.  Rap2b, but not Rap2a, Rap2c, Rap1a, or Rap1b, is expressed in human red blood cells, where it is believed to be involved in vesiculation.  A number of additional effector proteins for Rap2 have been identified, incl
Probab=99.37  E-value=2.8e-11  Score=95.19  Aligned_cols=151  Identities=23%  Similarity=0.284  Sum_probs=100.8

Q ss_pred             EEEEECCCCCCHHHHHHHHHHHCCCCCCCCCCCEEECCCHHHHHHCCEEEEEEEEEEEECCCCCEEEEEEEECCCCCHHH
Q ss_conf             79998013898778899999982980544443113058677987195052327999974378843899996178730027
Q gi|254780321|r   13 NFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVRLNYTSTDAKDYQLNLIDTPGHVDFT   92 (606)
Q Consensus        13 N~~IiaHvDhGKTTL~d~lL~~tg~i~~~~~~~~vlD~~~~EreRGITIka~~~~~~~~~~~~~~y~iNlIDTPGH~DF~   92 (606)
                      -+.++|..+-|||+|.-|++  .|.+.+.- ..++-|           ...+.  +   ..+++.+.+++.||+|+..|.
T Consensus         3 KivllGd~~VGKTsli~r~~--~~~f~~~y-~pTi~~-----------~~~k~--i---~~~~~~~~l~iwDtaG~e~~~   63 (163)
T cd04176           3 KVVVLGSGGVGKSALTVQFV--SGTFIEKY-DPTIED-----------FYRKE--I---EVDSSPSVLEILDTAGTEQFA   63 (163)
T ss_pred             EEEEECCCCCCHHHHHHHHH--HCCCCCCC-CCCCCC-----------EEEEE--E---EECCEEEEEEEEECCCCHHHH
T ss_conf             99998999978999999997--09899755-885233-----------16799--9---988899999999898854256


Q ss_pred             HHHHHHHHHCCEEEEEEECCCCCCHHHHHHHHHHH-H----CCCCEEEEECCCCCCCCCCCCH-HHHHH---HHHHHHHH
Q ss_conf             99999997302689999868788655899999999-7----0996799832678875321133-88877---55532232
Q gi|254780321|r   93 YEVSRSLSACEGSLLVVDATQGVEAQTLANVYQAI-D----NNHEIITVLNKADLPSADPDRV-KKQIE---ETIGISTE  163 (606)
Q Consensus        93 ~EV~r~l~a~dgaiLvVdA~~Gvq~QT~~~~~~A~-~----~~l~~I~viNKiD~~~A~~e~v-~~ei~---~~~g~~~~  163 (606)
                      .-....++-+|+++||.|.+.---=+....|+.-+ +    .++|+|+|-||+|++..+  .| .+|.+   +.+++   
T Consensus        64 ~~~~~~~~~a~~~ilvydit~~~Sf~~l~~~~~~i~~~~~~~~~piilVgNK~DL~~~r--~V~~~e~~~~a~~~~~---  138 (163)
T cd04176          64 SMRDLYIKNGQGFIVVYSLVNQQTFQDIKPMRDQIVRVKGYEKVPIILVGNKVDLESER--EVSSAEGRALAEEWGC---  138 (163)
T ss_pred             HHHHHHHCCCCEEEEEECCCCHHHHHHHHHHHHHHHHHHCCCCCEEEEEEECCCCCCCC--CCCHHHHHHHHHHCCC---
T ss_conf             78899855786568971279889999999999999997389996399974313400127--6999999999998599---


Q ss_pred             HHHHHHHHCCCCCCHHHHHHHHHH
Q ss_conf             100011100223200678776321
Q gi|254780321|r  164 DALLVSAKTGEGIPLLLERIVQQL  187 (606)
Q Consensus       164 ~ii~vSAktG~GV~~LLd~Iv~~i  187 (606)
                      ..+.+||++|.||+++++.++..+
T Consensus       139 ~~~E~SAk~~~nV~~~F~~l~~~i  162 (163)
T cd04176         139 PFMETSAKSKTMVNELFAEIVRQM  162 (163)
T ss_pred             EEEEECCCCCCCHHHHHHHHHHHH
T ss_conf             899985687817799999999953


No 180
>cd04177 RSR1 RSR1 subgroup.  RSR1/Bud1p is a member of the Rap subfamily of the Ras family that is found in fungi.  In budding yeasts, RSR1 is involved in selecting a site for bud growth on the cell cortex, which directs the establishment of cell polarization.  The Rho family GTPase cdc42 and its GEF, cdc24, then establish an axis of polarized growth by organizing the actin cytoskeleton and secretory apparatus at the bud site.  It is believed that cdc42 interacts directly with RSR1 in vivo.  In filamentous fungi, polar growth occurs at the tips of hypha and at novel growth sites along the extending hypha.  In Ashbya gossypii, RSR1 is a key regulator of hyphal growth, localizing at the tip region and regulating in apical polarization of the actin cytoskeleton.  Most Ras proteins contain a lipid modification site at the C-terminus, with a typical sequence motif CaaX, where a = an aliphatic amino acid and X = any amino acid.  Lipid binding is essential for membrane attachment, a key featu
Probab=99.37  E-value=1.5e-11  Score=97.11  Aligned_cols=157  Identities=19%  Similarity=0.241  Sum_probs=100.9

Q ss_pred             EEEEECCCCCCHHHHHHHHHHHCCCCCCCCCCCEEECCCHHHHHHCCEEEEEEEEEEEECCCCCEEEEEEEECCCCCHHH
Q ss_conf             79998013898778899999982980544443113058677987195052327999974378843899996178730027
Q gi|254780321|r   13 NFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVRLNYTSTDAKDYQLNLIDTPGHVDFT   92 (606)
Q Consensus        13 N~~IiaHvDhGKTTL~d~lL~~tg~i~~~~~~~~vlD~~~~EreRGITIka~~~~~~~~~~~~~~y~iNlIDTPGH~DF~   92 (606)
                      -++++|-.+.|||+|.-|++  .|.+.+.- ..++          |-+. .+  .+   ..+++.+.++|.||+|+..|.
T Consensus         3 KivlvGd~~VGKTsli~rf~--~~~f~~~y-~pTi----------~~~~-~k--~i---~i~~~~~~l~iwDtaG~e~~~   63 (168)
T cd04177           3 KIVVLGAGGVGKSALTVQFV--QNVFIESY-DPTI----------EDSY-RK--QV---EIDGRQCDLEILDTAGTEQFT   63 (168)
T ss_pred             EEEEECCCCCCHHHHHHHHH--HCCCCCCC-CCCC----------CCEE-EE--EE---EECCEEEEEEEEECCCCCCCC
T ss_conf             99998999977999999996--19389865-8833----------3159-99--99---999999999998278862333


Q ss_pred             HHHHHHHHHCCEEEEEEECCCCCCHHHHHHHHHHH-----HCCCCEEEEECCCCCCCCCCCCHHHHHHHHHH-HHHHHHH
Q ss_conf             99999997302689999868788655899999999-----70996799832678875321133888775553-2232100
Q gi|254780321|r   93 YEVSRSLSACEGSLLVVDATQGVEAQTLANVYQAI-----DNNHEIITVLNKADLPSADPDRVKKQIEETIG-ISTEDAL  166 (606)
Q Consensus        93 ~EV~r~l~a~dgaiLvVdA~~Gvq~QT~~~~~~A~-----~~~l~~I~viNKiD~~~A~~e~v~~ei~~~~g-~~~~~ii  166 (606)
                      .-....++-++|++||.|.++----+....|+.-.     ..++|+++|-||+|+.+.+.-. .+|..++.. +..-..+
T Consensus        64 ~~~~~~~~~a~~~ilvydvt~~~Sf~~~~~~~~~i~~~~~~~~~piilvgNK~DL~~~r~v~-~~e~~~~a~~~~~~~~~  142 (168)
T cd04177          64 AMRELYIKSGQGFLLVYSVTSEASLNELGELREQVLRIKDSDNVPMVLVGNKADLEDDRQVS-REDGVSLSQQWGNVPFY  142 (168)
T ss_pred             CCHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHHHHCCCCCCCEEEEEECCCHHHCCCCC-HHHHHHHHHHCCCCEEE
T ss_conf             45154512686679853689888999999999999985178887489887314612137689-99999999974997799


Q ss_pred             HHHHHCCCCCCHHHHHHHHHHHC
Q ss_conf             01110022320067877632100
Q gi|254780321|r  167 LVSAKTGEGIPLLLERIVQQLPS  189 (606)
Q Consensus       167 ~vSAktG~GV~~LLd~Iv~~iP~  189 (606)
                      .+|||+|.||+++++.++..+=+
T Consensus       143 E~SAk~~~nV~e~F~~l~~~il~  165 (168)
T cd04177         143 ETSARKRTNVDEVFIDLVRQIIC  165 (168)
T ss_pred             EECCCCCCCHHHHHHHHHHHHHH
T ss_conf             96248784689999999999999


No 181
>cd00879 Sar1 Sar1 subfamily.  Sar1 is an essential component of COPII vesicle coats involved in export of cargo from the ER.  The GTPase activity of Sar1 functions as a molecular switch to control protein-protein and protein-lipid interactions that direct vesicle budding from the ER.  Activation of the GDP to the GTP-bound form of Sar1 involves the membrane-associated guanine nucleotide exchange factor (GEF) Sec12.  Sar1 is unlike all Ras superfamily GTPases that use either myristoyl or prenyl groups to direct membrane association and function, in that Sar1 lacks such modification.  Instead, Sar1 contains a unique nine-amino-acid N-terminal extension.  This extension contains an evolutionarily conserved cluster of bulky hydrophobic amino acids, referred to as the Sar1-N-terminal activation recruitment (STAR) motif.  The STAR motif mediates the recruitment of Sar1 to ER membranes and facilitates its interaction with mammalian Sec12 GEF leading to activation.
Probab=99.37  E-value=2e-11  Score=96.11  Aligned_cols=152  Identities=16%  Similarity=0.243  Sum_probs=104.4

Q ss_pred             HHCEEEEEECCCCCCHHHHHHHHHHHCCCCCCCCCCCEEECCCHHHHHHCCEEEEEEEEEEEECCCCCEEEEEEEECCCC
Q ss_conf             25317999801389877889999998298054444311305867798719505232799997437884389999617873
Q gi|254780321|r    9 SRIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVRLNYTSTDAKDYQLNLIDTPGH   88 (606)
Q Consensus         9 ~~IRN~~IiaHvDhGKTTL~d~lL~~tg~i~~~~~~~~vlD~~~~EreRGITIka~~~~~~~~~~~~~~y~iNlIDTPGH   88 (606)
                      ++-+++-|+|=-.+|||||..+|.  .+.+..         ..       -|+..+..++.|     +++.+++.|++|+
T Consensus        17 ~k~~kIlilGld~aGKTTil~~l~--~~~~~~---------~~-------PT~Gfn~e~i~~-----~~~~~~~wDvgG~   73 (190)
T cd00879          17 NKEAKILFLGLDNAGKTTLLHMLK--DDRLAQ---------HV-------PTLHPTSEELTI-----GNIKFKTFDLGGH   73 (190)
T ss_pred             CCCCEEEEEECCCCCHHHHHHHHH--CCCCCE---------EC-------CCCCCCEEEEEE-----CCEEEEEEECCCC
T ss_conf             770489999069998899999980--799531---------52-------655874599998-----9999999989998


Q ss_pred             CHHHHHHHHHHHHCCEEEEEEECCCCC-CHHHHHHHHHHHH----CCCCEEEEECCCCCCCCCCCCHHHHHHHHHHHH--
Q ss_conf             002799999997302689999868788-6558999999997----099679983267887532113388877555322--
Q gi|254780321|r   89 VDFTYEVSRSLSACEGSLLVVDATQGV-EAQTLANVYQAID----NNHEIITVLNKADLPSADPDRVKKQIEETIGIS--  161 (606)
Q Consensus        89 ~DF~~EV~r~l~a~dgaiLvVdA~~Gv-q~QT~~~~~~A~~----~~l~~I~viNKiD~~~A~~e~v~~ei~~~~g~~--  161 (606)
                      .-|..--.....-+||.|+|||+++=- ..+.+..++..+.    .++|++++.||.|+|+|-.   .+||.+.++++  
T Consensus        74 ~~~R~lW~~Y~~~~~~iIfVVDssD~~r~~eak~~L~~lL~~~~l~~~PlLIlaNK~Dl~~a~~---~~ei~~~L~L~~~  150 (190)
T cd00879          74 EQARRLWKDYFPEVDGIVFLVDAADPERFQESKEELDSLLSDEELANVPFLILGNKIDLPGAVS---EEELRQALGLYGT  150 (190)
T ss_pred             CCCCCCHHHHHHCCCEEEEEEECCCHHHHHHHHHHHHHHHHHHHHCCCCEEEEEECCCCCCCCC---HHHHHHHCCCCCC
T ss_conf             4555438888431137999997767789999999999998555006980899986667767989---9999988398420


Q ss_pred             --------------HHHHHHHHHHCCCCCCHHHHHHHHH
Q ss_conf             --------------3210001110022320067877632
Q gi|254780321|r  162 --------------TEDALLVSAKTGEGIPLLLERIVQQ  186 (606)
Q Consensus       162 --------------~~~ii~vSAktG~GV~~LLd~Iv~~  186 (606)
                                    +-.+.+|||++|.|+++-|+=+.+.
T Consensus       151 ~~~~~~~~~~~~~r~~~i~~csA~tG~Gl~egl~WLs~~  189 (190)
T cd00879         151 TTGKGVSLKVSGIRPIEVFMCSVVKRQGYGEAFRWLSQY  189 (190)
T ss_pred             CCCCCCCCCCCCCCCEEEEEEEEECCCCHHHHHHHHHHH
T ss_conf             155443345457761499965506796828999999854


No 182
>cd04144 Ras2 Ras2 subfamily.  The Ras2 subfamily, found exclusively in fungi, was first identified in Ustilago maydis.  In U. maydis, Ras2 is regulated by Sql2, a protein that is homologous to GEFs (guanine nucleotide exchange factors) of the CDC25 family.  Ras2 has been shown to induce filamentous growth, but the signaling cascade through which Ras2 and Sql2 regulate cell morphology is not known.  Most Ras proteins contain a lipid modification site at the C-terminus, with a typical sequence motif CaaX, where a = an aliphatic amino acid and X = any amino acid.  Lipid binding is essential for membrane attachment, a key feature of most Ras proteins.
Probab=99.37  E-value=3.2e-11  Score=94.85  Aligned_cols=154  Identities=20%  Similarity=0.198  Sum_probs=100.0

Q ss_pred             EEEECCCCCCHHHHHHHHHHHCCCCCCCCCCCEEECCCHHHHHHCCEEEEEEEEEEEECCCCCEEEEEEEECCCCCHHHH
Q ss_conf             99980138987788999999829805444431130586779871950523279999743788438999961787300279
Q gi|254780321|r   14 FSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVRLNYTSTDAKDYQLNLIDTPGHVDFTY   93 (606)
Q Consensus        14 ~~IiaHvDhGKTTL~d~lL~~tg~i~~~~~~~~vlD~~~~EreRGITIka~~~~~~~~~~~~~~y~iNlIDTPGH~DF~~   93 (606)
                      +++||..+-|||+|.-|++  .+.+.+.-               --||-.. ..-.+ ..+++.+.++|.||.|+..|..
T Consensus         2 ivviGd~gVGKTsli~r~~--~~~F~~~y---------------~pTi~~~-~~k~~-~~~~~~~~l~iwDtaG~e~~~~   62 (190)
T cd04144           2 LVVLGDGGVGKTALTIQLC--LNHFVETY---------------DPTIEDS-YRKQV-VVDGQPCMLEVLDTAGQEEYTA   62 (190)
T ss_pred             EEEECCCCCCHHHHHHHHH--HCCCCCCC---------------CCCCCEE-EEEEE-EECCEEEEEEEEECCCCCCHHH
T ss_conf             8999989987899999996--29799886---------------9972478-89999-9999999999998999731167


Q ss_pred             HHHHHHHHCCEEEEEEECCCCCCHHHHHHHHHHH----H---CCCCEEEEECCCCCCCCCCCCHHHHHHHHHHHHHHHHH
Q ss_conf             9999997302689999868788655899999999----7---09967998326788753211338887755532232100
Q gi|254780321|r   94 EVSRSLSACEGSLLVVDATQGVEAQTLANVYQAI----D---NNHEIITVLNKADLPSADPDRVKKQIEETIGISTEDAL  166 (606)
Q Consensus        94 EV~r~l~a~dgaiLvVdA~~Gvq~QT~~~~~~A~----~---~~l~~I~viNKiD~~~A~~e~v~~ei~~~~g~~~~~ii  166 (606)
                      -....++-+|++|||.|.++=--=+....|+.-+    .   .++|+|+|=||+|+.+.+. --.+|.+++-.--.-..+
T Consensus        63 l~~~~~r~a~~~ilVydvtd~~SF~~l~~w~~~i~~~~~~~~~~~piiLVGNK~Dl~~~r~-V~~~e~~~~a~~~~~~~~  141 (190)
T cd04144          63 LRDQWIREGEGFILVYSITSRSTFERVERFREQIQRVKDESAADVPIMIVGNKCDKVYERE-VSTEEGAALARRLGCEFI  141 (190)
T ss_pred             HHHHHHCCCCEEEEEEECCCHHHHHHHHHHHHHHHHHHHCCCCCCEEEECCCCCCHHHCCC-CCHHHHHHHHHHCCCEEE
T ss_conf             8899823676589997279778999999999999998533799952895145535033057-899999999998099899


Q ss_pred             HHHHHCCCCCCHHHHHHHHHH
Q ss_conf             011100223200678776321
Q gi|254780321|r  167 LVSAKTGEGIPLLLERIVQQL  187 (606)
Q Consensus       167 ~vSAktG~GV~~LLd~Iv~~i  187 (606)
                      .+||++|.||+++++.++..+
T Consensus       142 E~SAk~~~nV~e~F~~l~~~i  162 (190)
T cd04144         142 EASAKTNVNVERAFYTLVRAL  162 (190)
T ss_pred             EECCCCCCCHHHHHHHHHHHH
T ss_conf             973588809799999999999


No 183
>cd04145 M_R_Ras_like M-Ras/R-Ras-like subfamily.  This subfamily contains R-Ras2/TC21, M-Ras/R-Ras3, and related members of the Ras family. M-Ras is expressed in lympho-hematopoetic cells.  It interacts with some of the known Ras effectors, but appears to also have its own effectors.  Expression of mutated M-Ras leads to transformation of several types of cell lines, including hematopoietic cells, mammary epithelial cells, and fibroblasts.  Overexpression of M-Ras is observed in carcinomas from breast, uterus, thyroid, stomach, colon, kidney, lung, and rectum.  In addition, expression of a constitutively active M-Ras mutant in murine bone marrow induces a malignant mast cell leukemia that is distinct from the monocytic leukemia induced by H-Ras.  TC21, along with H-Ras, has been shown to regulate the branching morphogenesis of ureteric bud cell branching in mice.  Most Ras proteins contain a lipid modification site at the C-terminus, with a typical sequence motif CaaX, where a = an ali
Probab=99.36  E-value=2.8e-11  Score=95.24  Aligned_cols=154  Identities=23%  Similarity=0.226  Sum_probs=101.8

Q ss_pred             EEEEECCCCCCHHHHHHHHHHHCCCCCCCCCCCEEECCCHHHHHHCCEEEEE-EEEEEEECCCCCEEEEEEEECCCCCHH
Q ss_conf             7999801389877889999998298054444311305867798719505232-799997437884389999617873002
Q gi|254780321|r   13 NFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQ-TVRLNYTSTDAKDYQLNLIDTPGHVDF   91 (606)
Q Consensus        13 N~~IiaHvDhGKTTL~d~lL~~tg~i~~~~~~~~vlD~~~~EreRGITIka~-~~~~~~~~~~~~~y~iNlIDTPGH~DF   91 (606)
                      -++++|-..-|||+|..|++  .+.+...- .              -||... .-.+   ..+++.+.++|.||+|+.+|
T Consensus         4 Kiv~lGd~~VGKTsli~r~~--~~~f~~~y-~--------------~Ti~~~~~k~~---~~~~~~~~l~iwDtaG~e~~   63 (164)
T cd04145           4 KLVVVGGGGVGKSALTIQFI--QSYFVTDY-D--------------PTIEDSYTKQC---EIDGQWAILDILDTAGQEEF   63 (164)
T ss_pred             EEEEECCCCCCHHHHHHHHH--CCCCCCCC-C--------------CCEEEEEEEEE---EECCEEEEEEEEECCCCCCC
T ss_conf             99999999978899999998--09898756-7--------------84135899999---99999999999989886031


Q ss_pred             HHHHHHHHHHCCEEEEEEECCCCCCHHHHHHHHHHH-H----CCCCEEEEECCCCCCCCCCCCHHHHHHHHHHHHHHHHH
Q ss_conf             799999997302689999868788655899999999-7----09967998326788753211338887755532232100
Q gi|254780321|r   92 TYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQAI-D----NNHEIITVLNKADLPSADPDRVKKQIEETIGISTEDAL  166 (606)
Q Consensus        92 ~~EV~r~l~a~dgaiLvVdA~~Gvq~QT~~~~~~A~-~----~~l~~I~viNKiD~~~A~~e~v~~ei~~~~g~~~~~ii  166 (606)
                      ..-....++-+||++||.|.++---=+....|+.-. +    ..+|+|+|-||+|+.+-+. -..+|.+++..--.-..+
T Consensus        64 ~~~~~~~~~~a~~~ilvydi~~~~Sf~~~~~~~~~i~~~~~~~~~piilVgNK~DL~~~r~-Vs~~e~~~~a~~~~~~~~  142 (164)
T cd04145          64 SAMREQYMRTGEGFLLVFSVTDRGSFEEVDKFHTQILRVKDRDEFPMILVGNKADLEHQRK-VSREEGQELARKLKIPYI  142 (164)
T ss_pred             CHHHHHHHCCCCCCEEEEECCCHHHHHHHHHHHHHHHHHCCCCCCCEEEECCCCCHHHHCC-CCHHHHHHHHHHCCCEEE
T ss_conf             2567987346787468985673543999999999999861887775265303457354088-999999999998199899


Q ss_pred             HHHHHCCCCCCHHHHHHHHHH
Q ss_conf             011100223200678776321
Q gi|254780321|r  167 LVSAKTGEGIPLLLERIVQQL  187 (606)
Q Consensus       167 ~vSAktG~GV~~LLd~Iv~~i  187 (606)
                      .+|||+|.||+++++.++..+
T Consensus       143 E~SAk~~~nV~e~F~~l~~~I  163 (164)
T cd04145         143 ETSAKDRLNVDKAFHDLVRVI  163 (164)
T ss_pred             EECCCCCCCHHHHHHHHHHHH
T ss_conf             985486827799999999975


No 184
>cd01866 Rab2 Rab2 subfamily.  Rab2 is localized on cis-Golgi membranes and interacts with Golgi matrix proteins. Rab2 is also implicated in the maturation of vesicular tubular clusters (VTCs), which are microtubule-associated intermediates in transport between the ER and Golgi apparatus. In plants, Rab2 regulates vesicle trafficking between the ER and the Golgi bodies and is important to pollen tube growth.  GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state.  Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilitate Rab recycling by masking C-terminal lipid binding and promoting cytosolic localization.  Most Rab GTPases contain a lipid modification site at the C-terminus, with sequence motifs CC, CXC, or CCX. Lipid binding is essential for membrane attachment, a key featur
Probab=99.36  E-value=3e-11  Score=94.96  Aligned_cols=156  Identities=22%  Similarity=0.217  Sum_probs=99.6

Q ss_pred             EEEEECCCCCCHHHHHHHHHHHCCCCCCCCCCCEEECCCHHHHHHCCEEEEEEEEEEEECCCCCEEEEEEEECCCCCHHH
Q ss_conf             79998013898778899999982980544443113058677987195052327999974378843899996178730027
Q gi|254780321|r   13 NFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVRLNYTSTDAKDYQLNLIDTPGHVDFT   92 (606)
Q Consensus        13 N~~IiaHvDhGKTTL~d~lL~~tg~i~~~~~~~~vlD~~~~EreRGITIka~~~~~~~~~~~~~~y~iNlIDTPGH~DF~   92 (606)
                      -+.++|..+.|||+|.-|++  .+.+....               -.||-....+-. ...+++.++++|.||+|+..|.
T Consensus         6 KivlvGd~~VGKTsli~r~~--~~~f~~~~---------------~~Tig~~~~~k~-i~~~~~~~~l~iwDt~G~e~~~   67 (168)
T cd01866           6 KYIIIGDTGVGKSCLLLQFT--DKRFQPVH---------------DLTIGVEFGARM-ITIDGKQIKLQIWDTAGQESFR   67 (168)
T ss_pred             EEEEECCCCCCHHHHHHHHH--CCCCCCCC---------------CCCCEEEEEEEE-EEECCEEEEEEEEECCCCCCCC
T ss_conf             99999989978899999991--09899987---------------898507889999-9999999999999799973346


Q ss_pred             HHHHHHHHHCCEEEEEEECCCCCCHHHHHHHH-HHHH---CCCCEEEEECCCCCCCCCCCCHHHHHHHHHHHHHHHHHHH
Q ss_conf             99999997302689999868788655899999-9997---0996799832678875321133888775553223210001
Q gi|254780321|r   93 YEVSRSLSACEGSLLVVDATQGVEAQTLANVY-QAID---NNHEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLV  168 (606)
Q Consensus        93 ~EV~r~l~a~dgaiLvVdA~~Gvq~QT~~~~~-~A~~---~~l~~I~viNKiD~~~A~~e~v~~ei~~~~g~~~~~ii~v  168 (606)
                      .-....++-++++|||.|.+.---=+....|. .+.+   .+.++|+|=||+|++.-+. --.+|.+++..-..-..+.+
T Consensus        68 ~l~~~~~~~a~~~ilvydit~~~Sf~~l~~w~~~i~~~~~~~~~iiLVGNK~DL~~~r~-V~~~e~~~~a~~~~~~~~E~  146 (168)
T cd01866          68 SITRSYYRGAAGALLVYDITRRETFNHLTSWLEDARQHSNSNMTIMLIGNKCDLESRRE-VSYEEGEAFAKEHGLIFMET  146 (168)
T ss_pred             CCHHHHHHHHCEEEEECCCCCHHHHHHHHHHHHHHHHHCCCCCEEEEEEECCCHHHCCC-CCHHHHHHHHHHCCCEEEEE
T ss_conf             25588866436899934458779999999999999986799965998434235454077-89999999999869999997


Q ss_pred             HHHCCCCCCHHHHHHHHHH
Q ss_conf             1100223200678776321
Q gi|254780321|r  169 SAKTGEGIPLLLERIVQQL  187 (606)
Q Consensus       169 SAktG~GV~~LLd~Iv~~i  187 (606)
                      |||+|.||+++++.++..+
T Consensus       147 SAk~~~nV~~~F~~l~~~i  165 (168)
T cd01866         147 SAKTASNVEEAFINTAKEI  165 (168)
T ss_pred             CCCCCCCHHHHHHHHHHHH
T ss_conf             6788808899999999999


No 185
>cd04117 Rab15 Rab15 subfamily.  Rab15 colocalizes with the transferrin receptor in early endosome compartments, but not with late endosomal markers. It codistributes with Rab4 and Rab5 on early/sorting endosomes, and with Rab11 on pericentriolar recycling endosomes. It is believed to function as an inhibitory GTPase that regulates distinct steps in early endocytic trafficking.  GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state.  Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilitate Rab recycling by masking C-terminal lipid binding and promoting cytosolic localization.  Most Rab GTPases contain a lipid modification site at the C-terminus, with sequence motifs CC, CXC, or CCX. Lipid binding is essential for membrane attachment, a key feature of most Rab proteins.  Due to
Probab=99.36  E-value=2.7e-11  Score=95.30  Aligned_cols=155  Identities=19%  Similarity=0.235  Sum_probs=101.6

Q ss_pred             EEEECCCCCCHHHHHHHHHHHCCCCCCCCCCCEEECCCHHHHHHCCEEEEEEEEEEEECCCCCEEEEEEEECCCCCHHHH
Q ss_conf             99980138987788999999829805444431130586779871950523279999743788438999961787300279
Q gi|254780321|r   14 FSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVRLNYTSTDAKDYQLNLIDTPGHVDFTY   93 (606)
Q Consensus        14 ~~IiaHvDhGKTTL~d~lL~~tg~i~~~~~~~~vlD~~~~EreRGITIka~~~~~~~~~~~~~~y~iNlIDTPGH~DF~~   93 (606)
                      +.++|...-|||+|.-|++  .+.+..... .++          |+....+.+     ..+++.+.++|.||+|...|..
T Consensus         3 IvllGd~~VGKTsli~r~~--~~~f~~~~~-~Ti----------g~~~~~k~v-----~~~~~~i~l~iwDtaGqe~~~~   64 (161)
T cd04117           3 LLLIGDSGVGKTCLLCRFT--DNEFHSSHI-STI----------GVDFKMKTI-----EVDGIKVRIQIWDTAGQERYQT   64 (161)
T ss_pred             EEEECCCCCCHHHHHHHHH--CCCCCCCCC-CCC----------EEEEEEEEE-----EECCEEEEEEEEECCCCCCCCC
T ss_conf             9999949985899999994--299899878-872----------089889999-----9999999999997999602363


Q ss_pred             HHHHHHHHCCEEEEEEECCCCCCHHHHHHHHHHH-H---CCCCEEEEECCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHH
Q ss_conf             9999997302689999868788655899999999-7---09967998326788753211338887755532232100011
Q gi|254780321|r   94 EVSRSLSACEGSLLVVDATQGVEAQTLANVYQAI-D---NNHEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVS  169 (606)
Q Consensus        94 EV~r~l~a~dgaiLvVdA~~Gvq~QT~~~~~~A~-~---~~l~~I~viNKiD~~~A~~e~v~~ei~~~~g~~~~~ii~vS  169 (606)
                      -+...++-+++++||.|-+.=--=+.+..|..-. +   .+.++|+|-||+|+...+. -..+|..++..--.-..+.+|
T Consensus        65 ~~~~y~r~a~~~ilvyDvt~~~Sf~~l~~w~~~i~~~~~~~~~~ilVgNK~Dl~~~r~-v~~~~~~~~a~~~~~~~~etS  143 (161)
T cd04117          65 ITKQYYRRAQGIFLVYDISSERSYQHIMKWVSDVDEYAPEGVQKILIGNKADEEQKRQ-VGDEQGNKLAKEYGMDFFETS  143 (161)
T ss_pred             CHHHHHHHHCEEEEECCCCCHHHHHHHHHHHHHHHHHCCCCCEEEEEEECCCHHHCCC-CCHHHHHHHHHHCCCEEEEEC
T ss_conf             5588876416889961489889999999999999987899864999873278786277-999999999998699799967


Q ss_pred             HHCCCCCCHHHHHHHHHH
Q ss_conf             100223200678776321
Q gi|254780321|r  170 AKTGEGIPLLLERIVQQL  187 (606)
Q Consensus       170 AktG~GV~~LLd~Iv~~i  187 (606)
                      ||+|.||+++++.|.+.+
T Consensus       144 Ak~~~nV~e~F~~l~~~i  161 (161)
T cd04117         144 ACTNSNIKESFTRLTELV  161 (161)
T ss_pred             CCCCCCHHHHHHHHHHHC
T ss_conf             789829899999999649


No 186
>KOG1143 consensus
Probab=99.35  E-value=6.2e-12  Score=99.61  Aligned_cols=250  Identities=20%  Similarity=0.268  Sum_probs=153.2

Q ss_pred             EEEEECCCCCCHHHHHHHHHHHCCCCCCCCCCCEE-ECCCHHHHHHCCEEEEEEEEEE---------EECC-------CC
Q ss_conf             79998013898778899999982980544443113-0586779871950523279999---------7437-------88
Q gi|254780321|r   13 NFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQV-LDNMDIERERGITIKAQTVRLN---------YTST-------DA   75 (606)
Q Consensus        13 N~~IiaHvDhGKTTL~d~lL~~tg~i~~~~~~~~v-lD~~~~EreRGITIka~~~~~~---------~~~~-------~~   75 (606)
                      -+|++|..|.|||||..-|-  -|-++......++ +=..+-|-.-|-|-.-..-.+.         |...       +.
T Consensus       169 RvAVlGg~D~GKSTLlGVLT--QgeLDnG~GrARln~FRh~HEiqsGrTSsis~evlGFd~~g~vVNY~~~~taEEi~e~  246 (591)
T KOG1143         169 RVAVLGGCDVGKSTLLGVLT--QGELDNGNGRARLNIFRHPHEIQSGRTSSISNEVLGFDNRGKVVNYAQNMTAEEIVEK  246 (591)
T ss_pred             EEEEECCCCCCCCEEEEEEE--CCCCCCCCCEEEEEHHCCHHHHCCCCCCCCCHHCCCCCCCCCCCCHHHCCCHHHHHHH
T ss_conf             99985276567223665541--0531478870663011063654057632001010053653430022320459998741


Q ss_pred             CEEEEEEEECCCCCHHHHHHHHHHHH--CCEEEEEEECCCCCCHHHHHHHHHHHHCCCCEEEEECCCCCCCC-CCCCHHH
Q ss_conf             43899996178730027999999973--02689999868788655899999999709967998326788753-2113388
Q gi|254780321|r   76 KDYQLNLIDTPGHVDFTYEVSRSLSA--CEGSLLVVDATQGVEAQTLANVYQAIDNNHEIITVLNKADLPSA-DPDRVKK  152 (606)
Q Consensus        76 ~~y~iNlIDTPGH~DF~~EV~r~l~a--~dgaiLvVdA~~Gvq~QT~~~~~~A~~~~l~~I~viNKiD~~~A-~~e~v~~  152 (606)
                      -...+.|||--||.-+.--...+|..  -+-|+|||+|..|+---|++|+-++...++|..+++.|||+.+- -.++..+
T Consensus       247 SSKlvTfiDLAGh~kY~~TTi~gLtgY~Ph~A~LvVsA~~Gi~~tTrEHLgl~~AL~iPfFvlvtK~Dl~~~~~~~~tv~  326 (591)
T KOG1143         247 SSKLVTFIDLAGHAKYQKTTIHGLTGYTPHFACLVVSADRGITWTTREHLGLIAALNIPFFVLVTKMDLVDRQGLKKTVK  326 (591)
T ss_pred             HCCEEEEEECCCCHHHHEEEEEECCCCCCCEEEEEEECCCCCCCCCHHHHHHHHHHCCCEEEEEEEECCCCCHHHHHHHH
T ss_conf             02338876504422313045220036798627999986888765408888899971787699998401236321789999


Q ss_pred             HHHHHH---HHH--------H------------HH---HHHHHHHCCCCCCHHHHHHHHHHHCCCCHHHHHC---CCCCC
Q ss_conf             877555---322--------3------------21---0001110022320067877632100011112201---23310
Q gi|254780321|r  153 QIEETI---GIS--------T------------ED---ALLVSAKTGEGIPLLLERIVQQLPSPTSPEGANA---PLKAL  203 (606)
Q Consensus       153 ei~~~~---g~~--------~------------~~---ii~vSAktG~GV~~LLd~Iv~~iP~P~~~~~~~~---Pl~al  203 (606)
                      |+..++   |+.        .            .+   |+.+|..+|.|.. ||....+.+||-......+.   ...-+
T Consensus       327 ~l~nll~~~Gc~kvp~~Vt~~ddAv~Aaq~~~s~nivPif~vSsVsGegl~-ll~~fLn~Lsp~~~~~e~~~L~q~~~eF  405 (591)
T KOG1143         327 DLSNLLAKAGCTKVPKRVTTKDDAVKAAQELCSGNIVPIFAVSSVSGEGLR-LLRTFLNCLSPAGTAEERIQLVQLPAEF  405 (591)
T ss_pred             HHHHHHHHCCCCCCCEEEECHHHHHHHHHHHCCCCCEEEEEEEECCCCCHH-HHHHHHHHCCCCCCHHHHHHHHCCCCEE
T ss_conf             999887423763263485050788788887536881148998504763266-9999986438767727799986676226


Q ss_pred             CCCEEEC-CCCCEEEEEEECCCCCCCCCEEEEECCC-CCCCCCCCCCCCCCEEEEHHCCCCCHH
Q ss_conf             1210114-7572599998169873558458873355-642101222335541240101247123
Q gi|254780321|r  204 LIDSWYN-SYLGVMVLVRIINGQLTKGQSIRLMGTN-AKYQVERIGILTPKMIDIEALYPGEIG  265 (606)
Q Consensus       204 Vfds~~D-~~~G~I~~~RV~sG~lk~Gd~I~~~~~g-~~~~v~~ig~~~~~~~~v~~l~aGdVG  265 (606)
                      -.|-.|. |++|.++-+-+.+|.+..|+.+.+-+.. ..+.--.++..+-.+.++..+.||+..
T Consensus       406 qvdEiy~Vp~VG~VVGG~Ls~G~l~Eg~~~~vGP~~DG~F~~itV~sI~Rnr~acrvvraGqaA  469 (591)
T KOG1143         406 QVDEIYNVPHVGQVVGGMLSEGQLHEGADVLVGPMKDGTFEKITVGSIRRNRQACRVVRAGQAA  469 (591)
T ss_pred             EHHHEECCCCCCCCCCCEEEECEECCCCEEEEECCCCCCEEEEEEEEEECCCCCEEEECCCCCE
T ss_conf             6747056776565031154223232686057504799834678862364166420263276311


No 187
>cd00157 Rho Rho (Ras homology) family.  Members of the Rho family include RhoA, Cdc42, Rac, Rnd, Wrch1, RhoBTB, and Rop.  There are 22 human Rho family members identified currently.  These proteins are all involved in the reorganization of the actin cytoskeleton in response to external stimuli.  They also have roles in cell transformation by Ras in cytokinesis, in focal adhesion formation and in the stimulation of stress-activated kinase.  These various functions are controlled through distinct effector proteins and mediated through a GTP-binding/GTPase cycle involving three classes of regulating proteins: GAPs (GTPase-activating proteins), GEFs (guanine nucleotide exchange factors), and GDIs (guanine nucleotide dissociation inhibitors).  Most Rho proteins contain a lipid modification site at the C-terminus, with a typical sequence motif CaaX, where a = an aliphatic amino acid and X = any amino acid.  Lipid binding is essential for membrane attachment, a key feature of most Rho protein
Probab=99.35  E-value=4.7e-11  Score=93.66  Aligned_cols=154  Identities=20%  Similarity=0.235  Sum_probs=96.1

Q ss_pred             EEEEECCCCCCHHHHHHHHHHHCCCCCCCCCCCEEECCCHHHHHHCCEEEEEEEEEEEECCCCCEEEEEEEECCCCCHHH
Q ss_conf             79998013898778899999982980544443113058677987195052327999974378843899996178730027
Q gi|254780321|r   13 NFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVRLNYTSTDAKDYQLNLIDTPGHVDFT   92 (606)
Q Consensus        13 N~~IiaHvDhGKTTL~d~lL~~tg~i~~~~~~~~vlD~~~~EreRGITIka~~~~~~~~~~~~~~y~iNlIDTPGH~DF~   92 (606)
                      -++++|..+-|||+|.-|++  .+.+.... ..++.|             .....+   ..+++.+.++|.||+|+.+|.
T Consensus         2 Ki~llGd~~VGKTsli~r~~--~~~f~~~y-~~Ti~~-------------~~~~~~---~~~~~~~~l~iwDt~G~e~~~   62 (171)
T cd00157           2 KIVVVGDGAVGKTCLLISYT--TGKFPTEY-VPTVFD-------------NYSATV---TVDGKQVNLGLWDTAGQEEYD   62 (171)
T ss_pred             EEEEECCCCCCHHHHHHHHH--CCCCCCCC-CCEEEE-------------EEEEEE---EECCEEEEEEEEECCCCCCCC
T ss_conf             89999999966999999996--29999875-880346-------------668999---999999999999899871024


Q ss_pred             HHHHHHHHHCCEEEEEEECCCCCCHHHHHH-HHHHHH---CCCCEEEEECCCCCCCCCC---------CCH-HHHHHHHH
Q ss_conf             999999973026899998687886558999-999997---0996799832678875321---------133-88877555
Q gi|254780321|r   93 YEVSRSLSACEGSLLVVDATQGVEAQTLAN-VYQAID---NNHEIITVLNKADLPSADP---------DRV-KKQIEETI  158 (606)
Q Consensus        93 ~EV~r~l~a~dgaiLvVdA~~Gvq~QT~~~-~~~A~~---~~l~~I~viNKiD~~~A~~---------e~v-~~ei~~~~  158 (606)
                      .-....++-++++|||.|.++---=+.... |..-+.   .+.|+|+|-||+|+.+.+.         ..| .+|.+++-
T Consensus        63 ~~~~~~~~~a~~~ilvydit~~~Sf~~i~~~w~~~i~~~~~~~piilvgNK~DL~~~~~~~~~~~~~~r~V~~~e~~~~a  142 (171)
T cd00157          63 RLRPLSYPNTDVFLICFSVDSPSSFENVKTKWIPEIRHYCPNVPIILVGTKIDLRDDENTLKKLEKGKEPITPEEGEKLA  142 (171)
T ss_pred             CCHHHHHHHCCEEEEEEECCCHHHHHHHHHHHHHHHHHHCCCCCEEEEEECCCCCCCCCHHHHHHCCCCCCCHHHHHHHH
T ss_conf             13223444265899999689778899999999999998599986899998710012300022331147515899999999


Q ss_pred             -HHHHHHHHHHHHHCCCCCCHHHHHHHH
Q ss_conf             -322321000111002232006787763
Q gi|254780321|r  159 -GISTEDALLVSAKTGEGIPLLLERIVQ  185 (606)
Q Consensus       159 -g~~~~~ii~vSAktG~GV~~LLd~Iv~  185 (606)
                       .+.....+.+|||+|.||+++++.++.
T Consensus       143 ~~~~~~~f~E~SAk~g~nV~e~F~~l~r  170 (171)
T cd00157         143 KEIGAIGYMECSALTQEGVKEVFEEAIR  170 (171)
T ss_pred             HHCCCCEEEEECCCCCCCHHHHHHHHHC
T ss_conf             9849988999787899598999999966


No 188
>cd04114 Rab30 Rab30 subfamily.  Rab30 appears to be associated with the Golgi stack. It is expressed in a wide variety of tissue types and in humans maps to chromosome 11.  GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state.  Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilitate Rab recycling by masking C-terminal lipid binding and promoting cytosolic localization.  Most Rab GTPases contain a lipid modification site at the C-terminus, with sequence motifs CC, CXC, or CCX. Lipid binding is essential for membrane attachment, a key feature of most Rab proteins.  Due to the presence of truncated sequences in this CD, the lipid modification site is not available for annotation.
Probab=99.35  E-value=3.5e-11  Score=94.51  Aligned_cols=158  Identities=19%  Similarity=0.210  Sum_probs=100.6

Q ss_pred             CEEEEEECCCCCCHHHHHHHHHHHCCCCCCCCCCCEEECCCHHHHHHCCEEEEEEEEEEEECCCCCEEEEEEEECCCCCH
Q ss_conf             31799980138987788999999829805444431130586779871950523279999743788438999961787300
Q gi|254780321|r   11 IRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVRLNYTSTDAKDYQLNLIDTPGHVD   90 (606)
Q Consensus        11 IRN~~IiaHvDhGKTTL~d~lL~~tg~i~~~~~~~~vlD~~~~EreRGITIka~~~~~~~~~~~~~~y~iNlIDTPGH~D   90 (606)
                      +=-++++|-.+.|||+|..|++  .+.+..... .+          -|+....+  .+.   .+++.+.++|.||+|...
T Consensus         7 ~~KivllGd~~VGKTsli~r~~--~~~f~~~~~-~T----------ig~d~~~k--~i~---~~~~~v~l~iwDtaG~e~   68 (169)
T cd04114           7 LFKIVLIGNAGVGKTCLVRRFT--QGLFPPGQG-AT----------IGVDFMIK--TVE---IKGEKIKLQIWDTAGQER   68 (169)
T ss_pred             EEEEEEECCCCCCHHHHHHHHH--HCCCCCCCC-CC----------CCEEEEEE--EEE---ECCEEEEEEEEECCCCCC
T ss_conf             9899999989979999999998--598999867-74----------12478999--999---999999999998999844


Q ss_pred             HHHHHHHHHHHCCEEEEEEECCCCCCHHHHHHHHHHH-HC---CCCEEEEECCCCCCCCCCCCHHHHHHHHHHHHHHHHH
Q ss_conf             2799999997302689999868788655899999999-70---9967998326788753211338887755532232100
Q gi|254780321|r   91 FTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQAI-DN---NHEIITVLNKADLPSADPDRVKKQIEETIGISTEDAL  166 (606)
Q Consensus        91 F~~EV~r~l~a~dgaiLvVdA~~Gvq~QT~~~~~~A~-~~---~l~~I~viNKiD~~~A~~e~v~~ei~~~~g~~~~~ii  166 (606)
                      |..-....++-+++++||.|.+.----+....|..-+ +.   ..++|+|=||+|+...+. -..++.+++..-..-..+
T Consensus        69 ~~~l~~~~~~~a~~~ilvydvt~~~Sf~~l~~w~~~i~~~~~~~~~~ilVGNK~DL~~~r~-v~~~~~~~~a~~~~~~~~  147 (169)
T cd04114          69 FRSITQSYYRSANALILTYDITCEESFRCLPEWLREIEQYANNKVITILVGNKIDLAERRE-VSQQRAEEFSDAQDMYYL  147 (169)
T ss_pred             CCCCHHHHHHCCCEEEEEECCCCHHHHHHHHHHHHHHHHHCCCCCEEEEECCCCCHHHCCC-CCHHHHHHHHHHCCCEEE
T ss_conf             4515577742366459981489888999999999999986898863897311343454178-899999999998899999


Q ss_pred             HHHHHCCCCCCHHHHHHHHHH
Q ss_conf             011100223200678776321
Q gi|254780321|r  167 LVSAKTGEGIPLLLERIVQQL  187 (606)
Q Consensus       167 ~vSAktG~GV~~LLd~Iv~~i  187 (606)
                      .+|||+|.||+++++.|...+
T Consensus       148 E~SAktg~nV~e~F~~la~~l  168 (169)
T cd04114         148 ETSAKESDNVEKLFLDLACRL  168 (169)
T ss_pred             EECCCCCCCHHHHHHHHHHHH
T ss_conf             986898808899999999987


No 189
>cd04125 RabA_like RabA-like subfamily.  RabA was first identified in D. discoideum, where its expression levels were compared to other Rabs in growing and developing cells.  The RabA mRNA levels were below the level of detection by Northern blot analysis, suggesting a very low level of expression.  The function of RabA remains unknown.  GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state.  Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilitate Rab recycling by masking C-terminal lipid binding and promoting cytosolic localization.  Most Rab GTPases contain a lipid modification site at the C-terminus, with sequence motifs CC, CXC, or CCX. Lipid binding is essential for membrane attachment, a key feature of most Rab proteins.
Probab=99.35  E-value=2.8e-11  Score=95.18  Aligned_cols=153  Identities=26%  Similarity=0.317  Sum_probs=98.7

Q ss_pred             EEEECCCCCCHHHHHHHHHHHCCCCCCCCCCCEEECCCHHHHHHCCEEEEEEEEEEEECCCCCEEEEEEEECCCCCHHHH
Q ss_conf             99980138987788999999829805444431130586779871950523279999743788438999961787300279
Q gi|254780321|r   14 FSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVRLNYTSTDAKDYQLNLIDTPGHVDFTY   93 (606)
Q Consensus        14 ~~IiaHvDhGKTTL~d~lL~~tg~i~~~~~~~~vlD~~~~EreRGITIka~~~~~~~~~~~~~~y~iNlIDTPGH~DF~~   93 (606)
                      ++++|..+.|||+|..|++  .+.+...- ..++          |.....+.+     ..+++.+.++|.||+|...|..
T Consensus         3 ivvvGd~~VGKTsli~r~~--~~~f~~~~-~~Ti----------g~~~~~k~i-----~~~~~~~~l~iwDtaG~e~~~~   64 (188)
T cd04125           3 VVIIGDYGVGKSSLLKRFT--EDEFSEST-KSTI----------GVDFKIKTV-----YIENKIIKLQIWDTNGQERFRS   64 (188)
T ss_pred             EEEECCCCCCHHHHHHHHH--HCCCCCCC-CCCC----------CEEEEEEEE-----EECCEEEEEEEEECCCCHHHHH
T ss_conf             9999999978999999995--19689986-8865----------403579999-----9999999999998999710457


Q ss_pred             HHHHHHHHCCEEEEEEECCCCCCHHHHHHHHHHH-H---CCCCEEEEECCCCCCCCCC-C-CHHHHHHHHHHHHHHHHHH
Q ss_conf             9999997302689999868788655899999999-7---0996799832678875321-1-3388877555322321000
Q gi|254780321|r   94 EVSRSLSACEGSLLVVDATQGVEAQTLANVYQAI-D---NNHEIITVLNKADLPSADP-D-RVKKQIEETIGISTEDALL  167 (606)
Q Consensus        94 EV~r~l~a~dgaiLvVdA~~Gvq~QT~~~~~~A~-~---~~l~~I~viNKiD~~~A~~-e-~v~~ei~~~~g~~~~~ii~  167 (606)
                      -....++-+|++|||.|.++=--=+....|+.-. .   ...++|+|-||+|+.+-+. + .-.++..+.+++   ..+.
T Consensus        65 l~~~~~~~a~~~ilvydit~~~Sf~~l~~w~~~i~~~~~~~~~iilvgNK~DL~~~r~V~~~e~~~~a~~~~~---~~~E  141 (188)
T cd04125          65 LNNSYYRGAHGYLLVYDVTDQESFENLKFWINEINRYARENVIKVIVANKSDLVNNKVVDSNIAKSFCDSLNI---PFFE  141 (188)
T ss_pred             HHHHHHCCCCEEEEEECCCCHHHHHHHHHHHHHHHHHCCCCCCEEEECCHHHHHHCCCCCHHHHHHHHHHCCC---EEEE
T ss_conf             8999863786799980389878999999999999987898662451001344766067999999999998699---8999


Q ss_pred             HHHHCCCCCCHHHHHHHHHH
Q ss_conf             11100223200678776321
Q gi|254780321|r  168 VSAKTGEGIPLLLERIVQQL  187 (606)
Q Consensus       168 vSAktG~GV~~LLd~Iv~~i  187 (606)
                      +||++|.||+++++.+++.+
T Consensus       142 ~SAktg~nV~e~F~~l~~~i  161 (188)
T cd04125         142 TSAKQSINVEEAFILLVKLI  161 (188)
T ss_pred             ECCCCCCCHHHHHHHHHHHH
T ss_conf             74788909899999999999


No 190
>cd01896 DRG The developmentally regulated GTP-binding protein (DRG) subfamily is an uncharacterized member of the Obg family, an evolutionary branch of GTPase superfamily proteins.  GTPases act as molecular switches regulating diverse cellular processes.  DRG2 and DRG1 comprise the DRG subfamily in eukaryotes.  In view of their widespread expression in various tissues and high conservation among distantly related species in eukaryotes and archaea, DRG proteins may regulate fundamental cellular processes.  It is proposed that the DRG subfamily proteins play their physiological roles through RNA binding.
Probab=99.33  E-value=6.4e-11  Score=92.81  Aligned_cols=147  Identities=26%  Similarity=0.335  Sum_probs=92.2

Q ss_pred             EEEEECCCCCCHHHHHHHHHHHCCCCCCCCCCCEEECCCHHHHHHCCEEEEEEEEEEEECCCCCEEEEEEEECCCCCHH-
Q ss_conf             7999801389877889999998298054444311305867798719505232799997437884389999617873002-
Q gi|254780321|r   13 NFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVRLNYTSTDAKDYQLNLIDTPGHVDF-   91 (606)
Q Consensus        13 N~~IiaHvDhGKTTL~d~lL~~tg~i~~~~~~~~vlD~~~~EreRGITIka~~~~~~~~~~~~~~y~iNlIDTPGH~DF-   91 (606)
                      .++|+|--..|||||.-+|   ||+-  .+..    |+.      .-|+.-..-.+.|     ++.++-|+||||.... 
T Consensus         2 ~V~LVG~PN~GKSTLln~L---T~a~--~~v~----~yp------fTT~~pi~g~~~~-----~~~~iqlvDtPGli~~a   61 (233)
T cd01896           2 RVALVGFPSVGKSTLLSKL---TNTK--SEVA----AYE------FTTLTCVPGVLEY-----KGAKIQLLDLPGIIEGA   61 (233)
T ss_pred             EEEEECCCCCCHHHHHHHH---HCCC--CCCC----CCC------CCCCCCEEEEEEE-----CCEEEEEEECCCCCCCC
T ss_conf             5999999999999999999---7899--5436----989------7875747779998-----99899999673002463


Q ss_pred             ------HHHHHHHHHHCCEEEEEEECCCCCCHH---------------------------------------------HH
Q ss_conf             ------799999997302689999868788655---------------------------------------------89
Q gi|254780321|r   92 ------TYEVSRSLSACEGSLLVVDATQGVEAQ---------------------------------------------TL  120 (606)
Q Consensus        92 ------~~EV~r~l~a~dgaiLvVdA~~Gvq~Q---------------------------------------------T~  120 (606)
                            +-++-..++-||..++|||+.+....+                                             ..
T Consensus        62 ~~g~g~g~~~l~~~r~aD~il~VvD~~~~~~~~~~i~~eLe~~gi~l~~~~~~v~i~~~~~~gi~i~~~~~~~~~~~~~v  141 (233)
T cd01896          62 ADGKGRGRQVIAVARTADLILMVLDATKPEGHREILERELEGVGIRLNKRPPNITIKKKKKGGINITSTVPLTKLDEKTI  141 (233)
T ss_pred             CCCCCHHHHHHHHHHHCCEEEEEEECCCCHHHHHHHHHHHHHHCCCCCCCCCCCEEEEECCCCEEEECCCCCCCCCHHHH
T ss_conf             33320689999998758999999847982667899999998605110357876257771358678604566666888999


Q ss_pred             HH----------------------HHHHHHCC---CCEEEEECCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHCCCC
Q ss_conf             99----------------------99999709---967998326788753211338887755532232100011100223
Q gi|254780321|r  121 AN----------------------VYQAIDNN---HEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEG  175 (606)
Q Consensus       121 ~~----------------------~~~A~~~~---l~~I~viNKiD~~~A~~e~v~~ei~~~~g~~~~~ii~vSAktG~G  175 (606)
                      ..                      +.-++..+   .|.|.|+||+|++..      ++++.+.  ...+++++||++|.|
T Consensus       142 ~~il~e~~i~~a~v~i~~~~t~dd~~d~i~~n~~y~P~i~V~NKiDl~~~------ee~~~~~--~~~~~i~ISA~~g~g  213 (233)
T cd01896         142 KAILREYKIHNADVLIREDITVDDLIDVIEGNRVYIPCLYVYNKIDLISI------EELDLLA--RQPNSVVISAEKGLN  213 (233)
T ss_pred             HHHHHHHCCCCCEEEECCCCCHHHHHHHHHCCCCCCCEEEEEECCCCCCH------HHHHHHH--CCCCEEEEECCCCCC
T ss_conf             99999827676437860578888989987357676737999974036998------9999864--679859998888989


Q ss_pred             CCHHHHHHHHHH
Q ss_conf             200678776321
Q gi|254780321|r  176 IPLLLERIVQQL  187 (606)
Q Consensus       176 V~~LLd~Iv~~i  187 (606)
                      +++|.+.|.+.+
T Consensus       214 ld~L~~~I~~~L  225 (233)
T cd01896         214 LDELKERIWDKL  225 (233)
T ss_pred             HHHHHHHHHHHH
T ss_conf             899999999983


No 191
>cd01864 Rab19 Rab19 subfamily.  Rab19 proteins are associated with Golgi stacks. Similarity analysis indicated that Rab41 is closely related to Rab19. However, the function of these Rabs is not yet chracterized. GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state.  Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilitate Rab recycling by masking C-terminal lipid binding and promoting cytosolic localization. Most Rab GTPases contain a lipid modification site at the C-terminus, with sequence motifs CC, CXC, or CCX. Lipid binding is essential for membrane attachment, a key feature of most Rab proteins.  Due to the presence of truncated sequences in this CD, the lipid modification site is not available for annotation.
Probab=99.33  E-value=3.5e-11  Score=94.52  Aligned_cols=153  Identities=18%  Similarity=0.278  Sum_probs=98.7

Q ss_pred             EEEEECCCCCCHHHHHHHHHHHCCCCCCCCCCCEEECCCHHHHHHCCEEEEEEEEEEEECCCCCEEEEEEEECCCCCHHH
Q ss_conf             79998013898778899999982980544443113058677987195052327999974378843899996178730027
Q gi|254780321|r   13 NFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVRLNYTSTDAKDYQLNLIDTPGHVDFT   92 (606)
Q Consensus        13 N~~IiaHvDhGKTTL~d~lL~~tg~i~~~~~~~~vlD~~~~EreRGITIka~~~~~~~~~~~~~~y~iNlIDTPGH~DF~   92 (606)
                      -++++|-...|||+|..|++  .|...+... .++          |+....+.  +   ..+++.+.+.+.||+|...|.
T Consensus         5 Kiv~lGd~~vGKTsli~r~~--~~~f~~~~~-~Ti----------~~~~~~k~--i---~~~~~~~~l~iwDtaG~e~~~   66 (165)
T cd01864           5 KIILIGDSNVGKTCVVQRFK--SGTFSERQG-NTI----------GVDFTMKT--L---EIEGKRVKLQIWDTAGQERFR   66 (165)
T ss_pred             EEEEECCCCCCHHHHHHHHH--HCCCCCCCC-CCC----------CEEEEEEE--E---EECCEEEEEEEEECCCCCCCC
T ss_conf             99999999958999999996--499999879-975----------43789999--9---999999999999899983445


Q ss_pred             HHHHHHHHHCCEEEEEEECCCCCCHHHH---HHHHH-HHH---CCCCEEEEECCCCCCCCCCCCHHHHHHHHHH-HHHHH
Q ss_conf             9999999730268999986878865589---99999-997---0996799832678875321133888775553-22321
Q gi|254780321|r   93 YEVSRSLSACEGSLLVVDATQGVEAQTL---ANVYQ-AID---NNHEIITVLNKADLPSADPDRVKKQIEETIG-ISTED  164 (606)
Q Consensus        93 ~EV~r~l~a~dgaiLvVdA~~Gvq~QT~---~~~~~-A~~---~~l~~I~viNKiD~~~A~~e~v~~ei~~~~g-~~~~~  164 (606)
                      .-....++-+|++|||.|.++   .+|.   ..|.. ...   .+.++|+|=||+|++.-+.- ..+|.+++-. .....
T Consensus        67 ~l~~~~~~~a~~~ilvydit~---~~Sf~~~~~w~~~i~~~~~~~~~iilVGNK~DL~~~r~V-~~~~~~~~a~~~~~~~  142 (165)
T cd01864          67 TITQSYYRSANGAIIAYDITR---RSSFESVPHWIEEVEKYGASNVVLLLIGNKCDLEEQREV-LFEEACTLAEKNGMLA  142 (165)
T ss_pred             CCCHHHEECCCEEEEEECCCC---HHHHHHHHHHHHHHHHHCCCCCCEEEEEECCCHHHHCCC-CHHHHHHHHHHCCCCE
T ss_conf             350755221566699713899---899999999999999876999843888772376862899-9999999999839976


Q ss_pred             HHHHHHHCCCCCCHHHHHHHHHH
Q ss_conf             00011100223200678776321
Q gi|254780321|r  165 ALLVSAKTGEGIPLLLERIVQQL  187 (606)
Q Consensus       165 ii~vSAktG~GV~~LLd~Iv~~i  187 (606)
                      .+.+|||+|.||+++++.+...+
T Consensus       143 ~~E~SAk~~~nV~e~F~~la~~i  165 (165)
T cd01864         143 VLETSAKESQNVEEAFLLMATEL  165 (165)
T ss_pred             EEEECCCCCCCHHHHHHHHHHHC
T ss_conf             99978885819899999999849


No 192
>cd04140 ARHI_like ARHI subfamily.  ARHI (A Ras homolog member I) is a member of the Ras family with several unique structural and functional properties.  ARHI is expressed in normal human ovarian and breast tissue, but its expression is decreased or eliminated in breast and ovarian cancer.  ARHI contains an N-terminal extension of 34 residues (human) that is required to retain its tumor suppressive activity.   Unlike most other Ras family members, ARHI is maintained in the constitutively active (GTP-bound) state in resting cells and has modest GTPase activity.  ARHI inhibits STAT3 (signal transducers and activators of transcription 3), a latent transcription factor whose abnormal activation plays a critical role in oncogenesis.  Most Ras proteins contain a lipid modification site at the C-terminus, with a typical sequence motif CaaX, where a = an aliphatic amino acid and X = any amino acid.  Lipid binding is essential for membrane attachment, a key feature of most Ras proteins.  Due to
Probab=99.33  E-value=3.7e-11  Score=94.35  Aligned_cols=151  Identities=22%  Similarity=0.213  Sum_probs=97.5

Q ss_pred             EEEEECCCCCCHHHHHHHHHHHCCCCCCCCCCCEEECCCHHHHHHCCEEEEEEEEEEEECCCCCEEEEEEEECCCCCHHH
Q ss_conf             79998013898778899999982980544443113058677987195052327999974378843899996178730027
Q gi|254780321|r   13 NFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVRLNYTSTDAKDYQLNLIDTPGHVDFT   92 (606)
Q Consensus        13 N~~IiaHvDhGKTTL~d~lL~~tg~i~~~~~~~~vlD~~~~EreRGITIka~~~~~~~~~~~~~~y~iNlIDTPGH~DF~   92 (606)
                      -++++|-.+-|||+|.-|++  .|.+.+.- ..              ||.. . .......+++.+.++|.||+|...|.
T Consensus         3 KivllGd~~VGKTsli~r~~--~~~F~~~y-~~--------------Ti~~-~-~~~~i~~~~~~~~l~iwDtaG~e~~~   63 (165)
T cd04140           3 RVVVFGAGGVGKSSLVLRFV--KGTFRESY-IP--------------TIED-T-YRQVISCSKNICTLQITDTTGSHQFP   63 (165)
T ss_pred             EEEEECCCCCCHHHHHHHHH--HCCCCCCC-CC--------------CCCC-E-EEEEEEECCEEEEEEEEECCCCCCCC
T ss_conf             99998999976999999996--49699986-88--------------4542-0-55899999999999999899984654


Q ss_pred             HHHHHHHHHCCEEEEEEECCCCCCHHHHHHHHH-HHH------CCCCEEEEECCCCCCCCCCCCHHHHHHH---HHHHHH
Q ss_conf             999999973026899998687886558999999-997------0996799832678875321133888775---553223
Q gi|254780321|r   93 YEVSRSLSACEGSLLVVDATQGVEAQTLANVYQ-AID------NNHEIITVLNKADLPSADPDRVKKQIEE---TIGIST  162 (606)
Q Consensus        93 ~EV~r~l~a~dgaiLvVdA~~Gvq~QT~~~~~~-A~~------~~l~~I~viNKiD~~~A~~e~v~~ei~~---~~g~~~  162 (606)
                      .-....++-+|++|||-|.+.=--=+....|+. ..+      .++|+++|-||+|+...+.- -.+|.++   .+++  
T Consensus        64 ~l~~~~~~~a~~~ilvydit~~~Sf~~~~~~~~~i~~~~~~~~~~~piilVgNK~Dl~~~r~V-~~~e~~~~a~~~~~--  140 (165)
T cd04140          64 AMQRLSISKGHAFILVYSVTSKQSLEELKPIYELICEIKGNNIEKIPIMLVGNKCDESHKREV-SSNEGAACATEWNC--  140 (165)
T ss_pred             CCHHHHHCCCCEEEEEECCCCHHHHHHHHHHHHHHHHHHHCCCCCCCEEEEEECCCCCCCCCC-CHHHHHHHHHHCCC--
T ss_conf             232445068857999813898789999999999999996158888878998642464002788-99999999998698--


Q ss_pred             HHHHHHHHHCCCCCCHHHHHHHHH
Q ss_conf             210001110022320067877632
Q gi|254780321|r  163 EDALLVSAKTGEGIPLLLERIVQQ  186 (606)
Q Consensus       163 ~~ii~vSAktG~GV~~LLd~Iv~~  186 (606)
                       ..+.+|||+|.||+++++.+++.
T Consensus       141 -~~~E~SAk~~~nV~e~F~~l~~l  163 (165)
T cd04140         141 -AFMETSAKTNHNVQELFQELLNL  163 (165)
T ss_pred             -EEEEECCCCCCCHHHHHHHHHHC
T ss_conf             -89997447794879999999814


No 193
>cd04118 Rab24 Rab24 subfamily.  Rab24 is distinct from other Rabs in several ways.  It exists primarily in the GTP-bound state, having a low intrinsic GTPase activity; it is not efficiently geranyl-geranylated at the C-terminus; it does not form a detectable complex with Rab GDP-dissociation inhibitors (GDIs); and it has recently been shown to undergo tyrosine phosphorylation when overexpressed in vitro. The specific function of Rab24 still remains unknown. It is found in a transport route between ER-cis-Golgi and late endocytic compartments.  It is putatively involved in an autophagic pathway, possibly directing misfolded proteins in the ER to degradative pathways.  GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state.  Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilita
Probab=99.32  E-value=9.1e-11  Score=91.77  Aligned_cols=156  Identities=17%  Similarity=0.246  Sum_probs=99.7

Q ss_pred             EEEECCCCCCHHHHHHHHHHHCCCCCCCCCCCEEECCCHHHHHHCCEEEEEEEEEEEECCCCCEEEEEEEECCCCCHHHH
Q ss_conf             99980138987788999999829805444431130586779871950523279999743788438999961787300279
Q gi|254780321|r   14 FSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVRLNYTSTDAKDYQLNLIDTPGHVDFTY   93 (606)
Q Consensus        14 ~~IiaHvDhGKTTL~d~lL~~tg~i~~~~~~~~vlD~~~~EreRGITIka~~~~~~~~~~~~~~y~iNlIDTPGH~DF~~   93 (606)
                      +.++|...-|||+|.-|++.  +.+....-              --||-.....-.+ ..+++.+.++|.||+|...|..
T Consensus         3 ivlvGd~~VGKTsLi~r~~~--~~f~~~~y--------------~~tig~~~~~k~i-~v~~~~v~l~iwDtaG~e~~~~   65 (193)
T cd04118           3 VVMLGKESVGKTSLVERYVH--HRFLVGPY--------------QNTIGAAFVAKRM-VVGERVVTLGIWDTAGSERYEA   65 (193)
T ss_pred             EEEECCCCCCHHHHHHHHHH--CCCCCCCC--------------CCCCEEEEEEEEE-EECCEEEEEEEEECCCCHHHHH
T ss_conf             99999699879999999985--97998997--------------8763058899999-9999999999991999731235


Q ss_pred             HHHHHHHHCCEEEEEEECCCCCCHHHH---HHHHHHH---HCCCCEEEEECCCCCCCCCC--CCH-HHHHHHHHHHHHHH
Q ss_conf             999999730268999986878865589---9999999---70996799832678875321--133-88877555322321
Q gi|254780321|r   94 EVSRSLSACEGSLLVVDATQGVEAQTL---ANVYQAI---DNNHEIITVLNKADLPSADP--DRV-KKQIEETIGISTED  164 (606)
Q Consensus        94 EV~r~l~a~dgaiLvVdA~~Gvq~QT~---~~~~~A~---~~~l~~I~viNKiD~~~A~~--e~v-~~ei~~~~g~~~~~  164 (606)
                      -.....+-++++|||.|-++   .+|.   ..|..-+   ..+.++++|-||+|+..-+.  ..| .+|..++..--.-.
T Consensus        66 l~~~y~~~a~~~ilvydit~---~~Sf~~i~~W~~~i~~~~~~~~iilVGnK~DL~~~~~~~r~V~~~e~~~~a~~~~~~  142 (193)
T cd04118          66 MSRIYYRGAKAAIVCYDLTD---SSSFERAKFWVKELQNLEEHCKIYLCGTKSDLIEQDRSLRQVDFHDVQDFADEIKAQ  142 (193)
T ss_pred             HHHHHHCCCCEEEEEECCCC---HHHHHHHHHHHHHHHHHCCCCCEEEEEECHHHHHCCCCCCCCCHHHHHHHHHHCCCE
T ss_conf             57988347744578830698---799998999999999748999979997746632201666446899999999980996


Q ss_pred             HHHHHHHCCCCCCHHHHHHHHHHHC
Q ss_conf             0001110022320067877632100
Q gi|254780321|r  165 ALLVSAKTGEGIPLLLERIVQQLPS  189 (606)
Q Consensus       165 ii~vSAktG~GV~~LLd~Iv~~iP~  189 (606)
                      .+.+|||+|.||+++++.|++.+-.
T Consensus       143 ~~E~SAktg~nV~e~F~~la~~i~~  167 (193)
T cd04118         143 HFETSSKTGQNVDELFQKVAEDFVS  167 (193)
T ss_pred             EEEECCCCCCCHHHHHHHHHHHHHH
T ss_conf             9998389893989999999999997


No 194
>cd04122 Rab14 Rab14 subfamily.  Rab14 GTPases are localized to biosynthetic compartments, including the rough ER, the Golgi complex, and the trans-Golgi network, and to endosomal compartments, including early endosomal vacuoles and associated vesicles.  Rab14 is believed to function in both the biosynthetic and recycling pathways between the Golgi and endosomal compartments.  Rab14 has also been identified on GLUT4 vesicles, and has been suggested to help regulate GLUT4 translocation.  In addition, Rab14 is believed to play a role in the regulation of phagocytosis.  GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state.  Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilitate Rab recycling by masking C-terminal lipid binding and promoting cytosolic localization.  Most Rab GT
Probab=99.32  E-value=3.6e-11  Score=94.46  Aligned_cols=156  Identities=21%  Similarity=0.271  Sum_probs=99.6

Q ss_pred             EEEEECCCCCCHHHHHHHHHHHCCCCCCCCCCCEEECCCHHHHHHCCEEEEEEEEEEEECCCCCEEEEEEEECCCCCHHH
Q ss_conf             79998013898778899999982980544443113058677987195052327999974378843899996178730027
Q gi|254780321|r   13 NFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVRLNYTSTDAKDYQLNLIDTPGHVDFT   92 (606)
Q Consensus        13 N~~IiaHvDhGKTTL~d~lL~~tg~i~~~~~~~~vlD~~~~EreRGITIka~~~~~~~~~~~~~~y~iNlIDTPGH~DF~   92 (606)
                      -+.++|-..-|||+|.-|++  .+.+...- ..+          =|++...+.+.     .+++.++++|.||+|+..|.
T Consensus         4 KivlvGd~~VGKTsli~r~~--~~~f~~~~-~~T----------ig~~~~~k~i~-----~~~~~~~l~iwDtaG~e~~~   65 (166)
T cd04122           4 KYIIIGDMGVGKSCLLHQFT--EKKFMADC-PHT----------IGVEFGTRIIE-----VNGQKIKLQIWDTAGQERFR   65 (166)
T ss_pred             EEEEECCCCCCHHHHHHHHH--CCCCCCCC-CCC----------CCEEEEEEEEE-----ECCEEEEEEEEECCCCCCCC
T ss_conf             99999999957999999991--29889999-997----------44688999999-----99999999999899985444


Q ss_pred             HHHHHHHHHCCEEEEEEECCCCCCHHHHHHHH-HHHHC---CCCEEEEECCCCCCCCCCCCHHHHHHHHHHHHHHHHHHH
Q ss_conf             99999997302689999868788655899999-99970---996799832678875321133888775553223210001
Q gi|254780321|r   93 YEVSRSLSACEGSLLVVDATQGVEAQTLANVY-QAIDN---NHEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLV  168 (606)
Q Consensus        93 ~EV~r~l~a~dgaiLvVdA~~Gvq~QT~~~~~-~A~~~---~l~~I~viNKiD~~~A~~e~v~~ei~~~~g~~~~~ii~v  168 (606)
                      .-....++-++++|||.|.+.=--=+-...|. .+...   +.++++|-||+|++..+. -..+|..++..-..-..+.+
T Consensus        66 ~~~~~~~~~a~~~ilvydvt~~~Sf~~l~~w~~~~~~~~~~~~~iilVGNK~DL~~~r~-V~~~e~~~~a~~~~~~~~E~  144 (166)
T cd04122          66 AVTRSYYRGAAGALMVYDITRRSTYNHLSSWLTDARNLTNPNTVIFLIGNKADLEAQRD-VTYEEAKQFADENGLLFLEC  144 (166)
T ss_pred             CCCHHHEECCCEEEEEECCCCHHHHHHHHHHHHHHHHHCCCCCEEEECCCCCCHHHCCC-CCHHHHHHHHHHCCCEEEEE
T ss_conf             25211143154659972587476799999999999985699975870340157444389-99999999999869989998


Q ss_pred             HHHCCCCCCHHHHHHHHHH
Q ss_conf             1100223200678776321
Q gi|254780321|r  169 SAKTGEGIPLLLERIVQQL  187 (606)
Q Consensus       169 SAktG~GV~~LLd~Iv~~i  187 (606)
                      |||+|.||++++..+++.+
T Consensus       145 SAk~g~nV~e~F~~l~~~i  163 (166)
T cd04122         145 SAKTGENVEDAFLETAKKI  163 (166)
T ss_pred             CCCCCCCHHHHHHHHHHHH
T ss_conf             6587808899999999999


No 195
>cd04126 Rab20 Rab20 subfamily.  Rab20 is one of several Rab proteins that appear to be restricted in expression to the apical domain of murine polarized epithelial cells.  It is expressed on the apical side of polarized kidney tubule and intestinal epithelial cells, and in non-polarized cells. It also localizes to vesico-tubular structures below the apical brush border of renal proximal tubule cells and in the apical region of duodenal epithelial cells.  Rab20 has also been shown to colocalize with vacuolar H+-ATPases (V-ATPases) in mouse kidney cells, suggesting a role in the regulation of V-ATPase traffic in specific portions of the nephron.  It was also shown to be one of several proteins whose expression is upregulated in human myelodysplastic syndrome (MDS) patients. GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bo
Probab=99.32  E-value=3.8e-11  Score=94.27  Aligned_cols=149  Identities=19%  Similarity=0.265  Sum_probs=96.6

Q ss_pred             EEEECCCCCCHHHHHHHHHHHCCCCCCCCCCCEEECCCHHHHHHCCEEEEEEEEEEEECCCCCEEEEEEEECCCCCHHHH
Q ss_conf             99980138987788999999829805444431130586779871950523279999743788438999961787300279
Q gi|254780321|r   14 FSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVRLNYTSTDAKDYQLNLIDTPGHVDFTY   93 (606)
Q Consensus        14 ~~IiaHvDhGKTTL~d~lL~~tg~i~~~~~~~~vlD~~~~EreRGITIka~~~~~~~~~~~~~~y~iNlIDTPGH~DF~~   93 (606)
                      +.++|...-|||+|+-|+.  .+.+.+.                --||     ...|....++.|.++|.||+|+..|..
T Consensus         3 ivllGd~~VGKTsl~~rf~--~~~F~~~----------------~~Ti-----g~~~~~k~~~~~~l~IwDTaGqE~f~s   59 (220)
T cd04126           3 VVLLGDMNVGKTSLLHRYM--ERRFKDT----------------VSTV-----GGAFYLKQWGPYNISIWDTAGREQFHG   59 (220)
T ss_pred             EEEECCCCCCHHHHHHHHH--HCCCCCC----------------CCCC-----CEEEEEEECCEEEEEEEECCCCCCCCC
T ss_conf             9999999988999999997--2989998----------------8871-----368999876478899994798622433


Q ss_pred             HHHHHHHHCCEEEEEEECCCCCCHHHHH---HHHHHHH----CCCCEEEEECCCCCCCCC-----------------CCC
Q ss_conf             9999997302689999868788655899---9999997----099679983267887532-----------------113
Q gi|254780321|r   94 EVSRSLSACEGSLLVVDATQGVEAQTLA---NVYQAID----NNHEIITVLNKADLPSAD-----------------PDR  149 (606)
Q Consensus        94 EV~r~l~a~dgaiLvVdA~~Gvq~QT~~---~~~~A~~----~~l~~I~viNKiD~~~A~-----------------~e~  149 (606)
                      -.....+-++|+|||-|.+.   .+|..   .|+.-+.    .+.++|+|=||+|+..-.                 ...
T Consensus        60 l~~~y~r~a~~~ilvyDit~---~~Sf~~l~~~~~~~~~~~~~~~~~ilVGNK~DL~~~~~~~~~~~~~~~~~~~~~~r~  136 (220)
T cd04126          60 LGSMYCRGAAAVILTYDVSN---VQSLEELEDRFLGLTDTANEDCLFAVVGNKLDLTEEGALAGQEKDAGDRVSPEDQRQ  136 (220)
T ss_pred             CHHHHHCCCCEEEEEEECCC---HHHHHHHHHHHHHHHHHCCCCCEEEEEEECHHCCCCCCCCCCCCCCCCCCCCCCCCC
T ss_conf             26888567988999997989---899999999999999847999808999887121364344333333322344100354


Q ss_pred             H-HHHHHHH-------HHHHHH-------HHHHHHHHCCCCCCHHHHHHHHHHH
Q ss_conf             3-8887755-------532232-------1000111002232006787763210
Q gi|254780321|r  150 V-KKQIEET-------IGISTE-------DALLVSAKTGEGIPLLLERIVQQLP  188 (606)
Q Consensus       150 v-~~ei~~~-------~g~~~~-------~ii~vSAktG~GV~~LLd~Iv~~iP  188 (606)
                      | .++.+++       .+++..       -.+.+|||+|.||+++++.|++.+-
T Consensus       137 Vs~ee~~~~a~~~~~~~~~~~~~~~~~~~~~fEtSAKtg~nV~e~F~~i~~~i~  190 (220)
T cd04126         137 VTLEDAKAFYKRINKYKMLDEDLSPAAEKMCFETSAKTGYNVDELFEYLFNLVL  190 (220)
T ss_pred             CCHHHHHHHHHHHHHHCCCCCCCCCCCCCEEEEEECCCCCCHHHHHHHHHHHHH
T ss_conf             489999999998502202221111245776999147899798999999999999


No 196
>cd01865 Rab3 Rab3 subfamily.  The Rab3 subfamily contains Rab3A, Rab3B, Rab3C, and Rab3D.  All four isoforms were found in mouse brain and endocrine tissues, with varying levels of expression.  Rab3A, Rab3B, and Rab3C localized to synaptic and secretory vesicles; Rab3D was expressed at high levels only in adipose tissue, exocrine glands, and the endocrine pituitary, where it is localized to cytoplasmic secretory granules.  Rab3 appears to control Ca2+-regulated exocytosis. The appropriate GDP/GTP exchange cycle of Rab3A is required for Ca2+-regulated exocytosis to occur, and interaction of the GTP-bound form of Rab3A with effector molecule(s) is widely believed to be essential for this process. Functionally, most studies point toward a role for Rab3 in the secretion of hormones and neurotransmitters. GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promot
Probab=99.32  E-value=5.8e-11  Score=93.07  Aligned_cols=154  Identities=23%  Similarity=0.313  Sum_probs=99.5

Q ss_pred             EEEEECCCCCCHHHHHHHHHHHCCCCCCCCCCCEEECCCHHHHHHCCEEEEEEEEEEEECCCCCEEEEEEEECCCCCHHH
Q ss_conf             79998013898778899999982980544443113058677987195052327999974378843899996178730027
Q gi|254780321|r   13 NFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVRLNYTSTDAKDYQLNLIDTPGHVDFT   92 (606)
Q Consensus        13 N~~IiaHvDhGKTTL~d~lL~~tg~i~~~~~~~~vlD~~~~EreRGITIka~~~~~~~~~~~~~~y~iNlIDTPGH~DF~   92 (606)
                      -++++|...-|||+|.-|++  .+.+...-. .++          |+....+.+     ..+.+.+.++|.||+|...|.
T Consensus         3 KivllGd~~VGKTsli~r~~--~~~f~~~y~-~Ti----------g~~~~~k~i-----~~~~~~i~l~iwDtaGqe~~~   64 (165)
T cd01865           3 KLLIIGNSSVGKTSFLFRYA--DDSFTSAFV-STV----------GIDFKVKTV-----FRNDKRVKLQIWDTAGQERYR   64 (165)
T ss_pred             EEEEECCCCCCHHHHHHHHH--CCCCCCCCC-CCC----------CEEEEEEEE-----EECCEEEEEEEEECCCCCCCC
T ss_conf             99999999968899999992--498899768-876----------378799999-----999999999999699983455


Q ss_pred             HHHHHHHHHCCEEEEEEECCCCCCHHHHHHHHH-HHHC---CCCEEEEECCCCCCCCCCCC--HHHHHHHHHHHHHHHHH
Q ss_conf             999999973026899998687886558999999-9970---99679983267887532113--38887755532232100
Q gi|254780321|r   93 YEVSRSLSACEGSLLVVDATQGVEAQTLANVYQ-AIDN---NHEIITVLNKADLPSADPDR--VKKQIEETIGISTEDAL  166 (606)
Q Consensus        93 ~EV~r~l~a~dgaiLvVdA~~Gvq~QT~~~~~~-A~~~---~l~~I~viNKiD~~~A~~e~--v~~ei~~~~g~~~~~ii  166 (606)
                      .-....++-++|++||.|.++=--=+....|.. ....   +.++++|-||+|+.+.+.-.  -.+++.+.+++   ..+
T Consensus        65 ~l~~~y~~~a~~~ilvydit~~~Sf~~~~~w~~~i~~~~~~~~~iilvgNK~DL~~~r~v~~~~~~~~a~~~~~---~~~  141 (165)
T cd01865          65 TITTAYYRGAMGFILMYDITNEESFNAVQDWSTQIKTYSWDNAQVILVGNKCDMEDERVVSSERGRQLADQLGF---EFF  141 (165)
T ss_pred             CCHHHHHHCCCEEEEEECCCCHHHHHHHHHHHHHHHHHCCCCCEEEEEECCCCHHHCCCCCHHHHHHHHHHCCC---EEE
T ss_conf             44154411354489985178879999999999999986898725999602423555188999999999998699---799


Q ss_pred             HHHHHCCCCCCHHHHHHHHHH
Q ss_conf             011100223200678776321
Q gi|254780321|r  167 LVSAKTGEGIPLLLERIVQQL  187 (606)
Q Consensus       167 ~vSAktG~GV~~LLd~Iv~~i  187 (606)
                      .+|||+|.||+++++.+++.+
T Consensus       142 E~SAk~~~nV~e~F~~l~~~i  162 (165)
T cd01865         142 EASAKENINVKQVFERLVDII  162 (165)
T ss_pred             EECCCCCCCHHHHHHHHHHHH
T ss_conf             976898908899999999999


No 197
>cd01861 Rab6 Rab6 subfamily.  Rab6 is involved in microtubule-dependent transport pathways through the Golgi and from endosomes to the Golgi. Rab6A of mammals is implicated in retrograde transport through the Golgi stack, and is also required for a slow, COPI-independent, retrograde transport pathway from the Golgi to the endoplasmic reticulum (ER). This pathway may allow Golgi residents to be recycled through the ER for scrutiny by ER quality-control systems. Yeast Ypt6p, the homolog of the mammalian Rab6 GTPase, is not essential for cell viability. Ypt6p acts in endosome-to-Golgi, in intra-Golgi retrograde transport, and possibly also in Golgi-to-ER trafficking.  GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state.  Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilitate
Probab=99.32  E-value=9.2e-11  Score=91.73  Aligned_cols=156  Identities=21%  Similarity=0.270  Sum_probs=101.1

Q ss_pred             EEEEECCCCCCHHHHHHHHHHHCCCCCCCCCCCEEECCCHHHHHHCCEEEEEEEEEEEECCCCCEEEEEEEECCCCCHHH
Q ss_conf             79998013898778899999982980544443113058677987195052327999974378843899996178730027
Q gi|254780321|r   13 NFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVRLNYTSTDAKDYQLNLIDTPGHVDFT   92 (606)
Q Consensus        13 N~~IiaHvDhGKTTL~d~lL~~tg~i~~~~~~~~vlD~~~~EreRGITIka~~~~~~~~~~~~~~y~iNlIDTPGH~DF~   92 (606)
                      -++++|..+.|||||+-|++  .+......           +..-|+......+.     .+++.+.++|+||+|...|.
T Consensus         2 Ki~vvG~~~vGKTsli~r~~--~~~f~~~~-----------~~tig~d~~~k~v~-----~~~~~~~l~i~D~~g~e~~~   63 (161)
T cd01861           2 KLVFLGDQSVGKTSIITRFM--YDTFDNQY-----------QATIGIDFLSKTMY-----LEDKTVRLQLWDTAGQERFR   63 (161)
T ss_pred             EEEEECCCCCCHHHHHHHHH--HCCCCCCC-----------CCCCCEEEEEEEEE-----ECCEEEEEEEEECCCCHHHH
T ss_conf             79999979978999999993--19999984-----------89756788999999-----99999999999799853157


Q ss_pred             HHHHHHHHHCCEEEEEEECCCCCCHHHHHHHHHHHH----CCCCEEEEECCCCCCCCCCCCHHHHHHHHHHHHHHHHHHH
Q ss_conf             999999973026899998687886558999999997----0996799832678875321133888775553223210001
Q gi|254780321|r   93 YEVSRSLSACEGSLLVVDATQGVEAQTLANVYQAID----NNHEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLV  168 (606)
Q Consensus        93 ~EV~r~l~a~dgaiLvVdA~~Gvq~QT~~~~~~A~~----~~l~~I~viNKiD~~~A~~e~v~~ei~~~~g~~~~~ii~v  168 (606)
                      .-....++-++++++|.|.++----+....|+.-..    ...++++|-||+|+++.+.-. .+|.+++..-..-..+.+
T Consensus        64 ~~~~~~~~~~~~~ilvfd~t~~~Sf~~~~~w~~~i~~~~~~~~~ivlvGnK~Dl~~~r~v~-~~e~~~~a~~~~~~y~E~  142 (161)
T cd01861          64 SLIPSYIRDSSVAVVVYDITNRQSFDNTDKWIDDVRDERGNDVIIVLVGNKTDLSDKRQVS-TEEGEKKAKELNAMFIET  142 (161)
T ss_pred             HHHHHHHHHHCEEEEEEECCCHHHHHHHHHHHHHHHHHCCCCCEEEEEEECCCCHHCCCCC-HHHHHHHHHHCCCEEEEE
T ss_conf             8889886652589999847998999999999999998657898499961021102217789-999999999849989998


Q ss_pred             HHHCCCCCCHHHHHHHHHH
Q ss_conf             1100223200678776321
Q gi|254780321|r  169 SAKTGEGIPLLLERIVQQL  187 (606)
Q Consensus       169 SAktG~GV~~LLd~Iv~~i  187 (606)
                      |||+|.||+++++.|...+
T Consensus       143 Sak~~~nV~e~F~~la~~l  161 (161)
T cd01861         143 SAKAGHNVKELFRKIASAL  161 (161)
T ss_pred             CCCCCCCHHHHHHHHHHHC
T ss_conf             3477808899999999709


No 198
>cd04136 Rap_like Rap-like subfamily.  The Rap subfamily consists of the Rap1, Rap2, and RSR1.  Rap subfamily proteins perform different cellular functions, depending on the isoform and its subcellular localization. For example, in rat salivary gland, neutrophils, and platelets, Rap1 localizes to secretory granules and is believed to regulate exocytosis or the formation of secretory granules.  Rap1 has also been shown to localize in the Golgi of rat fibroblasts, zymogen granules, plasma membrane, and microsomal membrane of the pancreatic acini, as well as in the endocytic compartment of skeletal muscle cells and fibroblasts.   Rap1 localizes in the nucleus of human oropharyngeal squamous cell carcinomas (SCCs) and cell lines.  Rap1 plays a role in phagocytosis by controlling the binding of adhesion receptors (typically integrins) to their ligands.  In yeast, Rap1 has been implicated in multiple functions, including activation and silencing of transcription and maintenance of telomeres. 
Probab=99.32  E-value=5.9e-11  Score=93.05  Aligned_cols=148  Identities=21%  Similarity=0.284  Sum_probs=99.5

Q ss_pred             EEEECCCCCCHHHHHHHHHHHCCCCCCCCCCCEEECCCHHHHHHCCEEEE-EEEEEEEECCCCCEEEEEEEECCCCCHHH
Q ss_conf             99980138987788999999829805444431130586779871950523-27999974378843899996178730027
Q gi|254780321|r   14 FSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKA-QTVRLNYTSTDAKDYQLNLIDTPGHVDFT   92 (606)
Q Consensus        14 ~~IiaHvDhGKTTL~d~lL~~tg~i~~~~~~~~vlD~~~~EreRGITIka-~~~~~~~~~~~~~~y~iNlIDTPGH~DF~   92 (606)
                      ++++|-..-|||+|.-|++  .|.+.+.- ..              ||.. ....+.   .+++.+.++|.||+|+.+|.
T Consensus         4 ivllGd~~VGKTsli~r~~--~~~f~~~y-~~--------------Ti~~~~~k~i~---~~~~~~~l~iwDtaG~e~~~   63 (163)
T cd04136           4 VVVLGSGGVGKSALTVQFV--QGIFVEKY-DP--------------TIEDSYRKQIE---VDGQQCMLEILDTAGTEQFT   63 (163)
T ss_pred             EEEECCCCCCHHHHHHHHH--HCCCCCCC-CC--------------CCCCEEEEEEE---ECCEEEEEEECCCCCCHHHH
T ss_conf             9998999988999999997--19598866-99--------------54206999999---99999999864576544555


Q ss_pred             HHHHHHHHHCCEEEEEEECCCCCCHHHHH---HHHHH-H----HCCCCEEEEECCCCCCCCCCC--CHHHHHHHHHHHHH
Q ss_conf             99999997302689999868788655899---99999-9----709967998326788753211--33888775553223
Q gi|254780321|r   93 YEVSRSLSACEGSLLVVDATQGVEAQTLA---NVYQA-I----DNNHEIITVLNKADLPSADPD--RVKKQIEETIGIST  162 (606)
Q Consensus        93 ~EV~r~l~a~dgaiLvVdA~~Gvq~QT~~---~~~~A-~----~~~l~~I~viNKiD~~~A~~e--~v~~ei~~~~g~~~  162 (606)
                      .-....++-+||+|||.|.++   .+|..   .|+.- .    ..++|+++|-||+|+...+.-  +-.+++...+++  
T Consensus        64 ~~~~~y~~~a~~~ilvydvt~---~~Sf~~l~~~~~~i~~~~~~~~~piilVGnK~Dl~~~r~v~~~~~~~~a~~~~~--  138 (163)
T cd04136          64 AMRDLYIKNGQGFVLVYSITS---QSSFNDLQDLREQILRVKDTENVPMVLVGNKCDLEDERVVSREEGQALARQWGC--  138 (163)
T ss_pred             HHHHHHHCCCCEEEEEECCCC---HHHHHHHHHHHHHHHHHCCCCCCCEEEEECCCCHHHHCCCCHHHHHHHHHHCCC--
T ss_conf             678988346876999704898---899999999999999861888886787623547264078999999999998499--


Q ss_pred             HHHHHHHHHCCCCCCHHHHHHHHHH
Q ss_conf             2100011100223200678776321
Q gi|254780321|r  163 EDALLVSAKTGEGIPLLLERIVQQL  187 (606)
Q Consensus       163 ~~ii~vSAktG~GV~~LLd~Iv~~i  187 (606)
                       ..+.+|||+|.||+++++.++..+
T Consensus       139 -~~~E~SAk~~~nV~e~F~~l~~~i  162 (163)
T cd04136         139 -PFYETSAKSKINVDEVFADLVRQI  162 (163)
T ss_pred             -EEEEECCCCCCCHHHHHHHHHHHH
T ss_conf             -899974487805899999999963


No 199
>cd04106 Rab23_lke Rab23-like subfamily.  Rab23 is a member of the Rab family of small GTPases. In mouse, Rab23 has been shown to function as a negative regulator in the sonic hedgehog (Shh) signalling pathway. Rab23 mediates the activity of Gli2 and Gli3, transcription factors that regulate Shh signaling in the spinal cord, primarily by preventing Gli2 activation in the absence of Shh ligand. Rab23 also regulates a step in the cytoplasmic signal transduction pathway that mediates the effect of Smoothened (one of two integral membrane proteins that are essential components of the Shh signaling pathway in vertebrates). In humans, Rab23 is expressed in the retina.  Mice contain an isoform that shares 93% sequence identity with the human Rab23 and an alternative splicing isoform that is specific to the brain. This isoform causes the murine open brain phenotype, indicating it may have a role in the development of the central nervous system.  GTPase activating proteins (GAPs) interact with G
Probab=99.32  E-value=4.3e-11  Score=93.94  Aligned_cols=156  Identities=18%  Similarity=0.233  Sum_probs=101.6

Q ss_pred             EEEECCCCCCHHHHHHHHHHHCCCCCCCCCCCEEECCCHHHHHHCCEEEEEEEEEEEECCCCCEEEEEEEECCCCCHHHH
Q ss_conf             99980138987788999999829805444431130586779871950523279999743788438999961787300279
Q gi|254780321|r   14 FSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVRLNYTSTDAKDYQLNLIDTPGHVDFTY   93 (606)
Q Consensus        14 ~~IiaHvDhGKTTL~d~lL~~tg~i~~~~~~~~vlD~~~~EreRGITIka~~~~~~~~~~~~~~y~iNlIDTPGH~DF~~   93 (606)
                      ++++|...-|||+|..|++  .+.+...- ..          .-|+....+.+.+   ..+++.+.++|.||+|...|..
T Consensus         3 ivvlGd~~VGKTsLi~r~~--~~~f~~~y-~~----------Tig~~~~~k~i~~---~~~~~~v~l~iwDtaG~e~~~~   66 (162)
T cd04106           3 VIVVGNGNVGKSSMIQRFV--KGIFTKDY-KK----------TIGVDFLEKQIFL---RQSDEDVRLMLWDTAGQEEFDA   66 (162)
T ss_pred             EEEECCCCCCHHHHHHHHH--HCCCCCCC-CC----------CCCCEEEEEEEEE---CCCCEEEEEEEEECCCCCCCCC
T ss_conf             9999999988999999998--49689876-88----------5562578878998---6799799999997899701341


Q ss_pred             HHHHHHHHCCEEEEEEECCCCCCHHHHHHHHHHHH---CCCCEEEEECCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             99999973026899998687886558999999997---099679983267887532113388877555322321000111
Q gi|254780321|r   94 EVSRSLSACEGSLLVVDATQGVEAQTLANVYQAID---NNHEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSA  170 (606)
Q Consensus        94 EV~r~l~a~dgaiLvVdA~~Gvq~QT~~~~~~A~~---~~l~~I~viNKiD~~~A~~e~v~~ei~~~~g~~~~~ii~vSA  170 (606)
                      -....++-+|++|||.|.+.=--=+....|+.-++   .++|+|+|-||+|+..-+. -..+|.+++..--.-..+.+||
T Consensus        67 l~~~~~~~a~~~ilvydvt~~~Sf~~l~~w~~~~~~~~~~~piilVgNK~DL~~~r~-V~~~e~~~~a~~~~~~~~E~SA  145 (162)
T cd04106          67 ITKAYYRGAQACILVFSTTDRESFEAIESWKEKVEAECGDIPMVLVQTKIDLLDQAV-ITNEEAEALAKRLQLPLFRTSV  145 (162)
T ss_pred             CHHHHHHHHCCEEEEEECCCHHHHHHHHHHHHHHHHHCCCCCEEEEECCHHHHHCCC-CCHHHHHHHHHHCCCEEEEECC
T ss_conf             524561230312688406988999999999999997669962999840544410177-8999999999986987999868


Q ss_pred             HCCCCCCHHHHHHHHH
Q ss_conf             0022320067877632
Q gi|254780321|r  171 KTGEGIPLLLERIVQQ  186 (606)
Q Consensus       171 ktG~GV~~LLd~Iv~~  186 (606)
                      |+|.||+++++.+.++
T Consensus       146 k~~~nV~e~F~~la~k  161 (162)
T cd04106         146 KDDFNVTELFEYLAEK  161 (162)
T ss_pred             CCCCCHHHHHHHHHHH
T ss_conf             8882989999999960


No 200
>PRK09554 feoB ferrous iron transport protein B; Reviewed
Probab=99.32  E-value=6.2e-11  Score=92.88  Aligned_cols=153  Identities=20%  Similarity=0.328  Sum_probs=104.8

Q ss_pred             HHHCEEEEEECCCCCCHHHHHHHHHHHCCCCCCCCCCCEEECCCHHHHHHCCEEEEEEEEEEEECCCCCEEEEEEEECCC
Q ss_conf             52531799980138987788999999829805444431130586779871950523279999743788438999961787
Q gi|254780321|r    8 LSRIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVRLNYTSTDAKDYQLNLIDTPG   87 (606)
Q Consensus         8 ~~~IRN~~IiaHvDhGKTTL~d~lL~~tg~i~~~~~~~~vlD~~~~EreRGITIka~~~~~~~~~~~~~~y~iNlIDTPG   87 (606)
                      |++| +||++|.-..|||||--+|   ||.-.  ..+|.          -|.|+.-+.-.+.|     +++.+.++|.||
T Consensus         1 Mk~i-~IALvGNPN~GKSTLFN~L---TG~~q--~VgNw----------PGvTVEkk~G~~~~-----~~~~~~ivDLPG   59 (772)
T PRK09554          1 MKKL-TIGLIGNPNSGKTTLFNQL---TGARQ--RVGNW----------AGVTVERKEGQFST-----TDHQVTLVDLPG   59 (772)
T ss_pred             CCCC-EEEEECCCCCCHHHHHHHH---HCCCC--EEECC----------CCCEEEEEEEEEEE-----CCCEEEEEECCC
T ss_conf             9735-6998889987899999998---68998--35789----------97647423899996-----894699997997


Q ss_pred             CCHHH---------HHHHHH-HH--HCCEEEEEEECCCCCCHHHHHHHHHH---HHCCCCEEEEECCCCCCCCCCCC-HH
Q ss_conf             30027---------999999-97--30268999986878865589999999---97099679983267887532113-38
Q gi|254780321|r   88 HVDFT---------YEVSRS-LS--ACEGSLLVVDATQGVEAQTLANVYQA---IDNNHEIITVLNKADLPSADPDR-VK  151 (606)
Q Consensus        88 H~DF~---------~EV~r~-l~--a~dgaiLvVdA~~Gvq~QT~~~~~~A---~~~~l~~I~viNKiD~~~A~~e~-v~  151 (606)
                      --..+         ..|.|- +.  -.|.++.||||+.     -..++|++   ++.|+|.|+++|.||.-..+=-+ =.
T Consensus        60 ~YSL~~~S~e~s~dE~Var~~ll~~~pDvvvnVvDAtn-----LeRnLyLt~QllElg~PvVvaLNM~D~A~~~Gi~ID~  134 (772)
T PRK09554         60 TYSLTTISSQTSLDEQIACHYILSGDADLLINVVDASN-----LERNLYLTLQLLELGIPCIVALNMLDIAEKQNIRIDI  134 (772)
T ss_pred             CCCCCCCCCCCCCHHHHHHHHHHCCCCCEEEEEEECCC-----HHHHHHHHHHHHHCCCCEEEEEECHHHHHHCCCEECH
T ss_conf             78699999777730899999861399989999801687-----5442899999997499989998779989887793289


Q ss_pred             HHHHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHC
Q ss_conf             88775553223210001110022320067877632100
Q gi|254780321|r  152 KQIEETIGISTEDALLVSAKTGEGIPLLLERIVQQLPS  189 (606)
Q Consensus       152 ~ei~~~~g~~~~~ii~vSAktG~GV~~LLd~Iv~~iP~  189 (606)
                      +.+++.+|++   ++++||.+|.|+++|.++|.+.-++
T Consensus       135 ~~Ls~~LGvP---VV~~~A~~g~Gi~eL~~ai~~~~~~  169 (772)
T PRK09554        135 DALSARLGCP---VIPLVSTRGRGIEALKLAIDRYKAN  169 (772)
T ss_pred             HHHHHHHCCC---EEEEEECCCCCHHHHHHHHHHHHCC
T ss_conf             9999985899---8999827887999999999975225


No 201
>smart00174 RHO Rho (Ras homology) subfamily of Ras-like small GTPases. Members of this subfamily of Ras-like small GTPases include Cdc42 and Rac, as well as Rho isoforms.
Probab=99.31  E-value=6.9e-11  Score=92.59  Aligned_cols=157  Identities=23%  Similarity=0.252  Sum_probs=97.4

Q ss_pred             EEEECCCCCCHHHHHHHHHHHCCCCCCCCCCCEEECCCHHHHHHCCEEEE-EEEEEEEECCCCCEEEEEEEECCCCCHHH
Q ss_conf             99980138987788999999829805444431130586779871950523-27999974378843899996178730027
Q gi|254780321|r   14 FSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKA-QTVRLNYTSTDAKDYQLNLIDTPGHVDFT   92 (606)
Q Consensus        14 ~~IiaHvDhGKTTL~d~lL~~tg~i~~~~~~~~vlD~~~~EreRGITIka-~~~~~~~~~~~~~~y~iNlIDTPGH~DF~   92 (606)
                      ++++|-.+-|||+|.-|++  .+.+...- .              -||-. ....+.   .+++.+.++|.||+|+.+|.
T Consensus         1 ivllGd~~VGKTsli~r~~--~~~f~~~y-~--------------~Ti~~~~~~~~~---~~~~~~~l~i~DtaG~e~~~   60 (174)
T smart00174        1 LVVVGDGAVGKTCLLISYT--TNAFPEDY-V--------------PTVFENYSADVE---VDGKPVELGLWDTAGQEDYD   60 (174)
T ss_pred             EEEECCCCCCHHHHHHHHH--HCCCCCCC-C--------------CCEEEEEEEEEE---ECCEEEEEEEEECCCCCCCC
T ss_conf             5998978975999999995--39899985-7--------------850578999999---99999999999489870345


Q ss_pred             HHHHHHHHHCCEEEEEEECCCCCCHHHHHH-HHHHH---HCCCCEEEEECCCCCCCCCC----------CCHH-HHHHHH
Q ss_conf             999999973026899998687886558999-99999---70996799832678875321----------1338-887755
Q gi|254780321|r   93 YEVSRSLSACEGSLLVVDATQGVEAQTLAN-VYQAI---DNNHEIITVLNKADLPSADP----------DRVK-KQIEET  157 (606)
Q Consensus        93 ~EV~r~l~a~dgaiLvVdA~~Gvq~QT~~~-~~~A~---~~~l~~I~viNKiD~~~A~~----------e~v~-~ei~~~  157 (606)
                      .-....++-++++|||-|-++=--=+.... |....   ..++|+|+|-||+|+..-+.          ..|. ++.+++
T Consensus        61 ~l~~~~~~~a~~~ilvydvt~~~Sf~~~~~~w~~~i~~~~~~~piilVgnK~DL~~~~~~~~~~~~~~~~~Vs~~~~~~~  140 (174)
T smart00174       61 RLRPLSYPDTDVFLICFSVDSPASFENVKEKWYPEVKHFCPNTPIILVGTKLDLREDKSTLRELSKQKQEPVTYEQGEAL  140 (174)
T ss_pred             CCCHHHCCCCCEEEEEEECCCHHHHHHHHHHHHHHHHHHCCCCCEEEEEECCCCCHHHHHHHHHHHCCCCCCCHHHHHHH
T ss_conf             45001104886899997589878999999989999998688986999987542501233354553314650029999999


Q ss_pred             H-HHHHHHHHHHHHHCCCCCCHHHHHHHHHHHCC
Q ss_conf             5-32232100011100223200678776321000
Q gi|254780321|r  158 I-GISTEDALLVSAKTGEGIPLLLERIVQQLPSP  190 (606)
Q Consensus       158 ~-g~~~~~ii~vSAktG~GV~~LLd~Iv~~iP~P  190 (606)
                      - .+.....+.+|||+|.||+++++.++..+=.|
T Consensus       141 a~~~~~~~y~EtSAk~g~nV~e~F~~l~r~~l~p  174 (174)
T smart00174      141 AKRIGAVKYLECSALTQEGVREVFEEAIRAALNP  174 (174)
T ss_pred             HHHCCCCEEEEECCCCCCCHHHHHHHHHHHHHCC
T ss_conf             9983997899964588949899999999997294


No 202
>cd01892 Miro2 Miro2 subfamily.  Miro (mitochondrial Rho) proteins have tandem GTP-binding domains separated by a linker region containing putative calcium-binding EF hand motifs.  Genes encoding Miro-like proteins were found in several eukaryotic organisms.  This CD represents the putative GTPase domain in the C terminus of Miro proteins.  These atypical Rho GTPases have roles in mitochondrial homeostasis and apoptosis.  Most Rho proteins contain a lipid modification site at the C-terminus; however, Miro is one of few Rho subfamilies that lack this feature.
Probab=99.31  E-value=1.7e-10  Score=89.92  Aligned_cols=159  Identities=21%  Similarity=0.259  Sum_probs=103.7

Q ss_pred             HHCEEEEEECCCCCCHHHHHHHHHHHCCCCCCCCCCCEEECCCHHHHHHCCEEEEEEEEEEEECCCCCEEEEEEEECCCC
Q ss_conf             25317999801389877889999998298054444311305867798719505232799997437884389999617873
Q gi|254780321|r    9 SRIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVRLNYTSTDAKDYQLNLIDTPGH   88 (606)
Q Consensus         9 ~~IRN~~IiaHvDhGKTTL~d~lL~~tg~i~~~~~~~~vlD~~~~EreRGITIka~~~~~~~~~~~~~~y~iNlIDTPGH   88 (606)
                      .++-++.|+|-.+.|||+|.-|++.  +.+....-..+          -|.....+++.     .+++.+.+.|.||+|+
T Consensus         2 r~vfk~~VlG~~~VGKTsLi~rf~~--~~f~~~~y~~T----------i~~~~~~k~v~-----v~g~~~~L~i~Dt~g~   64 (169)
T cd01892           2 RNVFLCFVLGAKGSGKSALLRAFLG--RSFSLNAYSPT----------IKPRYAVNTVE-----VYGQEKYLILREVGED   64 (169)
T ss_pred             CEEEEEEEECCCCCCHHHHHHHHHC--CCCCCCCCCCC----------CCCEEEEEEEE-----ECCEEEEEEEEECCCC
T ss_conf             5089999999999889999999964--99986665675----------46618999999-----8999999999855653


Q ss_pred             CHHHHHHHHHHHHCCEEEEEEECCCCCCHHHHH---HHHHHH--HCCCCEEEEECCCCCCCCCCCCHHHHHHHH---HHH
Q ss_conf             002799999997302689999868788655899---999999--709967998326788753211338887755---532
Q gi|254780321|r   89 VDFTYEVSRSLSACEGSLLVVDATQGVEAQTLA---NVYQAI--DNNHEIITVLNKADLPSADPDRVKKQIEET---IGI  160 (606)
Q Consensus        89 ~DF~~EV~r~l~a~dgaiLvVdA~~Gvq~QT~~---~~~~A~--~~~l~~I~viNKiD~~~A~~e~v~~ei~~~---~g~  160 (606)
                      ..|..-....++.||+++||-|.++-   ++-.   .|+.-.  ...+|+++|=||.|++.-+. -..+|.+++   .++
T Consensus        65 e~~~~l~~~~~~~ad~~ilVyDit~~---~SF~~i~~~~~~~~~~~~iP~vlVgNK~DL~~~rq-V~~~e~~~~a~~~~~  140 (169)
T cd01892          65 EVAILLNDAELAACDVACLVYDSSDP---KSFSYCAEVYKKYFMLGEIPCLFVAAKADLDEQQQ-RYEVQPDEFCRKLGL  140 (169)
T ss_pred             HHHHHHHHHHHCCCCEEEEEEECCCH---HHHHHHHHHHHHHHCCCCCCEEEEEECCCCCCCCC-CCHHHHHHHHHHCCC
T ss_conf             23556658875469889999979987---89999999999700568981899988655420375-467769999998399


Q ss_pred             HHHHHHHHHHHCCCCCCHHHHHHHHHHHCC
Q ss_conf             232100011100223200678776321000
Q gi|254780321|r  161 STEDALLVSAKTGEGIPLLLERIVQQLPSP  190 (606)
Q Consensus       161 ~~~~ii~vSAktG~GV~~LLd~Iv~~iP~P  190 (606)
                      .  -.+.+|||+|.||++++..|.+-.--|
T Consensus       141 ~--~~~e~SAktg~nv~~~F~~la~~a~~p  168 (169)
T cd01892         141 P--PPLHFSSKLGDSSNELFTKLATAAQYP  168 (169)
T ss_pred             C--CCEEEEEECCCCHHHHHHHHHHHHHCC
T ss_conf             9--666998327989899999999997678


No 203
>smart00176 RAN Ran (Ras-related nuclear proteins) /TC4 subfamily of small GTPases. Ran is involved in the active transport of proteins through nuclear pores.
Probab=99.31  E-value=8e-11  Score=92.15  Aligned_cols=150  Identities=19%  Similarity=0.194  Sum_probs=98.5

Q ss_pred             ECCCCCCHHHHHHHHHHHCCCCCCCCCCCEEECCCHHHHHHCCEEEEEEEEEEEECCCCCEEEEEEEECCCCCHHHHHHH
Q ss_conf             80138987788999999829805444431130586779871950523279999743788438999961787300279999
Q gi|254780321|r   17 VAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVRLNYTSTDAKDYQLNLIDTPGHVDFTYEVS   96 (606)
Q Consensus        17 iaHvDhGKTTL~d~lL~~tg~i~~~~~~~~vlD~~~~EreRGITIka~~~~~~~~~~~~~~y~iNlIDTPGH~DF~~EV~   96 (606)
                      ||..+-|||||.-|++  +|.+..+-.               -||-....+..+ ..+.+.+++++.||.|...|..-..
T Consensus         1 vGD~gVGKTsli~R~~--~~~F~~~y~---------------pTiGvd~~~~~~-~~~~~~i~l~iWDTAGqE~f~sl~~   62 (200)
T smart00176        1 VGDGGTGKTTFVKRHL--TGEFEKKYV---------------ATLGVEVHPLVF-HTNRGPIRFNVWDTAGQEKFGGLRD   62 (200)
T ss_pred             CCCCCCCHHHHHHHHH--CCCCCCCCC---------------CCEEEEEEEEEE-EECCEEEEEEEEECCCCCCCCCCCH
T ss_conf             9898878999999994--099999978---------------871489899999-9899899999998988700011026


Q ss_pred             HHHHHCCEEEEEEECCCCCCHHHHHHHHHHH---HCCCCEEEEECCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHCC
Q ss_conf             9997302689999868788655899999999---7099679983267887532113388877555322321000111002
Q gi|254780321|r   97 RSLSACEGSLLVVDATQGVEAQTLANVYQAI---DNNHEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTG  173 (606)
Q Consensus        97 r~l~a~dgaiLvVdA~~Gvq~QT~~~~~~A~---~~~l~~I~viNKiD~~~A~~e~v~~ei~~~~g~~~~~ii~vSAktG  173 (606)
                      ...+-++|||||.|.+.=--=.-+..|+.-+   ..++++|+|=||+|+.+..   |..+-..+-.-..-..+-+|||+|
T Consensus        63 ~yyr~a~~~IlvfDvt~~~SF~~l~~W~~~l~~~~~~ipiiLvGNK~DL~~r~---V~~e~~~~a~~~~~~y~EtSAKt~  139 (200)
T smart00176       63 GYYIQGQCAIIMFDVTARVTYKNVPNWHRDLVRVCENIPIVLCGNKVDVKDRK---VKAKSITFHRKKNLQYYDISAKSN  139 (200)
T ss_pred             HHCCCCCEEEEEEECCCHHHHHHHHHHHHHHHHHCCCCCEEEEEECCCCCCCC---CCHHHHHHHHHCCCCEEEEECCCC
T ss_conf             55057878899963587789998999999999857999889999887574043---659999999987997898300469


Q ss_pred             CCCCHHHHHHHHHH
Q ss_conf             23200678776321
Q gi|254780321|r  174 EGIPLLLERIVQQL  187 (606)
Q Consensus       174 ~GV~~LLd~Iv~~i  187 (606)
                      .||++++..+...+
T Consensus       140 ~Nv~e~F~~Lar~L  153 (200)
T smart00176      140 YNFEKPFLWLARKL  153 (200)
T ss_pred             CCHHHHHHHHHHHH
T ss_conf             69799999999998


No 204
>cd04141 Rit_Rin_Ric Rit/Rin/Ric subfamily.  Rit (Ras-like protein in all tissues), Rin (Ras-like protein in neurons) and Ric (Ras-related protein which interacts with calmodulin) form a subfamily with several unique structural and functional characteristics.   These proteins all lack a the C-terminal CaaX lipid-binding motif typical of Ras family proteins, and Rin and Ric contain calmodulin-binding domains.  Rin, which is expressed only in neurons, induces neurite outgrowth in rat pheochromocytoma cells through its association with calmodulin and its activation of endogenous Rac/cdc42.  Rit, which is ubiquitously expressed in mammals, inhibits growth-factor withdrawl-mediated apoptosis and induces neurite extension in pheochromocytoma cells.  Rit and Rin are both able to form a ternary complex with PAR6, a cell polarity-regulating protein, and Rac/cdc42.  This ternary complex is proposed to have physiological function in processes such as tumorigenesis.  Activated Ric is likely to sign
Probab=99.30  E-value=6.1e-11  Score=92.94  Aligned_cols=155  Identities=17%  Similarity=0.215  Sum_probs=103.2

Q ss_pred             EEEEECCCCCCHHHHHHHHHHHCCCCCCCCCCCEEECCCHHHHHHCCEEEEEEEEEEEECCCCCEEEEEEEECCCCCHHH
Q ss_conf             79998013898778899999982980544443113058677987195052327999974378843899996178730027
Q gi|254780321|r   13 NFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVRLNYTSTDAKDYQLNLIDTPGHVDFT   92 (606)
Q Consensus        13 N~~IiaHvDhGKTTL~d~lL~~tg~i~~~~~~~~vlD~~~~EreRGITIka~~~~~~~~~~~~~~y~iNlIDTPGH~DF~   92 (606)
                      .+.++|..+-|||+|.-|++  .+.+... ...++          |-+.   ...+.   .+++.+.++|.||.|+..|.
T Consensus         4 Kiv~lGd~~VGKTsli~r~~--~~~f~~~-~~pTi----------~~~~---~~~i~---i~~~~~~l~iwDtaGqe~~~   64 (172)
T cd04141           4 KIVMLGAGGVGKSAVTMQFI--SHSFPDY-HDPTI----------EDAY---KQQAR---IDNEPALLDILDTAGQAEFT   64 (172)
T ss_pred             EEEEECCCCCCHHHHHHHHH--HCCCCCC-CCCCC----------CCCE---EEEEE---ECCEEEEEEEEECCCCCCCC
T ss_conf             99999999977999999997--0989987-58842----------2203---69999---99999999999788851357


Q ss_pred             HHHHHHHHHCCEEEEEEECCCCCCHHHHHHHHHHH-----HCCCCEEEEECCCCCCCCCCCCHHHHHHH---HHHHHHHH
Q ss_conf             99999997302689999868788655899999999-----70996799832678875321133888775---55322321
Q gi|254780321|r   93 YEVSRSLSACEGSLLVVDATQGVEAQTLANVYQAI-----DNNHEIITVLNKADLPSADPDRVKKQIEE---TIGISTED  164 (606)
Q Consensus        93 ~EV~r~l~a~dgaiLvVdA~~Gvq~QT~~~~~~A~-----~~~l~~I~viNKiD~~~A~~e~v~~ei~~---~~g~~~~~  164 (606)
                      .-....++-+||+|||.|.++=--=+....|+.-.     ..++|+|+|-||+|+++.+. -..+|..+   -+++   .
T Consensus        65 ~l~~~~~r~a~~~ilvydvt~~~Sf~~~~~w~~~i~~~~~~~~~piilvGNK~DL~~~r~-Vs~~e~~~~a~~~~~---~  140 (172)
T cd04141          65 AMRDQYMRCGEGFIICYSVTDRHSFQEASEFKKLITRVRLTEDIPLVLVGNKVDLESQRQ-VTTEEGRNLAREFNC---P  140 (172)
T ss_pred             CCHHHHHCCCCEEEEEECCCCHHHHHHHHHHHHHHHHHHCCCCCCEEEEEECCCHHHHCC-CCHHHHHHHHHHCCC---E
T ss_conf             451556427865688731688889999999999999972889986899850456676188-899999999998599---7


Q ss_pred             HHHHHHHCCCCCCHHHHHHHHHHHCC
Q ss_conf             00011100223200678776321000
Q gi|254780321|r  165 ALLVSAKTGEGIPLLLERIVQQLPSP  190 (606)
Q Consensus       165 ii~vSAktG~GV~~LLd~Iv~~iP~P  190 (606)
                      .+.+||++|.||+++++.++..+--.
T Consensus       141 f~EtSAk~~~nV~e~F~~l~~~i~~k  166 (172)
T cd04141         141 FFETSAALRHYIDDAFHGLVREIRRK  166 (172)
T ss_pred             EEEECCCCCCCHHHHHHHHHHHHHHH
T ss_conf             99974788828899999999999863


No 205
>cd04142 RRP22 RRP22 subfamily.  RRP22 (Ras-related protein on chromosome 22) subfamily consists of proteins that inhibit cell growth and promote caspase-independent cell death.  Unlike most Ras proteins, RRP22 is down-regulated in many human tumor cells due to promoter methylation.  RRP22 localizes to the nucleolus in a GTP-dependent manner, suggesting a novel function in modulating transport of nucleolar components.  Most Ras proteins contain a lipid modification site at the C-terminus, with a typical sequence motif CaaX, where a = an aliphatic amino acid and X = any amino acid.  Lipid binding is essential for membrane attachment, a key feature of most Ras proteins.  Like most Ras family proteins, RRP22 is farnesylated.
Probab=99.30  E-value=1.4e-10  Score=90.46  Aligned_cols=158  Identities=18%  Similarity=0.210  Sum_probs=101.6

Q ss_pred             EEEECCCCCCHHHHHHHHHHHCCCCCCCCCCCEEECCCHHHHHHCCEEEEEEEEEEEECCCCCEEEEEEEECCCCCHHH-
Q ss_conf             9998013898778899999982980544443113058677987195052327999974378843899996178730027-
Q gi|254780321|r   14 FSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVRLNYTSTDAKDYQLNLIDTPGHVDFT-   92 (606)
Q Consensus        14 ~~IiaHvDhGKTTL~d~lL~~tg~i~~~~~~~~vlD~~~~EreRGITIka~~~~~~~~~~~~~~y~iNlIDTPGH~DF~-   92 (606)
                      ++++|-.+-|||+|+-|++  .+.+.+.- ..+          -|..+..+.+.     .+++.|.+.|.||||...|. 
T Consensus         3 ivvlG~~gVGKTsli~rf~--~~~F~~~y-~pT----------ig~~~~~k~v~-----~dg~~~~l~IwDtag~~~~~~   64 (198)
T cd04142           3 VAVLGAPGVGKTAIVRQFL--AQEFPEEY-IPT----------EHRRLYRPAVV-----LSGRVYDLHILDVPNMQRYPG   64 (198)
T ss_pred             EEEECCCCCCHHHHHHHHH--HCCCCCCC-CCC----------CCEEEEEEEEE-----ECCEEEEEEEEECCCCCCCCC
T ss_conf             9999979989999999997--19888874-784----------66167899999-----999999999995877304555


Q ss_pred             ---HH----HHHHHHHCCEEEEEEECCCCCCHHHHHHHHHHH-------HCCCCEEEEECCCCCCCCCCCCHHHHHHHHH
Q ss_conf             ---99----999997302689999868788655899999999-------7099679983267887532113388877555
Q gi|254780321|r   93 ---YE----VSRSLSACEGSLLVVDATQGVEAQTLANVYQAI-------DNNHEIITVLNKADLPSADPDRVKKQIEETI  158 (606)
Q Consensus        93 ---~E----V~r~l~a~dgaiLvVdA~~Gvq~QT~~~~~~A~-------~~~l~~I~viNKiD~~~A~~e~v~~ei~~~~  158 (606)
                         -|    ..|+++-++|+|||-|-++---=+-+..|+.-+       ....|+|+|=||+|+++.+.-. .++...+.
T Consensus        65 tagqe~~~~r~~~ir~a~~~ilVydvt~~~SF~~v~~~~~~i~~~~~~~~~~~piiLVGNK~DL~~~R~v~-~~~~~~~a  143 (198)
T cd04142          65 TAGQEWMDPRFRGLRNSRAFILVYDICSPDSFHYVKLLRQQILETRPAGNKEPPIVVVGNKRDQQRHRFAP-RHVLSVLV  143 (198)
T ss_pred             CCCHHHHHHHHHHCCCCCEEEEEEECCCHHHHHHHHHHHHHHHHHHHCCCCCCCEEEEEECCCCCCCCCCC-HHHHHHHH
T ss_conf             65212355564401468889999988677888999999999999851479998289983454310035688-99999999


Q ss_pred             HH-HHHHHHHHHHHCCCCCCHHHHHHHHHHHCC
Q ss_conf             32-232100011100223200678776321000
Q gi|254780321|r  159 GI-STEDALLVSAKTGEGIPLLLERIVQQLPSP  190 (606)
Q Consensus       159 g~-~~~~ii~vSAktG~GV~~LLd~Iv~~iP~P  190 (606)
                      .- -.-..+-+|||+|.||+++++.++..+-..
T Consensus       144 ~~~~~~~f~EtSAK~~~nV~~~F~~lvr~i~~~  176 (198)
T cd04142         144 RKSWKCGYLECSAKYNWHILLLFKELLISATTR  176 (198)
T ss_pred             HHCCCCEEEECCCCCCCCHHHHHHHHHHHHHHH
T ss_conf             851997699887889969899999999999860


No 206
>cd01870 RhoA_like RhoA-like subfamily.  The RhoA subfamily consists of RhoA, RhoB, and RhoC.  RhoA promotes the formation of stress fibers and focal adhesions, regulating cell shape, attachment, and motility.  RhoA can bind to multiple effector proteins, thereby triggering different downstream responses.  In many cell types, RhoA mediates local assembly of the contractile ring, which is necessary for cytokinesis.  RhoA is vital for muscle contraction; in vascular smooth muscle cells, RhoA plays a key role in cell contraction, differentiation, migration, and proliferation.  RhoA activities appear to be elaborately regulated in a time- and space-dependent manner to control cytoskeletal changes.  Most Rho proteins contain a lipid modification site at the C-terminus, with a typical sequence motif CaaX, where a = an aliphatic amino acid and X = any amino acid.  Lipid binding is essential for membrane attachment, a key feature of most Rho proteins.  RhoA and RhoC are observed only in geranyl
Probab=99.27  E-value=2.3e-10  Score=89.04  Aligned_cols=151  Identities=25%  Similarity=0.246  Sum_probs=97.2

Q ss_pred             EEEEECCCCCCHHHHHHHHHHHCCCCCCCCCCCEEECCCHHHHHHCCEEEEE-EEEEEEECCCCCEEEEEEEECCCCCHH
Q ss_conf             7999801389877889999998298054444311305867798719505232-799997437884389999617873002
Q gi|254780321|r   13 NFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQ-TVRLNYTSTDAKDYQLNLIDTPGHVDF   91 (606)
Q Consensus        13 N~~IiaHvDhGKTTL~d~lL~~tg~i~~~~~~~~vlD~~~~EreRGITIka~-~~~~~~~~~~~~~y~iNlIDTPGH~DF   91 (606)
                      -++++|..+-|||+|.-|++  .+.+.+.-               --||... ...+.   .+++.+.+.|.||+|+.+|
T Consensus         3 Ki~liGd~~VGKTsli~r~~--~~~F~~~y---------------~pTi~~~~~~~i~---~~~~~v~l~iwDtaG~e~~   62 (175)
T cd01870           3 KLVIVGDGACGKTCLLIVFS--KDQFPEVY---------------VPTVFENYVADIE---VDGKQVELALWDTAGQEDY   62 (175)
T ss_pred             EEEEECCCCCCHHHHHHHHH--CCCCCCCC---------------CCCEEEEEEEEEE---ECCEEEEEEEEECCCCCCC
T ss_conf             99999989966999999997--09899984---------------7843689999999---9999999999977766132


Q ss_pred             HHHHHHHHHHCCEEEEEEECCCCCCHHHHH----HHHHHHH---CCCCEEEEECCCCCCCCCCC----------CHH-HH
Q ss_conf             799999997302689999868788655899----9999997---09967998326788753211----------338-88
Q gi|254780321|r   92 TYEVSRSLSACEGSLLVVDATQGVEAQTLA----NVYQAID---NNHEIITVLNKADLPSADPD----------RVK-KQ  153 (606)
Q Consensus        92 ~~EV~r~l~a~dgaiLvVdA~~Gvq~QT~~----~~~~A~~---~~l~~I~viNKiD~~~A~~e----------~v~-~e  153 (606)
                      ..-....++-++++|||-|.++   .+|..    .|..-..   .+.|+|+|-||+|+.+.+.-          .|. +|
T Consensus        63 ~~~~~~~~~~a~~~ilvydi~~---~~Sf~~~~~~w~~~i~~~~~~~piilVgnK~DL~~~~~~~~~~~~~~~~~V~~~e  139 (175)
T cd01870          63 DRLRPLSYPDTDVILMCFSIDS---PDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRNDEHTRRELAKMKQEPVKPEE  139 (175)
T ss_pred             CCCHHHHHCCCCEEEEEEECCC---HHHHHHHHHHHHHHHHHHCCCCCEEEEEECCCCCCCHHHHHHHHHHCCCCCCHHH
T ss_conf             3240443148878999986598---7999999999999999729899899998724334332345666540255668999


Q ss_pred             HHHHHH-HHHHHHHHHHHHCCCCCCHHHHHHHHH
Q ss_conf             775553-223210001110022320067877632
Q gi|254780321|r  154 IEETIG-ISTEDALLVSAKTGEGIPLLLERIVQQ  186 (606)
Q Consensus       154 i~~~~g-~~~~~ii~vSAktG~GV~~LLd~Iv~~  186 (606)
                      -+++-. +.....+.+|||+|.||+++++.++..
T Consensus       140 g~~~a~~~~~~~f~EtSAk~~~nV~e~Fe~~~k~  173 (175)
T cd01870         140 GRDMANKIGAFGYMECSAKTKEGVREVFEMATRA  173 (175)
T ss_pred             HHHHHHHCCCCEEEEECCCCCCCHHHHHHHHHHH
T ss_conf             9999997499789997689997989999999998


No 207
>smart00178 SAR Sar1p-like members of the Ras-family  of small GTPases. Yeast SAR1 is an essential gene required for transport of secretory proteins from the endoplasmic reticulum to the Golgi apparatus.
Probab=99.26  E-value=2.2e-10  Score=89.22  Aligned_cols=153  Identities=16%  Similarity=0.179  Sum_probs=102.8

Q ss_pred             HHCEEEEEECCCCCCHHHHHHHHHHHCCCCCCCCCCCEEECCCHHHHHHCCEEEEEEEEEEEECCCCCEEEEEEEECCCC
Q ss_conf             25317999801389877889999998298054444311305867798719505232799997437884389999617873
Q gi|254780321|r    9 SRIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVRLNYTSTDAKDYQLNLIDTPGH   88 (606)
Q Consensus         9 ~~IRN~~IiaHvDhGKTTL~d~lL~~tg~i~~~~~~~~vlD~~~~EreRGITIka~~~~~~~~~~~~~~y~iNlIDTPGH   88 (606)
                      ++=.+|-|+|=-.+||||+..+|.  .+.+..         ..       -|+-.+..++.|     +++.+++.|..|+
T Consensus        15 ~ke~~ililGLd~aGKTTil~~lk--~~~~~~---------~~-------PT~g~~~e~~~~-----~~~~~~~wDlgG~   71 (184)
T smart00178       15 NKHAKILFLGLDNAGKTTLLHMLK--NDRLAQ---------HQ-------PTQHPTSEELAI-----GNIKFTTFDLGGH   71 (184)
T ss_pred             CCCCEEEEECCCCCCHHHHHHHHH--CCCCCC---------CC-------CCCCCCEEEEEE-----CCEEEEEEECCCC
T ss_conf             661479999658898899999980--699753---------05-------787886489999-----9999999988987


Q ss_pred             CHHHHHHHHHHHHCCEEEEEEECCCCC-CHHHHHHHHHHH----HCCCCEEEEECCCCCCCCCCCCHHHHHHHHHHH---
Q ss_conf             002799999997302689999868788-655899999999----709967998326788753211338887755532---
Q gi|254780321|r   89 VDFTYEVSRSLSACEGSLLVVDATQGV-EAQTLANVYQAI----DNNHEIITVLNKADLPSADPDRVKKQIEETIGI---  160 (606)
Q Consensus        89 ~DF~~EV~r~l~a~dgaiLvVdA~~Gv-q~QT~~~~~~A~----~~~l~~I~viNKiD~~~A~~e~v~~ei~~~~g~---  160 (606)
                      .-|-.-=.+-..-|+|.|.|||+++-- ..+.+..+...+    -.+.|++++.||.|+|+|-..   +||.+.+++   
T Consensus        72 ~~~R~lW~~Yy~~~~~iIfVVDssD~~r~~eak~~L~~ll~~~~l~~~PlLilaNKqDl~~a~~~---~ei~~~L~L~~~  148 (184)
T smart00178       72 QQARRLWKDYFPEVNGIVYLVDAYDKERFAESKRELDALLSDEELATVPFLILGNKIDAPYAASE---DELRYALGLTNT  148 (184)
T ss_pred             HHHHHHHHHHHCCCCEEEEEEECCCHHHHHHHHHHHHHHHHHHHHCCCCEEEEEECCCCCCCCCH---HHHHHHHCCHHH
T ss_conf             77889999882167589999726868899999999999864676559709999975677789999---999988195123


Q ss_pred             ---------HHHHHHHHHHHCCCCCCHHHHHHHHHH
Q ss_conf             ---------232100011100223200678776321
Q gi|254780321|r  161 ---------STEDALLVSAKTGEGIPLLLERIVQQL  187 (606)
Q Consensus       161 ---------~~~~ii~vSAktG~GV~~LLd~Iv~~i  187 (606)
                               .+-.+.+|||.+|.|+++-|+=+.+++
T Consensus       149 ~~~~~~~~~r~~~i~~~SA~tG~Gl~egl~WLs~~i  184 (184)
T smart00178      149 TGSKGKVGVRPLEVFMCSVVRRMGYGEGFKWLSQYI  184 (184)
T ss_pred             HCCCCCCCCCCEEEEEEECCCCCCHHHHHHHHHHHC
T ss_conf             265576677631999735607978699999998409


No 208
>cd04146 RERG_RasL11_like RERG/RasL11-like subfamily.  RERG (Ras-related and Estrogen- Regulated Growth inhibitor) and Ras-like 11 are members of a novel subfamily of Ras that were identified based on their behavior in breast and prostate tumors, respectively.  RERG expression was decreased or lost in a significant fraction of primary human breast tumors that lack estrogen receptor and are correlated with poor clinical prognosis.  Elevated RERG expression correlated with favorable patient outcome in a breast tumor subtype that is positive for estrogen receptor expression.  In contrast to most Ras proteins, RERG overexpression inhibited the growth of breast tumor cells in vitro and in vivo.  RasL11 was found to be ubiquitously expressed in human tissue, but down-regulated in prostate tumors.  Both RERG and RasL11 lack the C-terminal CaaX prenylation motif, where a = an aliphatic amino acid and X = any amino acid, and are localized primarily in the cytoplasm.  Both are believed to have tu
Probab=99.26  E-value=1.8e-10  Score=89.84  Aligned_cols=154  Identities=21%  Similarity=0.282  Sum_probs=96.9

Q ss_pred             EEEECCCCCCHHHHHHHHHHHCCCCCCCCCCCEEECCCHHHHHHCCEEEEEEEEEEEECCCCCEEEEEEEECCCCCHHHH
Q ss_conf             99980138987788999999829805444431130586779871950523279999743788438999961787300279
Q gi|254780321|r   14 FSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVRLNYTSTDAKDYQLNLIDTPGHVDFTY   93 (606)
Q Consensus        14 ~~IiaHvDhGKTTL~d~lL~~tg~i~~~~~~~~vlD~~~~EreRGITIka~~~~~~~~~~~~~~y~iNlIDTPGH~DF~~   93 (606)
                      ++++|-..-|||+|.-|++  ++.+...- ..++          |.+. .+  .+.   .+++.+.++|.||+|...|..
T Consensus         2 iv~vGd~~VGKTsli~rf~--~~~f~~~y-~~T~----------~~~~-~~--~~~---v~~~~~~l~iwDtaG~e~~~~   62 (165)
T cd04146           2 IAVLGASGVGKSALVVRFL--TKRFIGEY-DPNL----------ESLY-SR--QVT---IDGEQVSLEILDTAGQQQADT   62 (165)
T ss_pred             EEEECCCCCCHHHHHHHHH--HCCCCCCC-CCCC----------CCEE-EE--EEE---ECCEEEEEEEEECCCCCCCCH
T ss_conf             9999989977899999997--49899875-9955----------6305-79--999---999999999992898501220


Q ss_pred             H-HHHHHHHCCEEEEEEECCCCCCHHHHHHHHHHH-H-----CCCCEEEEECCCCCCCCCCCCHHHHHHHHHHHHHHHHH
Q ss_conf             9-999997302689999868788655899999999-7-----09967998326788753211338887755532232100
Q gi|254780321|r   94 E-VSRSLSACEGSLLVVDATQGVEAQTLANVYQAI-D-----NNHEIITVLNKADLPSADPDRVKKQIEETIGISTEDAL  166 (606)
Q Consensus        94 E-V~r~l~a~dgaiLvVdA~~Gvq~QT~~~~~~A~-~-----~~l~~I~viNKiD~~~A~~e~v~~ei~~~~g~~~~~ii  166 (606)
                      - ..+.++-+||+|||-|.++----+....|+.-+ +     .++|+|+|=||+|+++.+. --.+|.+++-.--.-..+
T Consensus        63 ~~~~~~~~~a~~~ilvydit~~~Sf~~~~~~~~~i~~~~~~~~~~piilVGNK~DL~~~r~-Vs~ee~~~~a~~~~~~f~  141 (165)
T cd04146          63 EQLERSIRWADGFVLVYSITDRSSFDEISQLKQLIREIKKRDREIPVILVGNKADLLHYRQ-VSTEEGEKLASELGCLFF  141 (165)
T ss_pred             HHHHHHCCCCCEEEEEEECCCHHHHHHHHHHHHHHHHHHCCCCCCEEEEECCCCCCCCCCC-CCHHHHHHHHHHCCCEEE
T ss_conf             1255430458789999865888999999999999999846699953998445545210367-799999999998199899


Q ss_pred             HHHHHCC-CCCCHHHHHHHHHH
Q ss_conf             0111002-23200678776321
Q gi|254780321|r  167 LVSAKTG-EGIPLLLERIVQQL  187 (606)
Q Consensus       167 ~vSAktG-~GV~~LLd~Iv~~i  187 (606)
                      .+|||+| .||+++++.++..+
T Consensus       142 E~SAk~~~~~V~~~F~~l~~~i  163 (165)
T cd04146         142 EVSAAEDYDGVHSVFHELCREV  163 (165)
T ss_pred             EEECCCCCCCHHHHHHHHHHHH
T ss_conf             9752087826999999999996


No 209
>cd04134 Rho3 Rho3 subfamily.  Rho3 is a member of the Rho family found only in fungi.  Rho3 is believed to regulate cell polarity by interacting with the diaphanous/formin family protein For3 to control both the actin cytoskeleton and microtubules.  Rho3 is also believed to have a direct role in exocytosis that is independent of its role in regulating actin polarity.  The function in exocytosis may be two-pronged: first, in the transport of post-Golgi vesicles from the mother cell to the bud, mediated by myosin (Myo2); second, in the docking and fusion of vesicles to the plasma membrane, mediated by an exocyst (Exo70) protein.  Most Rho proteins contain a lipid modification site at the C-terminus, with a typical sequence motif CaaX, where a = an aliphatic amino acid and X = any amino acid.  Lipid binding is essential for membrane attachment, a key feature of most Rho proteins.
Probab=99.26  E-value=4.1e-10  Score=87.35  Aligned_cols=160  Identities=19%  Similarity=0.190  Sum_probs=101.3

Q ss_pred             EEEEEECCCCCCHHHHHHHHHHHCCCCCCCCCCCEEECCCHHHHHHCCEEEEEEEEEEEECCCCCEEEEEEEECCCCCHH
Q ss_conf             17999801389877889999998298054444311305867798719505232799997437884389999617873002
Q gi|254780321|r   12 RNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVRLNYTSTDAKDYQLNLIDTPGHVDF   91 (606)
Q Consensus        12 RN~~IiaHvDhGKTTL~d~lL~~tg~i~~~~~~~~vlD~~~~EreRGITIka~~~~~~~~~~~~~~y~iNlIDTPGH~DF   91 (606)
                      |-+.++|...-|||+|.-|+.  .|.+.+.-               --||-..-.. .+ ..+++.+.++|.||.|+..|
T Consensus         1 ~KivlvGd~~VGKTsli~r~~--~~~F~~~y---------------~~Ti~~~~~~-~~-~v~~~~v~l~iwDTaGqe~~   61 (189)
T cd04134           1 RKVVVLGDGACGKTSLLNVFT--RGYFPQVY---------------EPTVFENYVH-DI-FVDGLHIELSLWDTAGQEEF   61 (189)
T ss_pred             CEEEEECCCCCCHHHHHHHHH--CCCCCCCC---------------CCCEEEEEEE-EE-EECCEEEEEEEEECCCCCCC
T ss_conf             989999979976999999997--09999986---------------8837899999-99-99999999999847785000


Q ss_pred             HHHHHHHHHHCCEEEEEEECCCCCCHHHHH-HHHHHHH---CCCCEEEEECCCCCCCCCCCCHH--HHH------HHHHH
Q ss_conf             799999997302689999868788655899-9999997---09967998326788753211338--887------75553
Q gi|254780321|r   92 TYEVSRSLSACEGSLLVVDATQGVEAQTLA-NVYQAID---NNHEIITVLNKADLPSADPDRVK--KQI------EETIG  159 (606)
Q Consensus        92 ~~EV~r~l~a~dgaiLvVdA~~Gvq~QT~~-~~~~A~~---~~l~~I~viNKiD~~~A~~e~v~--~ei------~~~~g  159 (606)
                      ..-.....+-+|++|||.|-+.=--=+... .|..-..   .++|+|+|-||+|+.+.+.+...  .+.      ++-..
T Consensus        62 ~~i~~~~y~~a~~~ilvydi~~~~Sf~~v~~~w~~~i~~~~~~~piiLVgnK~DL~~~~~~~~~~~~~~~~~is~~eg~~  141 (189)
T cd04134          62 DRLRSLSYADTDVIMLCFSVDSPDSLENVESKWLGEIREHCPGVKLVLVALKCDLREARNERDDLQRYGKHTISYEEGLA  141 (189)
T ss_pred             CHHHHHHHCCCCEEEEEEECCCHHHHHHHHHHHHHHHHHHCCCCCEEEEEECHHCCCCHHHHHHHHHHCCCCCCHHHHHH
T ss_conf             03556764378645999978987899999999999999749799789999880046532356777663046658999999


Q ss_pred             H----HHHHHHHHHHHCCCCCCHHHHHHHHHHHCC
Q ss_conf             2----232100011100223200678776321000
Q gi|254780321|r  160 I----STEDALLVSAKTGEGIPLLLERIVQQLPSP  190 (606)
Q Consensus       160 ~----~~~~ii~vSAktG~GV~~LLd~Iv~~iP~P  190 (606)
                      +    .+-..+.+|||+|.||+++++.+...+-.+
T Consensus       142 ~Ak~~~~~~y~EtSAkt~~nV~e~F~~lar~~l~~  176 (189)
T cd04134         142 VAKRINALRYLECSAKLNRGVNEAFTEAARVALNV  176 (189)
T ss_pred             HHHHHCCCEEEEECCCCCCCHHHHHHHHHHHHHHC
T ss_conf             99982997899968067949899999999999735


No 210
>COG0218 Predicted GTPase [General function prediction only]
Probab=99.26  E-value=2.1e-10  Score=89.30  Aligned_cols=165  Identities=22%  Similarity=0.316  Sum_probs=118.9

Q ss_pred             CCCCCHHHCEEEEEECCCCCCHHHHHHHHHHHCCCCCCCCCCCEEECCCHHHHHHCCEEEEEEEEEEEECCCCCEEEEEE
Q ss_conf             88998525317999801389877889999998298054444311305867798719505232799997437884389999
Q gi|254780321|r    3 KKPTPLSRIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVRLNYTSTDAKDYQLNL   82 (606)
Q Consensus         3 ~~~~p~~~IRN~~IiaHvDhGKTTL~d~lL~~tg~i~~~~~~~~vlD~~~~EreRGITIka~~~~~~~~~~~~~~y~iNl   82 (606)
                      .+..|.+..--||.+|-...|||||.-+|.-.-+ +.+...            .=|-|-     .+.|...+++   +.|
T Consensus        16 ~~~~P~~~~~EIaF~GRSNVGKSSlIN~l~~~k~-LArtSk------------tPGrTq-----~iNff~~~~~---~~l   74 (200)
T COG0218          16 IKQYPEDDLPEIAFAGRSNVGKSSLINALTNQKN-LARTSK------------TPGRTQ-----LINFFEVDDE---LRL   74 (200)
T ss_pred             HHHCCCCCCCEEEEECCCCCCHHHHHHHHHCCCC-EEECCC------------CCCCCC-----EEEEEEECCC---EEE
T ss_conf             7568998896799981686668999999967863-556579------------998542-----3679983585---799


Q ss_pred             EECCCCC----------HHHHHHHHHHH---HCCEEEEEEECCCCCCHHHHHHHHHHHHCCCCEEEEECCCCCCC-CCCC
Q ss_conf             6178730----------02799999997---30268999986878865589999999970996799832678875-3211
Q gi|254780321|r   83 IDTPGHV----------DFTYEVSRSLS---ACEGSLLVVDATQGVEAQTLANVYQAIDNNHEIITVLNKADLPS-ADPD  148 (606)
Q Consensus        83 IDTPGH~----------DF~~EV~r~l~---a~dgaiLvVdA~~Gvq~QT~~~~~~A~~~~l~~I~viNKiD~~~-A~~e  148 (606)
                      +|-|||-          .+...+.+-|.   -..++++|||+..++...-+..+..+.+.+++++++.||+|+-. ....
T Consensus        75 VDlPGYGyAkv~k~~~e~w~~~i~~YL~~R~~L~~vvlliD~r~~~~~~D~em~~~l~~~~i~~~vv~tK~DKi~~~~~~  154 (200)
T COG0218          75 VDLPGYGYAKVPKEVKEKWKKLIEEYLEKRANLKGVVLLIDARHPPKDLDREMIEFLLELGIPVIVVLTKADKLKKSERN  154 (200)
T ss_pred             EECCCCCCCCCCHHHHHHHHHHHHHHHHHCHHHEEEEEEEECCCCCCHHHHHHHHHHHHCCCCEEEEEECCCCCCHHHHH
T ss_conf             81799540328999999999999999963522248999997899986879999999997599869999711037746788


Q ss_pred             CHHHHHHHHHHHHHHH---HHHHHHHCCCCCCHHHHHHHHHHH
Q ss_conf             3388877555322321---000111002232006787763210
Q gi|254780321|r  149 RVKKQIEETIGISTED---ALLVSAKTGEGIPLLLERIVQQLP  188 (606)
Q Consensus       149 ~v~~ei~~~~g~~~~~---ii~vSAktG~GV~~LLd~Iv~~iP  188 (606)
                      +....+.+.++++..+   ++..|+.++.|+++|.+.|.+.+-
T Consensus       155 k~l~~v~~~l~~~~~~~~~~~~~ss~~k~Gi~~l~~~i~~~~~  197 (200)
T COG0218         155 KQLNKVAEELKKPPPDDQWVVLFSSLKKKGIDELKAKILEWLK  197 (200)
T ss_pred             HHHHHHHHHHCCCCCCCCEEEEEECCCCCCHHHHHHHHHHHHH
T ss_conf             8999999984689886643999865454489999999999864


No 211
>cd04111 Rab39 Rab39 subfamily.  Found in eukaryotes, Rab39 is mainly found in epithelial cell lines, but is distributed widely in various human tissues and cell lines.  It is believed to be a novel Rab protein involved in regulating Golgi-associated vesicular transport during cellular endocytosis. GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state.  Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilitate Rab recycling by masking C-terminal lipid binding and promoting cytosolic localization.   Most Rab GTPases contain a lipid modification site at the C-terminus, with sequence motifs CC, CXC, or CCX. Lipid binding is essential for membrane attachment, a key feature of most Rab proteins.
Probab=99.24  E-value=3.3e-10  Score=87.97  Aligned_cols=157  Identities=23%  Similarity=0.281  Sum_probs=101.2

Q ss_pred             EEEEECCCCCCHHHHHHHHHHHCCCCCCCCCCCEEECCCHHHHHHCCEEEEEEEEEEEECCCCCEEEEEEEECCCCCHHH
Q ss_conf             79998013898778899999982980544443113058677987195052327999974378843899996178730027
Q gi|254780321|r   13 NFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVRLNYTSTDAKDYQLNLIDTPGHVDFT   92 (606)
Q Consensus        13 N~~IiaHvDhGKTTL~d~lL~~tg~i~~~~~~~~vlD~~~~EreRGITIka~~~~~~~~~~~~~~y~iNlIDTPGH~DF~   92 (606)
                      -+.++|-..-|||+|+-|++  .+.+.+... .++          |.....+.+.+    .+++..+++|.||+|...|.
T Consensus         4 KivllGd~~VGKTsL~~rf~--~~~F~~~~~-~Ti----------g~df~~k~i~i----~dg~~v~l~IwDTaGqe~~~   66 (211)
T cd04111           4 RLIVIGDSTVGKSSLLKRFT--EGRFAEVSD-PTV----------GVDFFSRLIEI----EPGVRIKLQLWDTAGQERFR   66 (211)
T ss_pred             EEEEECCCCCCHHHHHHHHH--HCCCCCCCC-CCC----------CEEEEEEEEEE----CCCCEEEEEEEECCCCCCCC
T ss_conf             99999999961999999998--199999868-720----------16889989997----79959999999798863456


Q ss_pred             HHHHHHHHHCCEEEEEEECCCCCCHHHHHHHHH-HHHC----CCCEEEEECCCCCCCCCCCCH-HHHHHHHHHHHHHHHH
Q ss_conf             999999973026899998687886558999999-9970----996799832678875321133-8887755532232100
Q gi|254780321|r   93 YEVSRSLSACEGSLLVVDATQGVEAQTLANVYQ-AIDN----NHEIITVLNKADLPSADPDRV-KKQIEETIGISTEDAL  166 (606)
Q Consensus        93 ~EV~r~l~a~dgaiLvVdA~~Gvq~QT~~~~~~-A~~~----~l~~I~viNKiD~~~A~~e~v-~~ei~~~~g~~~~~ii  166 (606)
                      .-.....+-++|+|||.|.+.----+....|+. +..+    .+++|+|=||+|+.+-+  .| .+|.+++-.--.-..+
T Consensus        67 si~~~yyr~a~g~ilVyDvt~~~SF~~l~~W~~ei~~~~~~~~~~iiLVGNK~DL~~~R--~Vs~ee~~~~A~~~~~~f~  144 (211)
T cd04111          67 SITRSYYRNSVGVLLVFDITNRESFEHVHDWLEEARSHIQPHRPVFILVGHKCDLESQR--QVTREEAEKLAKDLGMKYI  144 (211)
T ss_pred             CCHHHHHHHCCEEEEEECCCCHHHHHHHHHHHHHHHHHCCCCCCEEEEEEECCCHHHHC--CCCHHHHHHHHHHHCCEEE
T ss_conf             44287742124468971477779999999999999997498885389887423128567--8899999999998399799


Q ss_pred             HHHHHCCCCCCHHHHHHHHHHH
Q ss_conf             0111002232006787763210
Q gi|254780321|r  167 LVSAKTGEGIPLLLERIVQQLP  188 (606)
Q Consensus       167 ~vSAktG~GV~~LLd~Iv~~iP  188 (606)
                      .+|||+|.||+++++.+...+-
T Consensus       145 EtSAK~g~nV~e~F~~la~~i~  166 (211)
T cd04111         145 ETSARTGDNVEEAFELLTQEIY  166 (211)
T ss_pred             EECCCCCCCHHHHHHHHHHHHH
T ss_conf             9759998198999999999999


No 212
>cd01871 Rac1_like Rac1-like subfamily.  The Rac1-like subfamily consists of Rac1, Rac2, and Rac3 proteins, plus the splice variant Rac1b that contains a 19-residue insertion near switch II relative to Rac1.  While Rac1 is ubiquitously expressed, Rac2 and Rac3 are largely restricted to hematopoietic and neural tissues respectively.  Rac1 stimulates the formation of actin lamellipodia and membrane ruffles.  It also plays a role in cell-matrix adhesion and cell anoikis.  In intestinal epithelial cells, Rac1 is an important regulator of migration and mediates apoptosis.  Rac1 is also essential for RhoA-regulated actin stress fiber and focal adhesion complex formation.  In leukocytes, Rac1 and Rac2 have distinct roles in regulating cell morphology, migration, and invasion, but are not essential for macrophage migration or chemotaxis.  Rac3 has biochemical properties that are closely related to Rac1, such as effector interaction, nucleotide binding, and hydrolysis; Rac2 has a slower nucleoti
Probab=99.24  E-value=7e-10  Score=85.83  Aligned_cols=155  Identities=21%  Similarity=0.209  Sum_probs=97.0

Q ss_pred             EEEECCCCCCHHHHHHHHHHHCCCCCCCCCCCEEECCCHHHHHHCCEEEEEEEEEEEECCCCCEEEEEEEECCCCCHHHH
Q ss_conf             99980138987788999999829805444431130586779871950523279999743788438999961787300279
Q gi|254780321|r   14 FSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVRLNYTSTDAKDYQLNLIDTPGHVDFTY   93 (606)
Q Consensus        14 ~~IiaHvDhGKTTL~d~lL~~tg~i~~~~~~~~vlD~~~~EreRGITIka~~~~~~~~~~~~~~y~iNlIDTPGH~DF~~   93 (606)
                      +.++|-.+-|||+|.-|++  .+.+...-               --||-. ..+... ..+++.+.++|.||+|+.+|..
T Consensus         4 ivlvGd~~VGKTsli~r~~--~~~f~~~~---------------~~Ti~~-~~~~~i-~~~~~~v~l~iwDtaGqe~~~~   64 (174)
T cd01871           4 CVVVGDGAVGKTCLLISYT--TNAFPGEY---------------IPTVFD-NYSANV-MVDGKPVNLGLWDTAGQEDYDR   64 (174)
T ss_pred             EEEECCCCCCHHHHHHHHH--HCCCCCCC---------------CCEEEE-EEEEEE-EECCEEEEEEEECCCCCCCCHH
T ss_conf             9998999986999999997--39999986---------------883788-767999-9999999999986999724067


Q ss_pred             HHHHHHHHCCEEEEEEECCCCCCHHHH-HHHHHHHH---CCCCEEEEECCCCCCCCCC--CC--------H-HHHHHHHH
Q ss_conf             999999730268999986878865589-99999997---0996799832678875321--13--------3-88877555
Q gi|254780321|r   94 EVSRSLSACEGSLLVVDATQGVEAQTL-ANVYQAID---NNHEIITVLNKADLPSADP--DR--------V-KKQIEETI  158 (606)
Q Consensus        94 EV~r~l~a~dgaiLvVdA~~Gvq~QT~-~~~~~A~~---~~l~~I~viNKiD~~~A~~--e~--------v-~~ei~~~~  158 (606)
                      -.....+-+|++|||-|-++---=+.. ..|+..+.   .+.|+|+|=||+|+...+.  +.        + .+|-..+-
T Consensus        65 ~~~~~~~~a~~~ilvydi~~~~SF~~i~~~w~~~i~~~~~~~piiLVGnK~DL~~~~~~~~~~~~~~~~~vs~~eg~~~a  144 (174)
T cd01871          65 LRPLSYPQTDVFLICFSLVSPASFENVRAKWYPEVRHHCPNTPIILVGTKLDLRDDKDTIEKLKEKKLTPITYPQGLAMA  144 (174)
T ss_pred             HHHHHHHHCCEEEEEEECCCHHHHHHHHHHHHHHHHHHCCCCCEEEEEECCCCCCCHHHHHHHHHCCCCCCCHHHHHHHH
T ss_conf             88998740668999986798788999999999999985889997987473013100456778865146775899999999


Q ss_pred             -HHHHHHHHHHHHHCCCCCCHHHHHHHHHH
Q ss_conf             -32232100011100223200678776321
Q gi|254780321|r  159 -GISTEDALLVSAKTGEGIPLLLERIVQQL  187 (606)
Q Consensus       159 -g~~~~~ii~vSAktG~GV~~LLd~Iv~~i  187 (606)
                       .+..-..+-+|||+|.||+++++.++..+
T Consensus       145 ~~~~~~~f~EtSAk~~~nV~e~F~~lir~i  174 (174)
T cd01871         145 KEIGAVKYLECSALTQKGLKTVFDEAIRAV  174 (174)
T ss_pred             HHCCCCEEEECCCCCCCCHHHHHHHHHHHC
T ss_conf             875997899918788959799999999519


No 213
>cd04133 Rop_like Rop subfamily.  The Rop (Rho-related protein from plants) subfamily plays a role in diverse cellular processes, including cytoskeletal organization, pollen and vegetative cell growth, hormone responses, stress responses, and pathogen resistance.  Rops are able to regulate several downstream pathways to amplify a specific signal by acting as master switches early in the signaling cascade.  They transmit a variety of extracellular and intracellular signals.  Rops are involved in establishing cell polarity in root-hair development, root-hair elongation, pollen-tube growth, cell-shape formation, responses to hormones such as abscisic acid (ABA) and auxin, responses to abiotic stresses such as oxygen deprivation, and disease resistance and disease susceptibility.  An individual Rop can have a unique function or an overlapping function shared with other Rop proteins; in addition, a given Rop-regulated function can be controlled by one or multiple Rop proteins.  For example, 
Probab=99.24  E-value=4.8e-10  Score=86.93  Aligned_cols=153  Identities=18%  Similarity=0.182  Sum_probs=97.2

Q ss_pred             EEEECCCCCCHHHHHHHHHHHCCCCCCCCCCCEEECCCHHHHHHCCEEEEE-EEEEEEECCCCCEEEEEEEECCCCCHHH
Q ss_conf             999801389877889999998298054444311305867798719505232-7999974378843899996178730027
Q gi|254780321|r   14 FSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQ-TVRLNYTSTDAKDYQLNLIDTPGHVDFT   92 (606)
Q Consensus        14 ~~IiaHvDhGKTTL~d~lL~~tg~i~~~~~~~~vlD~~~~EreRGITIka~-~~~~~~~~~~~~~y~iNlIDTPGH~DF~   92 (606)
                      +.++|...-|||+|+-|+.  .+.+.....               =||... ...+   ..+++.+.++|.||+|+.+|.
T Consensus         4 ivllGd~~VGKTsL~~rf~--~~~F~~~~~---------------pTi~~~~~~~i---~v~~~~~~l~iwDTaG~e~~~   63 (176)
T cd04133           4 CVTVGDGAVGKTCMLICYT--SNKFPTDYI---------------PTVFDNFSANV---SVDGNTVNLGLWDTAGQEDYN   63 (176)
T ss_pred             EEEECCCCCCHHHHHHHHH--HCCCCCCCC---------------CCEEEEEEEEE---EECCEEEEEEEEECCCCCCCC
T ss_conf             9998999977999999996--598999867---------------85358999999---999989999999799976542


Q ss_pred             HHHHHHHHHCCEEEEEEECCCCCCHHHHH----HHHHHH---HCCCCEEEEECCCCCCCCCCC--------CH-HHHHHH
Q ss_conf             99999997302689999868788655899----999999---709967998326788753211--------33-888775
Q gi|254780321|r   93 YEVSRSLSACEGSLLVVDATQGVEAQTLA----NVYQAI---DNNHEIITVLNKADLPSADPD--------RV-KKQIEE  156 (606)
Q Consensus        93 ~EV~r~l~a~dgaiLvVdA~~Gvq~QT~~----~~~~A~---~~~l~~I~viNKiD~~~A~~e--------~v-~~ei~~  156 (606)
                      .-.....+-++++|||-|-+.   .+|..    .|..-+   .-+.|+|+|-||+|+.+.+..        .+ .+|-++
T Consensus        64 ~l~~~~y~~a~~~ilvydi~~---~~Sf~~~~~~w~~~~~~~~~~~piilvGnK~DL~~~r~~~~~~~~~~~Vs~~e~~~  140 (176)
T cd04133          64 RLRPLSYRGADVFVLAFSLIS---RASYENVLKKWVPELRHYAPNVPIVLVGTKLDLRDDKQYLADHPGASPITTAQGEE  140 (176)
T ss_pred             HHHHHHHCCCCEEEEEEECCC---HHHHHHHHHHHHHHHHHHCCCCCEEEEEECHHHHHCHHHHHHCCCCCCCCHHHHHH
T ss_conf             468987267875799997898---78999999999999998684998899998632021222333302467777999999


Q ss_pred             HH-HHHHHHHHHHHHHCCCCCCHHHHHHHHHHHC
Q ss_conf             55-3223210001110022320067877632100
Q gi|254780321|r  157 TI-GISTEDALLVSAKTGEGIPLLLERIVQQLPS  189 (606)
Q Consensus       157 ~~-g~~~~~ii~vSAktG~GV~~LLd~Iv~~iP~  189 (606)
                      +- .+.....+-+|||+|.||+++++.++..+=-
T Consensus       141 ~a~~~~~~~y~EtSAk~~~nV~e~F~~~~~~il~  174 (176)
T cd04133         141 LRKQIGAAAYIECSSKTQQNVKAVFDAAIKVVLQ  174 (176)
T ss_pred             HHHHCCCCEEEEECCCCCCCHHHHHHHHHHHHHC
T ss_conf             9997799789994789880989999999999808


No 214
>cd04130 Wrch_1 Wrch-1 subfamily.  Wrch-1 (Wnt-1 responsive Cdc42 homolog) is a Rho family GTPase that shares significant sequence and functional similarity with Cdc42.  Wrch-1 was first identified in mouse mammary epithelial cells, where its transcription is upregulated in Wnt-1 transformation.  Wrch-1 contains N- and C-terminal extensions relative to cdc42, suggesting potential differences in cellular localization and function.  The Wrch-1 N-terminal extension contains putative SH3 domain-binding motifs and has been shown to bind the SH3 domain-containing protein Grb2, which increases the level of active Wrch-1 in cells.  Unlike Cdc42, which localizes to the cytosol and perinuclear membranes, Wrch-1 localizes extensively with the plasma membrane and endosomes.  The membrane association, localization, and biological activity of Wrch-1 indicate an atypical model of regulation distinct from other Rho family GTPases.  Most Rho proteins contain a lipid modification site at the C-terminus, 
Probab=99.24  E-value=4.4e-10  Score=87.16  Aligned_cols=151  Identities=20%  Similarity=0.199  Sum_probs=95.2

Q ss_pred             EEEECCCCCCHHHHHHHHHHHCCCCCCCCCCCEEECCCHHHHHHCCEEEE-EEEEEEEECCCCCEEEEEEEECCCCCHHH
Q ss_conf             99980138987788999999829805444431130586779871950523-27999974378843899996178730027
Q gi|254780321|r   14 FSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKA-QTVRLNYTSTDAKDYQLNLIDTPGHVDFT   92 (606)
Q Consensus        14 ~~IiaHvDhGKTTL~d~lL~~tg~i~~~~~~~~vlD~~~~EreRGITIka-~~~~~~~~~~~~~~y~iNlIDTPGH~DF~   92 (606)
                      +.++|..+-|||+|.-|++  .+.+...- .              -|+-. ....+.   .+++.+.++|.||+|+.+|.
T Consensus         3 vvlvGd~~VGKTsli~r~~--~~~F~~~y-~--------------pT~~~~~~~~i~---~~~~~v~l~iwDtaG~e~~~   62 (173)
T cd04130           3 CVLVGDGAVGKTSLIVSYT--TNGYPTEY-V--------------PTAFDNFSVVVL---VDGKPVRLQLCDTAGQDEFD   62 (173)
T ss_pred             EEEECCCCCCHHHHHHHHH--HCCCCCCC-C--------------CCEEEEEEEEEE---ECCEEEEEEEEECCCCCCCC
T ss_conf             9999989978899999996--19999985-7--------------835899999999---99999999999899873443


Q ss_pred             HHHHHHHHHCCEEEEEEECCCCCCHHHHH-HHHHHHH---CCCCEEEEECCCCCCCCCC---------CC-HH-HHHHHH
Q ss_conf             99999997302689999868788655899-9999997---0996799832678875321---------13-38-887755
Q gi|254780321|r   93 YEVSRSLSACEGSLLVVDATQGVEAQTLA-NVYQAID---NNHEIITVLNKADLPSADP---------DR-VK-KQIEET  157 (606)
Q Consensus        93 ~EV~r~l~a~dgaiLvVdA~~Gvq~QT~~-~~~~A~~---~~l~~I~viNKiD~~~A~~---------e~-v~-~ei~~~  157 (606)
                      .-....++-+|++|||-|-+.=--=+-+. .|.....   .+.|+|+|=||+|+.....         ++ |. +|...+
T Consensus        63 ~l~~~~~~~a~~~ilvydv~~~~Sf~~l~~~w~~~i~~~~~~~piilvGnK~DL~~~~~~~~~~~~~~~r~Vs~~e~~~~  142 (173)
T cd04130          63 KLRPLCYPDTDVFLLCFSVVNPSSFQNISEKWIPEIRKHNPKAPIILVGTQADLRTDVNVLIQLARYGEKPVSQSRAKAL  142 (173)
T ss_pred             HHHHHHHCCCCEEEEEEECCCHHHHHHHHHHHHHHHHHCCCCCCEEEEEECCCCCCCHHHHHHHHHCCCCCCCHHHHHHH
T ss_conf             45676613787899999659878899999999999996098998899988701100133554443325755789999999


Q ss_pred             H-HHHHHHHHHHHHHCCCCCCHHHHHHH
Q ss_conf             5-32232100011100223200678776
Q gi|254780321|r  158 I-GISTEDALLVSAKTGEGIPLLLERIV  184 (606)
Q Consensus       158 ~-g~~~~~ii~vSAktG~GV~~LLd~Iv  184 (606)
                      - .+..-..+-+|||+|.||+++++.++
T Consensus       143 a~~~~~~~y~EtSAkt~~nV~e~Fe~~i  170 (173)
T cd04130         143 AEKIGACEYIECSALTQKNLKEVFDTAI  170 (173)
T ss_pred             HHHCCCCEEEEECCCCCCCHHHHHHHHH
T ss_conf             9984996899968688969799999998


No 215
>cd04135 Tc10 TC10 subfamily.  TC10 is a Rho family protein that has been shown to induce microspike formation and neurite outgrowth in vitro.  Its expression changes dramatically after peripheral nerve injury, suggesting an important role in promoting axonal outgrowth and regeneration.  TC10 regulates translocation of insulin-stimulated GLUT4 in adipocytes and has also been shown to bind directly to Golgi COPI coat proteins.  GTP-bound TC10 in vitro can bind numerous potential effectors.  Depending on its subcellular localization and distinct functional domains, TC10 can differentially regulate two types of filamentous actin in adipocytes.  TC10 mRNAs are highly expressed in three types of mouse muscle tissues:  leg skeletal muscle, cardiac muscle, and uterus; they were also present in brain, with higher levels in adults than in newborns.  TC10 has also been shown to play a role in regulating the expression of cystic fibrosis transmembrane conductance regulator (CFTR) through interacti
Probab=99.23  E-value=5.2e-10  Score=86.70  Aligned_cols=153  Identities=20%  Similarity=0.236  Sum_probs=97.8

Q ss_pred             EEEEECCCCCCHHHHHHHHHHHCCCCCCCCCCCEEECCCHHHHHHCCEEEEEEEEEEEECCCCCEEEEEEEECCCCCHHH
Q ss_conf             79998013898778899999982980544443113058677987195052327999974378843899996178730027
Q gi|254780321|r   13 NFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVRLNYTSTDAKDYQLNLIDTPGHVDFT   92 (606)
Q Consensus        13 N~~IiaHvDhGKTTL~d~lL~~tg~i~~~~~~~~vlD~~~~EreRGITIka~~~~~~~~~~~~~~y~iNlIDTPGH~DF~   92 (606)
                      -+.++|..+.|||+|.-|++  .+.+.+.- ..++.|.             ....+.   .+++.+.++|.||+|+.+|.
T Consensus         2 Kiv~vGd~~VGKTsli~rf~--~~~f~~~y-~pTi~~~-------------~~~~i~---v~~~~~~l~i~DTaG~e~~~   62 (174)
T cd04135           2 KCVVVGDGAVGKTCLLMSYA--NDAFPEEY-VPTVFDH-------------YAVSVT---VGGKQYLLGLYDTAGQEDYD   62 (174)
T ss_pred             EEEEECCCCCCHHHHHHHHH--HCCCCCCC-CCEEEEE-------------EEEEEE---ECCEEEEEEEEECCCCCCCH
T ss_conf             89999989985999999996--29899886-8857520-------------227999---99999999999797640315


Q ss_pred             HHHHHHHHHCCEEEEEEECCCCCCHHHHHH----HHHHH---HCCCCEEEEECCCCCCCCC----------CCCH-HHHH
Q ss_conf             999999973026899998687886558999----99999---7099679983267887532----------1133-8887
Q gi|254780321|r   93 YEVSRSLSACEGSLLVVDATQGVEAQTLAN----VYQAI---DNNHEIITVLNKADLPSAD----------PDRV-KKQI  154 (606)
Q Consensus        93 ~EV~r~l~a~dgaiLvVdA~~Gvq~QT~~~----~~~A~---~~~l~~I~viNKiD~~~A~----------~e~v-~~ei  154 (606)
                      .-....++-+++++||-|-++   .+|..+    |..-.   ..++|+|+|=||+|+....          ...| .+|-
T Consensus        63 ~~~~~~~~~a~~~ilvydi~~---~~Sf~~~~~~w~~~~~~~~~~~piilvgnK~DL~~~~~~~~~~~~~~~r~Vs~eeg  139 (174)
T cd04135          63 RLRPLSYPMTDVFLICFSVVN---PASFQNVKEEWVPELKEYAPNVPYLLVGTQIDLRDDPKTLARLNDMKEKPVTVEQG  139 (174)
T ss_pred             HHHHHHHCCCCEEEEEEECCC---HHHHHHHHHHHHHHHHHHCCCCCEEEEEECHHHCCCHHHHHHHCCCCCCCCCHHHH
T ss_conf             565998557876789843797---78899999999999998684998899968523004434554530045766399999


Q ss_pred             HHHH-HHHHHHHHHHHHHCCCCCCHHHHHHHHHH
Q ss_conf             7555-32232100011100223200678776321
Q gi|254780321|r  155 EETI-GISTEDALLVSAKTGEGIPLLLERIVQQL  187 (606)
Q Consensus       155 ~~~~-g~~~~~ii~vSAktG~GV~~LLd~Iv~~i  187 (606)
                      +.+- .+...-.+.+|||+|.||+++++.++..+
T Consensus       140 ~~~A~~~g~~~f~E~SAkt~~nV~e~F~~~i~~i  173 (174)
T cd04135         140 QKLAKEIGAHCYVECSALTQKGLKTVFDEAILAI  173 (174)
T ss_pred             HHHHHHCCCCEEEEECCCCCCCHHHHHHHHHHHH
T ss_conf             9999977998999905487949899999999997


No 216
>cd04115 Rab33B_Rab33A Rab33B/Rab33A subfamily.  Rab33B is ubiquitously expressed in mouse tissues and cells, where it is localized to the medial Golgi cisternae. It colocalizes with alpha-mannose II.  Together with the other cisternal Rabs, Rab6A and Rab6A', it is believed to regulate the Golgi response to stress and is likely a molecular target in stress-activated signaling pathways. Rab33A (previously known as S10) is expressed primarily in the brain and immune system cells.  In humans, it is located on the X chromosome at Xq26 and its expression is down-regulated in tuberculosis patients. Experimental evidence suggests that Rab33A is a novel CD8+ T cell factor that likely plays a role in tuberculosis disease processes.  GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state.  Rabs are further regulated by guanine 
Probab=99.23  E-value=9.2e-10  Score=85.01  Aligned_cols=158  Identities=21%  Similarity=0.278  Sum_probs=98.9

Q ss_pred             CEEEEEECCCCCCHHHHHHHHHHHCCCCCCCCCCCEEECCCHHHHHHCCEEEEEEEEEEEECCCCCEEEEEEEECCCCCH
Q ss_conf             31799980138987788999999829805444431130586779871950523279999743788438999961787300
Q gi|254780321|r   11 IRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVRLNYTSTDAKDYQLNLIDTPGHVD   90 (606)
Q Consensus        11 IRN~~IiaHvDhGKTTL~d~lL~~tg~i~~~~~~~~vlD~~~~EreRGITIka~~~~~~~~~~~~~~y~iNlIDTPGH~D   90 (606)
                      +=.++++|....|||+|.-|++  .+.+.+.- ..++          |+....+.+.     .+++.+.+++.||+|...
T Consensus         2 ~~Kiv~lGd~~VGKTsli~r~~--~~~F~~~~-~~Ti----------g~d~~~k~i~-----v~~~~v~l~iwDtaG~e~   63 (170)
T cd04115           2 IFKIIVIGDSNVGKTCLTYRFC--AGRFPERT-EATI----------GVDFRERTVE-----IDGERIKVQLWDTAGQER   63 (170)
T ss_pred             EEEEEEECCCCCCHHHHHHHHH--CCCCCCCC-CCCE----------EEEEEEEEEE-----ECCEEEEEEEEECCCCHH
T ss_conf             6999999979977999999995--39889987-8863----------0787899999-----999999999997788530


Q ss_pred             HH-HHHHHHHHHCCEEEEEEECCCCCCHHHHHHHHHH-HH----CCCCEEEEECCCCCCCCCCCCHHHHHHHHHHHHHHH
Q ss_conf             27-9999999730268999986878865589999999-97----099679983267887532113388877555322321
Q gi|254780321|r   91 FT-YEVSRSLSACEGSLLVVDATQGVEAQTLANVYQA-ID----NNHEIITVLNKADLPSADPDRVKKQIEETIGISTED  164 (606)
Q Consensus        91 F~-~EV~r~l~a~dgaiLvVdA~~Gvq~QT~~~~~~A-~~----~~l~~I~viNKiD~~~A~~e~v~~ei~~~~g~~~~~  164 (606)
                      |. .-.....+-+||+|||.|.+.=--=+....|..- .+    ..+|+++|-||+|+...+. -..+|.+++-.--.-.
T Consensus        64 ~~~s~~~~~~~~a~~~ilvydvt~~~Sf~~~~~w~~~i~~~~~~~~~p~vlVGNK~DL~~~r~-Vs~~e~~~~a~~~~~~  142 (170)
T cd04115          64 FRKSMVQHYYRNVHAVVFVYDVTNMASFHSLPSWIEECEQHSLPNEVPRILVGNKCDLREQIQ-VPTDLAQRFADAHSMP  142 (170)
T ss_pred             HHHHHHHHHHCCCCEEEEEEECCCHHHHHHHHHHHHHHHHHCCCCCCCEEEEEECCCCHHHCC-CCHHHHHHHHHHCCCE
T ss_conf             567778998457735799950474767999999999999865888997999999821341178-7999999999977999


Q ss_pred             HHHHHHH---CCCCCCHHHHHHHHHH
Q ss_conf             0001110---0223200678776321
Q gi|254780321|r  165 ALLVSAK---TGEGIPLLLERIVQQL  187 (606)
Q Consensus       165 ii~vSAk---tG~GV~~LLd~Iv~~i  187 (606)
                      .+.+|||   +|.||++++..+...+
T Consensus       143 ~~E~SAK~~~~~~nV~~~F~~la~~i  168 (170)
T cd04115         143 LFETSAKDPSENDHVEAIFMTLAHKL  168 (170)
T ss_pred             EEEECCCCCCCCCCHHHHHHHHHHHH
T ss_conf             99988899851708899999999996


No 217
>cd01874 Cdc42 Cdc42 subfamily.  Cdc42 is an essential GTPase that belongs to the Rho family of Ras-like GTPases.  These proteins act as molecular switches by responding to exogenous and/or endogenous signals and relaying those signals to activate downstream components of a biological pathway.  Cdc42 transduces signals to the actin cytoskeleton to initiate and maintain polarized growth and to mitogen-activated protein morphogenesis. In the budding yeast Saccharomyces cerevisiae, Cdc42 plays an important role in multiple actin-dependent morphogenetic events such as bud emergence, mating-projection formation, and pseudohyphal growth.  In mammalian cells, Cdc42 regulates a variety of actin-dependent events and induces the JNK/SAPK protein kinase cascade, which leads to the activation of transcription factors within the nucleus.  Cdc42 mediates these processes through interactions with a myriad of downstream effectors, whose number and regulation we are just starting to understand.  In addi
Probab=99.23  E-value=8.1e-10  Score=85.41  Aligned_cols=152  Identities=16%  Similarity=0.188  Sum_probs=97.1

Q ss_pred             EEEEECCCCCCHHHHHHHHHHHCCCCCCCCCCCEEECCCHHHHHHCCEEEEEEEEEEEECCCCCEEEEEEEECCCCCHHH
Q ss_conf             79998013898778899999982980544443113058677987195052327999974378843899996178730027
Q gi|254780321|r   13 NFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVRLNYTSTDAKDYQLNLIDTPGHVDFT   92 (606)
Q Consensus        13 N~~IiaHvDhGKTTL~d~lL~~tg~i~~~~~~~~vlD~~~~EreRGITIka~~~~~~~~~~~~~~y~iNlIDTPGH~DF~   92 (606)
                      .+.++|..+-|||+|.-|++  .+.+....               .-||... .+... ..+++.+.++|.||+|+.+|.
T Consensus         3 Kvv~lGd~~VGKTsli~r~~--~~~f~~~y---------------~pti~~~-~~~~~-~~~~~~v~l~iwDTaG~e~~~   63 (175)
T cd01874           3 KCVVVGDGAVGKTCLLISYT--TNKFPSEY---------------VPTVFDN-YAVTV-MIGGEPYTLGLFDTAGQEDYD   63 (175)
T ss_pred             EEEEECCCCCCHHHHHHHHH--HCCCCCCC---------------CCCEEEE-EEEEE-EECCEEEEEEEEECCCCCCCH
T ss_conf             99998999958899999996--49899986---------------7863478-99999-999999999999899974512


Q ss_pred             HHHHHHHHHCCEEEEEEECCCCCCHHHHHHH----HHHH---HCCCCEEEEECCCCCCCCCC----------CCHH-HHH
Q ss_conf             9999999730268999986878865589999----9999---70996799832678875321----------1338-887
Q gi|254780321|r   93 YEVSRSLSACEGSLLVVDATQGVEAQTLANV----YQAI---DNNHEIITVLNKADLPSADP----------DRVK-KQI  154 (606)
Q Consensus        93 ~EV~r~l~a~dgaiLvVdA~~Gvq~QT~~~~----~~A~---~~~l~~I~viNKiD~~~A~~----------e~v~-~ei  154 (606)
                      .-....++-+|++|||-|-++   .+|..++    ..-+   ..+.|+|+|=||+|+...++          ..|. +|-
T Consensus        64 ~l~~~~~~~~~~~ilvydv~d---~~Sf~~i~~~w~~~i~~~~~~~p~iLVGnK~DL~~~~~~~~~~~~~~~r~V~~~eg  140 (175)
T cd01874          64 RLRPLSYPQTDVFLVCFSVVS---PSSFENVKEKWVPEITHHCPKTPFLLVGTQIDLRDDPSTIEKLAKNKQKPITPETG  140 (175)
T ss_pred             HHHHHHHHCCCEEEEEEECCC---HHHHHHHHHHHHHHHHHHCCCCCEEEEEECCCCCCCHHHHHHHHHCCCCCCCHHHH
T ss_conf             465887713888899963798---78899999999999998298998899998720335666677764402656689999


Q ss_pred             HHHH-HHHHHHHHHHHHHCCCCCCHHHHHHHHH
Q ss_conf             7555-3223210001110022320067877632
Q gi|254780321|r  155 EETI-GISTEDALLVSAKTGEGIPLLLERIVQQ  186 (606)
Q Consensus       155 ~~~~-g~~~~~ii~vSAktG~GV~~LLd~Iv~~  186 (606)
                      +.+- .+..-..+-+|||+|.||+++++.++..
T Consensus       141 ~~lA~~~~~~~y~EtSAk~g~nV~e~F~~~i~~  173 (175)
T cd01874         141 EKLARDLKAVKYVECSALTQKGLKNVFDEAILA  173 (175)
T ss_pred             HHHHHHCCCCEEEECCCCCCCCHHHHHHHHHHH
T ss_conf             999997599599991337895979999999998


No 218
>TIGR03156 GTP_HflX GTP-binding protein HflX. This protein family is one of a number of homologous small, well-conserved GTP-binding proteins with pleiotropic effects. Bacterial members are designated HflX, following the naming convention in Escherichia coli where HflX is encoded immediately downstream of the RNA chaperone Hfq, and immediately upstream of HflKC, a membrane-associated protease pair with an important housekeeping function. Over large numbers of other bacterial genomes, the pairing with hfq is more significant than with hflK and hlfC. The gene from Homo sapiens in this family has been named PGPL (pseudoautosomal GTP-binding protein-like).
Probab=99.21  E-value=4.5e-10  Score=87.11  Aligned_cols=151  Identities=31%  Similarity=0.366  Sum_probs=90.4

Q ss_pred             HCEEEEEECCCCCCHHHHHHHHHHHCCCCCCCCCCCEEECCCHHHHHHCCEEEEEEEEEEEECCCCCEEEEEEEECCCCC
Q ss_conf             53179998013898778899999982980544443113058677987195052327999974378843899996178730
Q gi|254780321|r   10 RIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVRLNYTSTDAKDYQLNLIDTPGHV   89 (606)
Q Consensus        10 ~IRN~~IiaHvDhGKTTL~d~lL~~tg~i~~~~~~~~vlD~~~~EreRGITIka~~~~~~~~~~~~~~y~iNlIDTPGH~   89 (606)
                      .+-.+|++|--.+|||||.-+|   ||.  .....++.          .-|....+-.+.+  .++.  .+-+.||+|..
T Consensus       188 ~~p~ValVGYTNAGKSTL~n~L---t~~--~~~~~d~l----------FaTLd~t~r~~~l--~~~~--~~ll~DTVGFI  248 (351)
T TIGR03156       188 GVPTVALVGYTNAGKSTLFNAL---TGA--DVYAADQL----------FATLDPTTRRLDL--PDGG--EVLLTDTVGFI  248 (351)
T ss_pred             CCCEEEEECCCCCCHHHHHHHH---HHC--CCCCCCCC----------EEECCCCCCEEEC--CCCC--EEEEEECCCHH
T ss_conf             9976999667887789999998---517--76410343----------1353673204887--9997--69998150056


Q ss_pred             H---------HHHHHHHHHHHCCEEEEEEECCCC-CCHHHHHHHHHHHHCC---CCEEEEECCCCCCCCCCCCHHHHHHH
Q ss_conf             0---------279999999730268999986878-8655899999999709---96799832678875321133888775
Q gi|254780321|r   90 D---------FTYEVSRSLSACEGSLLVVDATQG-VEAQTLANVYQAIDNN---HEIITVLNKADLPSADPDRVKKQIEE  156 (606)
Q Consensus        90 D---------F~~EV~r~l~a~dgaiLvVdA~~G-vq~QT~~~~~~A~~~~---l~~I~viNKiD~~~A~~e~v~~ei~~  156 (606)
                      .         |..-.+. ..-+|-.|.|||+++- .+.|-..+...-.+.|   .|+|.|+||||+...  +. ...+. 
T Consensus       249 ~~LP~~Li~aF~sTLee-~~~aDlllhVvD~S~~~~~~~~~~v~~~L~elg~~~~p~i~V~NKiD~~~~--~~-~~~~~-  323 (351)
T TIGR03156       249 RDLPHELVAAFRATLEE-VREADLLLHVVDASDPDREEQIEAVEEVLEELGAEDIPQLLVYNKIDLLDE--PR-IERLE-  323 (351)
T ss_pred             HHCCHHHHHHHHHHHHH-HHHCCEEEEEECCCCCCHHHHHHHHHHHHHHCCCCCCCEEEEEECHHCCCH--HH-HHHHH-
T ss_conf             30886799999999999-985989999805888478999999999999769999988999967015895--77-89987-


Q ss_pred             HHHHHHHHHHHHHHHCCCCCCHHHHHHHHHH
Q ss_conf             5532232100011100223200678776321
Q gi|254780321|r  157 TIGISTEDALLVSAKTGEGIPLLLERIVQQL  187 (606)
Q Consensus       157 ~~g~~~~~ii~vSAktG~GV~~LLd~Iv~~i  187 (606)
                         ....+.+++||++|.|++.|++.|.+.+
T Consensus       324 ---~~~~~~v~ISA~~g~gi~~L~~~I~~~L  351 (351)
T TIGR03156       324 ---EGYPEAVFVSAKTGEGLDLLLEAIAERL  351 (351)
T ss_pred             ---HCCCCEEEEECCCCCCHHHHHHHHHHHC
T ss_conf             ---3799879996899989999999999559


No 219
>cd04162 Arl9_Arfrp2_like Arl9/Arfrp2-like subfamily.  Arl9 (Arf-like 9) was first identified as part of the Human Cancer Genome Project.  It maps to chromosome 4q12 and is sometimes referred to as Arfrp2 (Arf-related protein 2).  This is a novel subfamily identified in human cancers that is uncharacterized to date.
Probab=99.21  E-value=2.5e-10  Score=88.79  Aligned_cols=150  Identities=19%  Similarity=0.256  Sum_probs=102.5

Q ss_pred             EEEECCCCCCHHHHHHHHHHHCCCCCCCCCCCEEECCCHHHHHHCCEEEEEEEEEEEECCCCCEEEEEEEECCCCCHHHH
Q ss_conf             99980138987788999999829805444431130586779871950523279999743788438999961787300279
Q gi|254780321|r   14 FSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVRLNYTSTDAKDYQLNLIDTPGHVDFTY   93 (606)
Q Consensus        14 ~~IiaHvDhGKTTL~d~lL~~tg~i~~~~~~~~vlD~~~~EreRGITIka~~~~~~~~~~~~~~y~iNlIDTPGH~DF~~   93 (606)
                      |-++|=-++|||||..+|.  .+.... ..              .-|+-.+..++.|     +++.+++.|++|+..|..
T Consensus         2 IlilGLd~aGKTTil~~l~--~~~~~~-~~--------------~PT~Gf~~~~i~~-----~~~~l~~wDlgGq~~~R~   59 (164)
T cd04162           2 ILVLGLDGAGKTSLLHSLS--SERSLE-SV--------------VPTTGFNSVAIPT-----QDAIMELLEIGGSQNLRK   59 (164)
T ss_pred             EEEECCCCCCHHHHHHHHH--CCCCCC-CC--------------CCCCCCCEEEEEE-----CCEEEEEEECCCHHHHHH
T ss_conf             9999679998999999981--699876-53--------------5632774699998-----999999985375288865


Q ss_pred             HHHHHHHHCCEEEEEEECCCCC-CHHHHHHHHHHH--HCCCCEEEEECCCCCCCCCCCCHHHHHHHHHHHHHH-----HH
Q ss_conf             9999997302689999868788-655899999999--709967998326788753211338887755532232-----10
Q gi|254780321|r   94 EVSRSLSACEGSLLVVDATQGV-EAQTLANVYQAI--DNNHEIITVLNKADLPSADPDRVKKQIEETIGISTE-----DA  165 (606)
Q Consensus        94 EV~r~l~a~dgaiLvVdA~~Gv-q~QT~~~~~~A~--~~~l~~I~viNKiD~~~A~~e~v~~ei~~~~g~~~~-----~i  165 (606)
                      --.+-..-|+|.++|||+++=- ..+.+..++..+  ..++|++++-||.|+|+|.   -.+||.+.++++.-     -.
T Consensus        60 ~W~~Y~~~~~gIIfVVDssD~~rl~eak~~L~~ll~~~~~~PlLIlaNKqDl~~a~---s~~ei~~~L~L~~i~~~r~w~  136 (164)
T cd04162          60 YWKRYLSGSQGLIFVVDSADSERLPLARQELHQLLQHPPDLPLVVLANKQDLPAAR---SVQEIHKELELEPIARGRRWI  136 (164)
T ss_pred             HHHHHHHCCCEEEEEEECCCHHHHHHHHHHHHHHHHCCCCCEEEEEEECCCCCCCC---CHHHHHHHCCCCCCCCCCCEE
T ss_conf             69987117758999995688889999999999997087998699998632433699---999999866994637999889


Q ss_pred             HHHHHHCCCCCCHHHHHHHHHHH
Q ss_conf             00111002232006787763210
Q gi|254780321|r  166 LLVSAKTGEGIPLLLERIVQQLP  188 (606)
Q Consensus       166 i~vSAktG~GV~~LLd~Iv~~iP  188 (606)
                      +.++|.+|.|.+.-++.+.+.+-
T Consensus       137 iq~~s~~g~gl~~~~~~l~~~~~  159 (164)
T cd04162         137 LQGTSLDDDGSPSRMEAVKDLLS  159 (164)
T ss_pred             EEEECCCCCCCHHHHHHHHHHHH
T ss_conf             97110479985899999999999


No 220
>PRK05291 trmE tRNA modification GTPase TrmE; Reviewed
Probab=99.19  E-value=6.1e-10  Score=86.23  Aligned_cols=143  Identities=31%  Similarity=0.343  Sum_probs=96.7

Q ss_pred             EEEEECCCCCCHHHHHHHHHHHCCCCCCCCCCCEEECCCHHHHHHCCEEEEEEEEEEEECCCCCEEEEEEEECCCCCHHH
Q ss_conf             79998013898778899999982980544443113058677987195052327999974378843899996178730027
Q gi|254780321|r   13 NFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVRLNYTSTDAKDYQLNLIDTPGHVDFT   92 (606)
Q Consensus        13 N~~IiaHvDhGKTTL~d~lL~~tg~i~~~~~~~~vlD~~~~EreRGITIka~~~~~~~~~~~~~~y~iNlIDTPGH~DF~   92 (606)
                      .++|+|-...|||||.-+|+..--+|-...              -|-|--.-...+.+     +.+.++|+||.|--+=.
T Consensus       218 ~v~i~G~PN~GKSSL~N~L~~~drAIVS~i--------------pGTTRD~ie~~l~l-----~G~~v~l~DTAGiR~t~  278 (445)
T PRK05291        218 KVVIAGRPNVGKSSLLNALLGEERAIVTDI--------------AGTTRDVIEEHINL-----DGIPLRLIDTAGIRETE  278 (445)
T ss_pred             EEEEECCCCCCHHHHHHHHHCCCCEEECCC--------------CCCCCCEEEEEEEE-----CCEEEEEEECCCCCCCC
T ss_conf             699889998768999999857874673189--------------99740402236899-----99899999899766557


Q ss_pred             HH-----HHHHHHH---CCEEEEEEECCCCCCHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCCHHHHHHHHHHHHHHH
Q ss_conf             99-----9999973---026899998687886558999999997099679983267887532113388877555322321
Q gi|254780321|r   93 YE-----VSRSLSA---CEGSLLVVDATQGVEAQTLANVYQAIDNNHEIITVLNKADLPSADPDRVKKQIEETIGISTED  164 (606)
Q Consensus        93 ~E-----V~r~l~a---~dgaiLvVdA~~Gvq~QT~~~~~~A~~~~l~~I~viNKiD~~~A~~e~v~~ei~~~~g~~~~~  164 (606)
                      .+     +.|+...   +|-.|+|+|++++....-...+.  ...+-+.|+|+||+|+.....             ...+
T Consensus       279 d~IE~~GI~ra~~~~~~ADlil~v~D~s~~~~~~~~~~~~--~~~~~~~i~V~NK~DL~~~~~-------------~~~~  343 (445)
T PRK05291        279 DEVEKIGIERSRKAIEEADLVLLVLDASEPLTEEDKEILE--EFKNKPVIVVLNKADLTGEKI-------------DGLP  343 (445)
T ss_pred             CHHHHHHHHHHHHHHHHCCEEEEEEECCCCCCCCHHHHHH--HCCCCCEEEEEEHHHCCCCCC-------------CCCC
T ss_conf             4588999999999998399999998799888722599998--517998799985120466534-------------7897


Q ss_pred             HHHHHHHCCCCCCHHHHHHHHHHHC
Q ss_conf             0001110022320067877632100
Q gi|254780321|r  165 ALLVSAKTGEGIPLLLERIVQQLPS  189 (606)
Q Consensus       165 ii~vSAktG~GV~~LLd~Iv~~iP~  189 (606)
                      ++.+||++|.|++.|++.|.+.+..
T Consensus       344 ~i~iSak~g~Gi~~L~~~i~~~~~~  368 (445)
T PRK05291        344 VIRISAKTGEGIDELEEALKQLVGF  368 (445)
T ss_pred             EEEEECCCCCCHHHHHHHHHHHHHC
T ss_conf             5999837886999999999999704


No 221
>COG0370 FeoB Fe2+ transport system protein B [Inorganic ion transport and metabolism]
Probab=99.18  E-value=5.9e-10  Score=86.33  Aligned_cols=148  Identities=26%  Similarity=0.399  Sum_probs=105.7

Q ss_pred             EEEECCCCCCHHHHHHHHHHHCCCCCCCCCCCEEECCCHHHHHHCCEEEEEEEEEEEECCCCCEEEEEEEECCCCCHHH-
Q ss_conf             9998013898778899999982980544443113058677987195052327999974378843899996178730027-
Q gi|254780321|r   14 FSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVRLNYTSTDAKDYQLNLIDTPGHVDFT-   92 (606)
Q Consensus        14 ~~IiaHvDhGKTTL~d~lL~~tg~i~~~~~~~~vlD~~~~EreRGITIka~~~~~~~~~~~~~~y~iNlIDTPGH~DF~-   92 (606)
                      +|++|.-..|||||-.+|   ||+-.  ..+|.          -|.|+--+...+.|.     .+.+.+||.||--+++ 
T Consensus         6 valvGNPNvGKTtlFN~L---TG~~q--~VgNw----------pGvTVEkkeg~~~~~-----~~~i~ivDLPG~YSL~~   65 (653)
T COG0370           6 VALVGNPNVGKTTLFNAL---TGANQ--KVGNW----------PGVTVEKKEGKLKYK-----GHEIEIVDLPGTYSLTA   65 (653)
T ss_pred             EEEECCCCCCHHHHHHHH---HCCCC--EECCC----------CCCEEEEEEEEEEEC-----CCEEEEEECCCCCCCCC
T ss_conf             898569985489999998---56674--65478----------980699878899735-----85489986897565888


Q ss_pred             --H--HHHHH-H--HHCCEEEEEEECCCCCCHHHHHHHHHH---HHCCCCEEEEECCCCCCCCCCCCH---HHHHHHHHH
Q ss_conf             --9--99999-9--730268999986878865589999999---970996799832678875321133---888775553
Q gi|254780321|r   93 --Y--EVSRS-L--SACEGSLLVVDATQGVEAQTLANVYQA---IDNNHEIITVLNKADLPSADPDRV---KKQIEETIG  159 (606)
Q Consensus        93 --~--EV~r~-l--~a~dgaiLvVdA~~Gvq~QT~~~~~~A---~~~~l~~I~viNKiD~~~A~~e~v---~~ei~~~~g  159 (606)
                        .  .|.|- |  -..|..+-||||+.     -+.|+|+.   +|.|.|.|+++|++|.  |....+   .+.+++.+|
T Consensus        66 ~S~DE~Var~~ll~~~~D~ivnVvDA~n-----LeRnLyltlQLlE~g~p~ilaLNm~D~--A~~~Gi~Id~~~L~~~LG  138 (653)
T COG0370          66 YSEDEKVARDFLLEGKPDLIVNVVDATN-----LERNLYLTLQLLELGIPMILALNMIDE--AKKRGIRIDIEKLSKLLG  138 (653)
T ss_pred             CCCHHHHHHHHHHCCCCCEEEEEECCCH-----HHHHHHHHHHHHHCCCCEEEEECCHHH--HHHCCCCCCHHHHHHHHC
T ss_conf             9920899999986389988999602323-----777789999999859985999612756--886497126999999868


Q ss_pred             HHHHHHHHHHHHCCCCCCHHHHHHHHHHHCCC
Q ss_conf             22321000111002232006787763210001
Q gi|254780321|r  160 ISTEDALLVSAKTGEGIPLLLERIVQQLPSPT  191 (606)
Q Consensus       160 ~~~~~ii~vSAktG~GV~~LLd~Iv~~iP~P~  191 (606)
                      ++   ++++||++|.|+++|+++|++..+...
T Consensus       139 vP---Vv~tvA~~g~G~~~l~~~i~~~~~~~~  167 (653)
T COG0370         139 VP---VVPTVAKRGEGLEELKRAIIELAESKT  167 (653)
T ss_pred             CC---EEEEEECCCCCHHHHHHHHHHHCCCCC
T ss_conf             98---899873058897999999987432556


No 222
>cd04148 RGK RGK subfamily.  The RGK (Rem, Rem2, Rad, Gem/Kir) subfamily of Ras GTPases are expressed in a tissue-specific manner and are dynamically regulated by transcriptional and posttranscriptional mechanisms in response to environmental cues.   RGK proteins bind to the beta subunit of L-type calcium channels, causing functional down-regulation of these voltage-dependent calcium channels, and either termination of calcium-dependent secretion or modulation of electrical conduction and contractile function.  Inhibition of L-type calcium channels by Rem2 may provide a mechanism for modulating calcium-triggered exocytosis in hormone-secreting cells, and has been proposed to influence the secretion of insulin in pancreatic beta cells.  RGK proteins also interact with and inhibit the Rho/Rho kinase pathway to modulate remodeling of the cytoskeleton.  Two characteristics of RGK proteins cited in the literature are N-terminal and C-terminal extensions beyond the GTPase domain typical of Ra
Probab=99.17  E-value=1.8e-09  Score=83.02  Aligned_cols=152  Identities=20%  Similarity=0.234  Sum_probs=95.2

Q ss_pred             EEEEECCCCCCHHHHHHHHHHHCCCCCCCCCCCEEECCCHHHHHHCCEEEEEEEEEEEECCCCCEEEEEEEECCCCCHHH
Q ss_conf             79998013898778899999982980544443113058677987195052327999974378843899996178730027
Q gi|254780321|r   13 NFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVRLNYTSTDAKDYQLNLIDTPGHVDFT   92 (606)
Q Consensus        13 N~~IiaHvDhGKTTL~d~lL~~tg~i~~~~~~~~vlD~~~~EreRGITIka~~~~~~~~~~~~~~y~iNlIDTPGH~DF~   92 (606)
                      .++++|-..-|||+|+-+++  +|..........          -|.....+.+.     .+++.+.+.++||+|..+|.
T Consensus         2 KVvllGd~gVGKTSLi~rf~--~~~f~~~~y~~t----------~~~d~~~k~v~-----vd~~~~~l~i~Dt~g~e~~~   64 (221)
T cd04148           2 RVVMLGSPGVGKSSLASQFT--SGEYDDHAYDAS----------GDDDTYERTVS-----VDGEESTLVVIDHWEQEMWT   64 (221)
T ss_pred             EEEEECCCCCHHHHHHHHHH--HCCCCCCCCCCC----------CCEEEEEEEEE-----ECCEEEEEEEEECCCCHHHH
T ss_conf             79999989970999999998--198698667874----------42488999999-----99999899999898731266


Q ss_pred             HHHHHHH-HHCCEEEEEEECCCCCCHHHHHHHHHHHH-----CCCCEEEEECCCCCCCCCCCCH-HHHHHH---HHHHHH
Q ss_conf             9999999-73026899998687886558999999997-----0996799832678875321133-888775---553223
Q gi|254780321|r   93 YEVSRSL-SACEGSLLVVDATQGVEAQTLANVYQAID-----NNHEIITVLNKADLPSADPDRV-KKQIEE---TIGIST  162 (606)
Q Consensus        93 ~EV~r~l-~a~dgaiLvVdA~~Gvq~QT~~~~~~A~~-----~~l~~I~viNKiD~~~A~~e~v-~~ei~~---~~g~~~  162 (606)
                      ..  ..+ ..+|+++||-|-++=--=+-...|+.-+.     .++|+|+|=||+|+...+  .| .+|-++   .+++  
T Consensus        65 ~~--~~~~~~ada~ilVYdvtdr~SF~~~~~~~~~l~~~~~~~~~piILVGNK~DL~~~R--~Vs~eEg~~~A~~~~~--  138 (221)
T cd04148          65 ED--SCMQYQGDAFVVVYSVTDRSSFERASELRIQLRRNRQLEDRPIILVGNKSDLARSR--EVSVQEGRACAVVFDC--  138 (221)
T ss_pred             HH--HHHHHCCCEEEEEEECCCHHHHHHHHHHHHHHHHHCCCCCCEEEEEEECCCHHHHC--CCCHHHHHHHHHHCCC--
T ss_conf             66--56530686899999646677888899999999986489995199985356668638--9999999999998599--


Q ss_pred             HHHHHHHHHCCCCCCHHHHHHHHHHH
Q ss_conf             21000111002232006787763210
Q gi|254780321|r  163 EDALLVSAKTGEGIPLLLERIVQQLP  188 (606)
Q Consensus       163 ~~ii~vSAktG~GV~~LLd~Iv~~iP  188 (606)
                       ..+-+||++|.||+++++.++..|-
T Consensus       139 -~F~EtSAk~~~NV~elF~~lvrqIr  163 (221)
T cd04148         139 -KFIETSAGLQHNVDELLEGIVRQIR  163 (221)
T ss_pred             -EEEECCCCCCCCHHHHHHHHHHHHH
T ss_conf             -8999457999498999999999998


No 223
>cd04109 Rab28 Rab28 subfamily.  First identified in maize, Rab28 has been shown to be a late embryogenesis-abundant (Lea) protein that is regulated by the plant hormone abcisic acid (ABA).  In Arabidopsis, Rab28 is expressed during embryo development and is generally restricted to provascular tissues in mature embryos.  Unlike maize Rab28, it is not ABA-inducible. Characterization of the human Rab28 homolog revealed two isoforms, which differ by a 95-base pair insertion, producing an alternative sequence for the 30 amino acids at the C-terminus.  The two human isoforms are presumbly the result of alternative splicing.  Since they differ at the C-terminus but not in the GTP-binding region, they are predicted to be targeted to different cellular locations.  GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state.  Rabs 
Probab=99.17  E-value=1.8e-09  Score=83.07  Aligned_cols=158  Identities=21%  Similarity=0.295  Sum_probs=99.3

Q ss_pred             EEEECCCCCCHHHHHHHHHHHCCCCCCCCCCCEEECCCHHHHHHCCEEEEEEEEEEEECCCCCEEEEEEEECCCCCHHHH
Q ss_conf             99980138987788999999829805444431130586779871950523279999743788438999961787300279
Q gi|254780321|r   14 FSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVRLNYTSTDAKDYQLNLIDTPGHVDFTY   93 (606)
Q Consensus        14 ~~IiaHvDhGKTTL~d~lL~~tg~i~~~~~~~~vlD~~~~EreRGITIka~~~~~~~~~~~~~~y~iNlIDTPGH~DF~~   93 (606)
                      +.++|-.+-|||+|+-|++  .+.+.+.-. .++          |+-..++.+.+    .+..++.++|.||+|+..|..
T Consensus         3 vvllGd~~VGKTSli~rf~--~~~F~~~y~-~Ti----------G~d~~~k~i~i----~~~~~v~l~iwDtaGqe~~~~   65 (215)
T cd04109           3 IVVLGDGAVGKTSLCRRFA--KEGFGKSYK-QTI----------GLDFFSKRVTL----PGNLNVTLQVWDIGGQSIGGK   65 (215)
T ss_pred             EEEECCCCCCHHHHHHHHH--HCCCCCCCC-CCC----------CEEEEEEEEEE----CCCCEEEEEEEECCCCCCHHH
T ss_conf             9999999970999999997--498988778-865----------57889999998----799469999996998500237


Q ss_pred             HHHHHHHHCCEEEEEEECCCCCCHHHHHHHHHHH----HC-CC--CEEEEECCCCCCCCCCCCHHHHHHHHHHHHHHHHH
Q ss_conf             9999997302689999868788655899999999----70-99--67998326788753211338887755532232100
Q gi|254780321|r   94 EVSRSLSACEGSLLVVDATQGVEAQTLANVYQAI----DN-NH--EIITVLNKADLPSADPDRVKKQIEETIGISTEDAL  166 (606)
Q Consensus        94 EV~r~l~a~dgaiLvVdA~~Gvq~QT~~~~~~A~----~~-~l--~~I~viNKiD~~~A~~e~v~~ei~~~~g~~~~~ii  166 (606)
                      -....++-++|+|||-|-+.=--=+-...|+...    .. .-  ++++|=||+|++..+.= -.+|-+++-.-..-..+
T Consensus        66 ~~~~y~~~a~~~ilVYDitn~~SF~~l~~W~~~i~~~~~~~~~~~~iiLVGNK~DL~~~R~V-s~ee~~~~A~~~g~~f~  144 (215)
T cd04109          66 MLDKYIYGAHAVFLVYDVTNSQSFENLEDWYSMVRKVLKSSETQPLVVLVGNKTDLEHNRTV-KDDKHARFAQANGMESC  144 (215)
T ss_pred             HHHHHHHHHCCEEEECCCCCHHHHHHHHHHHHHHHHHHHCCCCCCEEEEEEECCCHHHHCCC-CHHHHHHHHHHCCCEEE
T ss_conf             89999975151377414786789998999999999985045778529999754542864776-99999999998299899


Q ss_pred             HHHHHCCCCCCHHHHHHHHHHHC
Q ss_conf             01110022320067877632100
Q gi|254780321|r  167 LVSAKTGEGIPLLLERIVQQLPS  189 (606)
Q Consensus       167 ~vSAktG~GV~~LLd~Iv~~iP~  189 (606)
                      .+|||+|.||++++..++..+..
T Consensus       145 E~SAktg~nV~e~F~~la~~i~~  167 (215)
T cd04109         145 LVSAKTGDRVNLLFQQLAAELLG  167 (215)
T ss_pred             EEECCCCCCHHHHHHHHHHHHHC
T ss_conf             98389994989999999999976


No 224
>cd01875 RhoG RhoG subfamily.  RhoG is a GTPase with high sequence similarity to members of the Rac subfamily, including the regions involved in effector recognition and binding.  However, RhoG does not bind to known Rac1 and Cdc42 effectors, including proteins containing a Cdc42/Rac interacting binding (CRIB) motif.  Instead, RhoG interacts directly with Elmo, an upstream regulator of Rac1, in a GTP-dependent manner and forms a ternary complex with Dock180 to induce activation of Rac1.  The RhoG-Elmo-Dock180 pathway is required for activation of Rac1 and cell spreading mediated by integrin, as well as for neurite outgrowth induced by nerve growth factor.  Thus RhoG activates Rac1 through Elmo and Dock180 to control cell morphology.  RhoG has also been shown to play a role in caveolar trafficking and has a novel role in signaling the neutrophil respiratory burst stimulated by G protein-coupled receptor (GPCR) agonists.  Most Rho proteins contain a lipid modification site at the C-termin
Probab=99.16  E-value=2.1e-09  Score=82.60  Aligned_cols=158  Identities=18%  Similarity=0.205  Sum_probs=100.1

Q ss_pred             EEEEECCCCCCHHHHHHHHHHHCCCCCCCCCCCEEECCCHHHHHHCCEEEEEEEEEEEECCCCCEEEEEEEECCCCCHHH
Q ss_conf             79998013898778899999982980544443113058677987195052327999974378843899996178730027
Q gi|254780321|r   13 NFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVRLNYTSTDAKDYQLNLIDTPGHVDFT   92 (606)
Q Consensus        13 N~~IiaHvDhGKTTL~d~lL~~tg~i~~~~~~~~vlD~~~~EreRGITIka~~~~~~~~~~~~~~y~iNlIDTPGH~DF~   92 (606)
                      .+.++|..+-|||+|.-|++  .|.+.+.. ..              ||.. ..+... ..+++.+.++|.||.|+..|.
T Consensus         5 KivlvGd~~VGKTsli~r~~--~~~F~~~y-~p--------------ti~~-~~~~~~-~i~~~~v~l~iwDtaG~e~~~   65 (191)
T cd01875           5 KCVVVGDGAVGKTCLLICYT--TNAFPKEY-IP--------------TVFD-NYSAQT-AVDGRTVSLNLWDTAGQEEYD   65 (191)
T ss_pred             EEEEECCCCCCHHHHHHHHH--HCCCCCCC-CC--------------CCCE-EEEEEE-EECCEEEEEEEEECCCCCCHH
T ss_conf             99999999989999999997--29999864-66--------------2100-046789-999999999998588870035


Q ss_pred             HHHHHHHHHCCEEEEEEECCCCCCHHHHH-HHHHHHH---CCCCEEEEECCCCCCCCCCCCHHHHHHH----------HH
Q ss_conf             99999997302689999868788655899-9999997---0996799832678875321133888775----------55
Q gi|254780321|r   93 YEVSRSLSACEGSLLVVDATQGVEAQTLA-NVYQAID---NNHEIITVLNKADLPSADPDRVKKQIEE----------TI  158 (606)
Q Consensus        93 ~EV~r~l~a~dgaiLvVdA~~Gvq~QT~~-~~~~A~~---~~l~~I~viNKiD~~~A~~e~v~~ei~~----------~~  158 (606)
                      .-.....+.+|++|||.|-+.=---+... .|+.-+.   .++|+|+|-||+|+.+.+ + ...++.+          ..
T Consensus        66 ~~~~~~~~~a~~~ilvfdvt~~~Sf~~v~~~w~~ei~~~~~~~piiLvGnK~DL~~~~-~-~~~~~~e~~~~~vs~eeg~  143 (191)
T cd01875          66 RLRTLSYPQTNVFIICFSIASPSSYENVRHKWHPEVCHHCPNVPILLVGTKKDLRNDA-D-TLKKLKEQGQAPITPQQGG  143 (191)
T ss_pred             HHHHHHHCCCCEEEEEEECCCHHHHHHHHHHHHHHHHHHCCCCCEEEEEECCCCCCCH-H-HHHHHHHHHCCCCCHHHHH
T ss_conf             6778774478689999857977889999999999999709699789998880102345-7-7888776413755699999


Q ss_pred             HH----HHHHHHHHHHHCCCCCCHHHHHHHHHHHCCC
Q ss_conf             32----2321000111002232006787763210001
Q gi|254780321|r  159 GI----STEDALLVSAKTGEGIPLLLERIVQQLPSPT  191 (606)
Q Consensus       159 g~----~~~~ii~vSAktG~GV~~LLd~Iv~~iP~P~  191 (606)
                      .+    ..-..+.+||++|.||+++++.+++.+=.|.
T Consensus       144 ~~a~~~~~~~y~EtSAkt~~nV~e~F~~l~k~il~~~  180 (191)
T cd01875         144 ALAKQIHAVKYLECSALNQDGVKEVFAEAVRAVLNPT  180 (191)
T ss_pred             HHHHHHCCCEEEECCCCCCCCHHHHHHHHHHHHHCCC
T ss_conf             9999809988999068989698999999999980789


No 225
>cd04161 Arl2l1_Arl13_like Arl2l1/Arl13 subfamily.  Arl2l1 (Arl2-like protein 1) and Arl13 form a subfamily of the Arf family of small GTPases.  Arl2l1 was identified in human cells during a search for the gene(s) responsible for Bardet-Biedl syndrome (BBS).  Like Arl6, the identified BBS gene, Arl2l1 is proposed to have cilia-specific functions.  Arl13 is found on the X chromosome, but its expression has not been confirmed; it may be a pseudogene.
Probab=99.16  E-value=1.1e-09  Score=84.44  Aligned_cols=145  Identities=19%  Similarity=0.206  Sum_probs=94.9

Q ss_pred             EEEECCCCCCHHHHHHHHHHHCCCCCCCCCCCEEECCCHHHHHHCCEEEEEEEEEEEECCCCCEEEEEEEECCCCCHHHH
Q ss_conf             99980138987788999999829805444431130586779871950523279999743788438999961787300279
Q gi|254780321|r   14 FSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVRLNYTSTDAKDYQLNLIDTPGHVDFTY   93 (606)
Q Consensus        14 ~~IiaHvDhGKTTL~d~lL~~tg~i~~~~~~~~vlD~~~~EreRGITIka~~~~~~~~~~~~~~y~iNlIDTPGH~DF~~   93 (606)
                      +-|+|=-++|||||.-+|.  .+....  .              -=|+-....++.|     +++.+++.|..|+.-|-.
T Consensus         2 ililGLd~aGKTTil~~l~--~~~~~~--~--------------~PT~G~~~~~~~~-----~~~~l~~~DlgG~~~~R~   58 (167)
T cd04161           2 LLTVGLDNAGKTTLVSALQ--GEIPKK--V--------------APTVGFTPTKLRL-----DKYEVCIFDLGGGANFRG   58 (167)
T ss_pred             EEEEEECCCCHHHHHHHHC--CCCCCC--C--------------CCCCCCCEEEEEE-----CCEEEEEEECCCCHHHHH
T ss_conf             8999008998899999982--899876--5--------------0877731799998-----999999998998778889


Q ss_pred             HHHHHHHHCCEEEEEEECCCCC-CHHHHHHHHHHHH----CCCCEEEEECCCCCCCCCCCCHHHHHHHHHHHHH------
Q ss_conf             9999997302689999868788-6558999999997----0996799832678875321133888775553223------
Q gi|254780321|r   94 EVSRSLSACEGSLLVVDATQGV-EAQTLANVYQAID----NNHEIITVLNKADLPSADPDRVKKQIEETIGIST------  162 (606)
Q Consensus        94 EV~r~l~a~dgaiLvVdA~~Gv-q~QT~~~~~~A~~----~~l~~I~viNKiD~~~A~~e~v~~ei~~~~g~~~------  162 (606)
                      -=.+-..-++|.|.|||+++-- ..+.+..++..+.    .+.|++++.||.|+|+|-..   +||.+.++++.      
T Consensus        59 lW~~Y~~~~~gIIfVVDssD~~rl~eak~~L~~lL~~~~l~~~PiLIlaNKqDl~~a~~~---~ei~~~L~L~~l~~~~~  135 (167)
T cd04161          59 IWVNYYAEAHGLVFVVDSSDDDRVQEVKEILRELLQHPRVSGKPILVLANKQDKKNALLG---ADVIEYLSLEKLVNENK  135 (167)
T ss_pred             HHHHHCCCCCEEEEEEECCCHHHHHHHHHHHHHHHCCHHHCCCEEEEEEECCCCCCCCCH---HHHHHHHCCHHHCCCCC
T ss_conf             999873477657999855758899999999999965887789959999886576158999---99998819742408998


Q ss_pred             --HHHHHHHHHCCCC------CCHHHHHHH
Q ss_conf             --2100011100223------200678776
Q gi|254780321|r  163 --EDALLVSAKTGEG------IPLLLERIV  184 (606)
Q Consensus       163 --~~ii~vSAktG~G------V~~LLd~Iv  184 (606)
                        -.+.+|||++|.|      +.+=|+=++
T Consensus       136 ~~~~I~~csA~tG~G~~~~~~l~eGl~WL~  165 (167)
T cd04161         136 SLCHIEPCSAIEGLGKKIDPSIVEGLRWLL  165 (167)
T ss_pred             CEEEEEECEEECCCCCCCCCCHHHHHHHHH
T ss_conf             637999576444888787663154998986


No 226
>PRK11058 putative GTPase HflX; Provisional
Probab=99.15  E-value=3e-09  Score=81.55  Aligned_cols=156  Identities=25%  Similarity=0.331  Sum_probs=93.0

Q ss_pred             HCEEEEEECCCCCCHHHHHHHHHHHCCCCCCCCCCCEEECCCHHHHHHCCEEEEEEEEEEEECCCCCEEEEEEEECCCCC
Q ss_conf             53179998013898778899999982980544443113058677987195052327999974378843899996178730
Q gi|254780321|r   10 RIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVRLNYTSTDAKDYQLNLIDTPGHV   89 (606)
Q Consensus        10 ~IRN~~IiaHvDhGKTTL~d~lL~~tg~i~~~~~~~~vlD~~~~EreRGITIka~~~~~~~~~~~~~~y~iNlIDTPGH~   89 (606)
                      .+-.+|++|--.+|||||.-+|-. ++...    .+++--+++-          .+-.+.  -.++..  +-|.||.|..
T Consensus       196 ~~~~ValVGYTNAGKSTL~n~Lt~-~~v~~----~d~LFATLD~----------t~R~~~--l~~~~~--~lltDTVGFI  256 (426)
T PRK11058        196 DVPTVSLVGYTNAGKSTLFNRITE-ARVYA----ADQLFATLDP----------TLRRID--VADVGE--TVLADTVGFI  256 (426)
T ss_pred             CCCEEEEECCCCCCHHHHHHHHHC-CCCCC----CCCCCCCCCC----------CEEEEE--CCCCCE--EEEECCCHHH
T ss_conf             997699973577778999877752-88763----2545014786----------202678--699986--9997150666


Q ss_pred             H---------HHHHHHHHHHHCCEEEEEEECCCC-CCHHHHHHHHHHHHC---CCCEEEEECCCCCCCCCCCCHHHHHHH
Q ss_conf             0---------279999999730268999986878-865589999999970---996799832678875321133888775
Q gi|254780321|r   90 D---------FTYEVSRSLSACEGSLLVVDATQG-VEAQTLANVYQAIDN---NHEIITVLNKADLPSADPDRVKKQIEE  156 (606)
Q Consensus        90 D---------F~~EV~r~l~a~dgaiLvVdA~~G-vq~QT~~~~~~A~~~---~l~~I~viNKiD~~~A~~e~v~~ei~~  156 (606)
                      +         |..--+. ..-+|--|.|||+++- .+.|-..+...-.+.   +.|.|.|.||||+......    .+..
T Consensus       257 ~~LP~~LveAF~sTLeE-v~~ADlLLhVvD~S~p~~~~q~~~v~~vL~elg~~~~p~i~V~NKiD~~~~~~~----~~~~  331 (426)
T PRK11058        257 RHLPHDLVAAFKATLQE-TRQATLLLHVIDAADVRVQENIEAVNTVLEEIDAHEIPTLLVMNKIDMLDDFEP----RIDR  331 (426)
T ss_pred             HHCCHHHHHHHHHHHHH-HHCCCEEEEEEECCCCCHHHHHHHHHHHHHHCCCCCCCEEEEEECCCCCCCHHH----HHHH
T ss_conf             51989999999999999-963988999984999379999999999999759999977999977023896445----5666


Q ss_pred             HHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHCC
Q ss_conf             5532232100011100223200678776321000
Q gi|254780321|r  157 TIGISTEDALLVSAKTGEGIPLLLERIVQQLPSP  190 (606)
Q Consensus       157 ~~g~~~~~ii~vSAktG~GV~~LLd~Iv~~iP~P  190 (606)
                      . .....+.+++||++|.|++.|+++|.+.++.-
T Consensus       332 ~-~~~~p~~V~iSA~tg~Gi~~L~~~I~~~L~~~  364 (426)
T PRK11058        332 D-EENKPIRVWLSAQTGAGIPLLFQALTERLSGE  364 (426)
T ss_pred             H-HCCCCCEEEEECCCCCCHHHHHHHHHHHCCCC
T ss_conf             5-33998779997899989999999999870337


No 227
>cd04143 Rhes_like Rhes_like subfamily.  This subfamily includes Rhes (Ras homolog enriched in striatum) and Dexras1/AGS1 (activator of G-protein signaling 1).  These proteins are homologous, but exhibit significant differences in tissue distribution and subcellular localization.  Rhes is found primarily in the striatum of the brain, but is also expressed in other areas of the brain, such as the cerebral cortex, hippocampus, inferior colliculus, and cerebellum.  Rhes expression is controlled by thyroid hormones.  In rat PC12 cells, Rhes is farnesylated and localizes to the plasma membrane.  Rhes binds and activates PI3K, and plays a role in coupling serpentine membrane receptors with heterotrimeric G-protein signaling.  Rhes has recently been shown to be reduced under conditions of dopamine supersensitivity and may play a role in determining dopamine receptor sensitivity.  Dexras1/AGS1 is a dexamethasone-induced Ras protein that is expressed primarily in the brain, with low expression l
Probab=99.13  E-value=1.7e-09  Score=83.31  Aligned_cols=158  Identities=18%  Similarity=0.271  Sum_probs=102.4

Q ss_pred             EEEECCCCCCHHHHHHHHHHHCCCCCCCCCCCEEECCCHHHHHHCCEEEEEEEEEEEECCCCCEEEEEEEECCCCCHHHH
Q ss_conf             99980138987788999999829805444431130586779871950523279999743788438999961787300279
Q gi|254780321|r   14 FSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVRLNYTSTDAKDYQLNLIDTPGHVDFTY   93 (606)
Q Consensus        14 ~~IiaHvDhGKTTL~d~lL~~tg~i~~~~~~~~vlD~~~~EreRGITIka~~~~~~~~~~~~~~y~iNlIDTPGH~DF~~   93 (606)
                      +.++|..+-|||+|+-|++  .+.+.+.- ..++      | +    ...+.+.     .+++.++++|.||.|...|..
T Consensus         3 IvvlGdsgVGKTSLi~Rf~--~~~F~~~y-~pTi------~-d----~~~k~i~-----i~g~~v~L~IwDTaGqe~f~s   63 (247)
T cd04143           3 MVVLGASKVGKTAIVSRFL--GGRFEEQY-TPTI------E-D----FHRKLYS-----IRGEVYQLDILDTSGNHPFPA   63 (247)
T ss_pred             EEEECCCCCCHHHHHHHHH--CCCCCCCC-CCCH------H-H----EEEEEEE-----ECCEEEEEEEEECCCCCCCCC
T ss_conf             9999989978999999996--49689987-8883------5-3----1889999-----999999999996766536874


Q ss_pred             HHHHHHHHCCEEEEEEECCCCCCHHHHHHHHHHH-------------HCCCCEEEEECCCCCCCCCCCCHHHHHHHHHHH
Q ss_conf             9999997302689999868788655899999999-------------709967998326788753211338887755532
Q gi|254780321|r   94 EVSRSLSACEGSLLVVDATQGVEAQTLANVYQAI-------------DNNHEIITVLNKADLPSADPDRVKKQIEETIGI  160 (606)
Q Consensus        94 EV~r~l~a~dgaiLvVdA~~Gvq~QT~~~~~~A~-------------~~~l~~I~viNKiD~~~A~~e~v~~ei~~~~g~  160 (606)
                      -.....+-+|++|||-|-+.---=+.+..|+.-+             ..++|+|+|=||.|+...+ +-..+|..+++.-
T Consensus        64 l~~~y~~~a~~~IlVYDITnr~SFe~v~~w~~~I~e~k~~~~~~~~~~~~vpiiLVGNK~DL~~~R-~Vs~eEa~~~~A~  142 (247)
T cd04143          64 MRRLSILTGDVFILVFSLDNRESFEEVCRLREQILETKSCLKNKTKENVKIPMVICGNKADRDFPR-EVQRDEVEQLVGG  142 (247)
T ss_pred             CHHHHHHCCCEEEEEEECCCHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCEEEEEECCCCHHCC-CCCHHHHHHHHHH
T ss_conf             420131217789999979987899989999999998640010013578887589986655432017-8799999999997


Q ss_pred             -HHHHHHHHHHHCCCCCCHHHHHHHHHHHCCC
Q ss_conf             -2321000111002232006787763210001
Q gi|254780321|r  161 -STEDALLVSAKTGEGIPLLLERIVQQLPSPT  191 (606)
Q Consensus       161 -~~~~ii~vSAktG~GV~~LLd~Iv~~iP~P~  191 (606)
                       ..-..+-+|||+|.||++++.++....--|.
T Consensus       143 ~~~~~f~EtSAKt~~NV~E~F~~L~~~~~l~~  174 (247)
T cd04143         143 DENCAYFEVSAKKNSNLDEMFRALFSLAKLPN  174 (247)
T ss_pred             HCCCEEEECCCCCCCCHHHHHHHHHHHCCCCC
T ss_conf             68987998878999498999999998549986


No 228
>COG0486 ThdF Predicted GTPase [General function prediction only]
Probab=99.12  E-value=9.3e-10  Score=84.98  Aligned_cols=152  Identities=28%  Similarity=0.363  Sum_probs=101.1

Q ss_pred             EEEEECCCCCCHHHHHHHHHHHCCCCCCCCCCCEEECCCHHHHHHCCEEEEEEEEEEEECCCCCEEEEEEEECCCCC---
Q ss_conf             79998013898778899999982980544443113058677987195052327999974378843899996178730---
Q gi|254780321|r   13 NFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVRLNYTSTDAKDYQLNLIDTPGHV---   89 (606)
Q Consensus        13 N~~IiaHvDhGKTTL~d~lL~~tg~i~~~~~~~~vlD~~~~EreRGITIka~~~~~~~~~~~~~~y~iNlIDTPGH~---   89 (606)
                      +++|+|-...|||||.-+|+..-.+|-..-.              |-|=  -.+.-.+   +-+.|.++|+||-|--   
T Consensus       219 kvvIiG~PNvGKSSLLNaL~~~d~AIVTdI~--------------GTTR--Dviee~i---~i~G~pv~l~DTAGiRet~  279 (454)
T COG0486         219 KVVIIGRPNVGKSSLLNALLGRDRAIVTDIA--------------GTTR--DVIEEDI---NLNGIPVRLVDTAGIRETD  279 (454)
T ss_pred             EEEEECCCCCCHHHHHHHHHCCCCEEECCCC--------------CCCC--CEEEEEE---EECCEEEEEEECCCCCCCC
T ss_conf             4999879988679999988667866742899--------------9741--0378999---9898899998567766673


Q ss_pred             HHH--HHHHHHHH---HCCEEEEEEECCCCCCHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCCHHHHHHHHHHHHHHH
Q ss_conf             027--99999997---3026899998687886558999999997099679983267887532113388877555322321
Q gi|254780321|r   90 DFT--YEVSRSLS---ACEGSLLVVDATQGVEAQTLANVYQAIDNNHEIITVLNKADLPSADPDRVKKQIEETIGISTED  164 (606)
Q Consensus        90 DF~--~EV~r~l~---a~dgaiLvVdA~~Gvq~QT~~~~~~A~~~~l~~I~viNKiD~~~A~~e~v~~ei~~~~g~~~~~  164 (606)
                      |+.  --|+||..   -+|.+|+|+||+++...+-...+. ....+.++++|+||.|+.........    ..  .+...
T Consensus       280 d~VE~iGIeRs~~~i~~ADlvL~v~D~~~~~~~~d~~~~~-~~~~~~~~i~v~NK~DL~~~~~~~~~----~~--~~~~~  352 (454)
T COG0486         280 DVVERIGIERAKKAIEEADLVLFVLDASQPLDKEDLALIE-LLPKKKPIIVVLNKADLVSKIELESE----KL--ANGDA  352 (454)
T ss_pred             CHHHHHHHHHHHHHHHHCCEEEEEEECCCCCCHHHHHHHH-HCCCCCCEEEEEECHHCCCCCCCCHH----HC--CCCCC
T ss_conf             4899999999999998599899997088777601177887-24368977999960211564321012----02--67882


Q ss_pred             HHHHHHHCCCCCCHHHHHHHHHHHCC
Q ss_conf             00011100223200678776321000
Q gi|254780321|r  165 ALLVSAKTGEGIPLLLERIVQQLPSP  190 (606)
Q Consensus       165 ii~vSAktG~GV~~LLd~Iv~~iP~P  190 (606)
                      ++.+||++|.|++.|.++|-..+..-
T Consensus       353 ~i~iSa~t~~Gl~~L~~~i~~~~~~~  378 (454)
T COG0486         353 IISISAKTGEGLDALREAIKQLFGKG  378 (454)
T ss_pred             EEEEEECCCCCHHHHHHHHHHHHHHC
T ss_conf             69998257657999999999998630


No 229
>cd04129 Rho2 Rho2 subfamily.  Rho2 is a fungal GTPase that plays a role in cell morphogenesis, control of cell wall integrity, control of growth polarity, and maintenance of growth direction.  Rho2 activates the protein kinase C homolog Pck2, and Pck2 controls Mok1, the major (1-3) alpha-D-glucan synthase.  Together with Rho1 (RhoA), Rho2 regulates the construction of the cell wall.  Unlike Rho1, Rho2 is not an essential protein, but its overexpression is lethal.  Most Rho proteins contain a lipid modification site at the C-terminus, with a typical sequence motif CaaX, where a = an aliphatic amino acid and X = any amino acid.  Lipid binding is essential for proper intracellular localization via membrane attachment.  As with other Rho family GTPases, the GDP/GTP cycling is regulated by GEFs (guanine nucleotide exchange factors), GAPs (GTPase-activating proteins) and GDIs (guanine nucleotide dissociation inhibitors).
Probab=99.10  E-value=2.3e-09  Score=82.33  Aligned_cols=154  Identities=25%  Similarity=0.266  Sum_probs=97.6

Q ss_pred             EEEEEECCCCCCHHHHHHHHHHHCCCCCCCCCCCEEECCCHHHHHHCCEEEEE-EEEEEEECCCCCEEEEEEEECCCCCH
Q ss_conf             17999801389877889999998298054444311305867798719505232-79999743788438999961787300
Q gi|254780321|r   12 RNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQ-TVRLNYTSTDAKDYQLNLIDTPGHVD   90 (606)
Q Consensus        12 RN~~IiaHvDhGKTTL~d~lL~~tg~i~~~~~~~~vlD~~~~EreRGITIka~-~~~~~~~~~~~~~y~iNlIDTPGH~D   90 (606)
                      +-+.++|-..-|||+|.-|+.  .|.+...- .              -||-.. ...+   ..+++.+.+++.||+|+.+
T Consensus         2 ~KivllGd~~VGKTsLi~r~~--~~~f~~~y-~--------------pTi~~~~~~~i---~v~~~~v~l~iwDTaG~e~   61 (187)
T cd04129           2 RKLVIVGDGACGKTSLLSVFT--LGEFPEEY-H--------------PTVFENYVTDC---RVDGKPVQLALWDTAGQEE   61 (187)
T ss_pred             EEEEEECCCCCCHHHHHHHHH--HCCCCCCC-C--------------CCEEEEEEEEE---EECCEEEEEEEEECCCCCC
T ss_conf             199999989976899999998--29899987-8--------------86678989999---9999999999997888703


Q ss_pred             HHHHHHHHHHHCCEEEEEEECCCCCCHHHHHH----HHH-HHH--CCCCEEEEECCCCCCCCCC-------CC-HH-H--
Q ss_conf             27999999973026899998687886558999----999-997--0996799832678875321-------13-38-8--
Q gi|254780321|r   91 FTYEVSRSLSACEGSLLVVDATQGVEAQTLAN----VYQ-AID--NNHEIITVLNKADLPSADP-------DR-VK-K--  152 (606)
Q Consensus        91 F~~EV~r~l~a~dgaiLvVdA~~Gvq~QT~~~----~~~-A~~--~~l~~I~viNKiD~~~A~~-------e~-v~-~--  152 (606)
                      |..-.....+-++++||+-|-+.   .+|..+    |.. +..  .+.|+|+|-||+|+.....       ++ |. +  
T Consensus        62 ~~~~~~~~~~~a~~~ilvydi~~---~~Sf~~~~~~w~~~~~~~~~~~piilVGnK~DL~~~~~~~~~~~~~r~V~~~~g  138 (187)
T cd04129          62 YERLRPLSYSKAHVILIGFAVDT---PDSLENVRTKWIEEVRRYCPNVPVILVGLKKDLRQDAVAKEEYRTQRFVPIQQG  138 (187)
T ss_pred             CCCCCCCEECCCCEEEEECCCCC---HHHHHHHHHHHHHHHHHHCCCCCEEEEEECCCCCCCCCCCCCHHHCCCCCHHHH
T ss_conf             45460412338858999702698---667999999999999985879988999886001134112111223155789999


Q ss_pred             -HHHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHCC
Q ss_conf             -87755532232100011100223200678776321000
Q gi|254780321|r  153 -QIEETIGISTEDALLVSAKTGEGIPLLLERIVQQLPSP  190 (606)
Q Consensus       153 -ei~~~~g~~~~~ii~vSAktG~GV~~LLd~Iv~~iP~P  190 (606)
                       ++.+.++  ....+-+||++|.||+++++.++..+=..
T Consensus       139 ~~~a~~~~--~~~y~EtSAk~~~nV~e~F~~~~r~~l~~  175 (187)
T cd04129         139 KRVAKEIG--AKKYMECSALTGEGVDDVFEAATRAALLV  175 (187)
T ss_pred             HHHHHHCC--CCEEEEECCCCCCCHHHHHHHHHHHHHHH
T ss_conf             99999849--97899968899979899999999999752


No 230
>PRK12299 obgE GTPase ObgE; Reviewed
Probab=99.06  E-value=1.2e-08  Score=77.55  Aligned_cols=161  Identities=24%  Similarity=0.284  Sum_probs=95.6

Q ss_pred             HHHCEEEEEECCCCCCHHHHHHHHHHHCCCCCCCCCCCEEECCCHHHHHHCCEEEEEEEEEEEECCCCCEEEEEEEECCC
Q ss_conf             52531799980138987788999999829805444431130586779871950523279999743788438999961787
Q gi|254780321|r    8 LSRIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVRLNYTSTDAKDYQLNLIDTPG   87 (606)
Q Consensus         8 ~~~IRN~~IiaHvDhGKTTL~d~lL~~tg~i~~~~~~~~vlD~~~~EreRGITIka~~~~~~~~~~~~~~y~iNlIDTPG   87 (606)
                      ++-|-.+++||--.+|||||.-++   |++-.+-  .    ||-      -.|+.-+.=.+.|  .+++  .+-+.|+||
T Consensus       155 LkliADVgLVG~PNaGKSTLl~~i---s~A~pkI--a----~Yp------FTTl~P~lGvv~~--~d~~--~~~iaDiPG  215 (334)
T PRK12299        155 LKLLADVGLVGLPNAGKSTLISSV---SAAKPKI--A----DYP------FTTLHPNLGVVRV--DDYK--SFVIADIPG  215 (334)
T ss_pred             EEEECCCEEEECCCCCHHHHHHHH---HCCCCCC--C----CCC------CEECCCEEEEEEE--CCCC--EEEEEECCC
T ss_conf             984403014636987466999987---6476433--5----787------3003875479994--6886--789986674


Q ss_pred             CC-----H--HHHHHHHHHHHCCEEEEEEECCCCCCHHHHHHHHHHH------HCCCCEEEEECCCCCCCCCCCCHHHHH
Q ss_conf             30-----0--2799999997302689999868788655899999999------709967998326788753211338887
Q gi|254780321|r   88 HV-----D--FTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQAI------DNNHEIITVLNKADLPSADPDRVKKQI  154 (606)
Q Consensus        88 H~-----D--F~~EV~r~l~a~dgaiLvVdA~~Gvq~QT~~~~~~A~------~~~l~~I~viNKiD~~~A~~e~v~~ei  154 (606)
                      -.     .  -+.+.-|-+.=|...+.|||++..=-.+....+..-+      ...-|.++|+||||++.+  +...+.+
T Consensus       216 lIegA~~g~GLG~~FLrHieR~~~L~~viD~s~~d~~~~~~~l~~EL~~y~~~L~~Kp~ivvlNK~Dl~~~--~~~~~~~  293 (334)
T PRK12299        216 LIEGASEGAGLGHRFLKHIERTRLLLHLVDASSEDPVEDYKTIRNELEKYSPELADKPRILVLNKIDLLDE--EERKEKI  293 (334)
T ss_pred             CCCCCCCCCCCHHHHHHHHHHCCEEEEEEECCCCCHHHHHHHHHHHHHHHHHHHCCCCEEEEEECCCCCCH--HHHHHHH
T ss_conf             33552347774789987665343699999799889899999999999985065536987999988106885--6789999


Q ss_pred             HHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHC
Q ss_conf             75553223210001110022320067877632100
Q gi|254780321|r  155 EETIGISTEDALLVSAKTGEGIPLLLERIVQQLPS  189 (606)
Q Consensus       155 ~~~~g~~~~~ii~vSAktG~GV~~LLd~Iv~~iP~  189 (606)
                      +++...-..+++++||.+|.|+++|++.|.+.+-.
T Consensus       294 ~~~~~~~~~~v~~ISA~~g~Gl~eL~~~i~~~L~~  328 (334)
T PRK12299        294 KELIKALGGPVFLISAVTGEGLDELLRALWEFLKE  328 (334)
T ss_pred             HHHHHHCCCCEEEEECCCCCCHHHHHHHHHHHHHH
T ss_conf             99998709968999787784999999999999997


No 231
>cd04131 Rnd Rnd subfamily.  The Rnd subfamily contains Rnd1/Rho6, Rnd2/Rho7, and Rnd3/RhoE/Rho8.  These novel Rho family proteins have substantial structural differences compared to other Rho members, including N- and C-terminal extensions relative to other Rhos.  Rnd3/RhoE is farnesylated at the C-terminal prenylation site, unlike most other Rho proteins that are geranylgeranylated.  In addition, Rnd members are unable to hydrolyze GTP and are resistant to GAP activity.  They are believed to exist only in the GTP-bound conformation, and are antagonists of RhoA activity.  Most Rho proteins contain a lipid modification site at the C-terminus, with a typical sequence motif CaaX, where a = an aliphatic amino acid and X = any amino acid.  Lipid binding is essential for membrane attachment, a key feature of most Rho proteins.  Due to the presence of truncated sequences in this CD, the lipid modification site is not available for annotation.
Probab=99.06  E-value=1.4e-08  Score=77.15  Aligned_cols=154  Identities=19%  Similarity=0.199  Sum_probs=94.7

Q ss_pred             EEEEECCCCCCHHHHHHHHHHHCCCCCCCCCCCEEECCCHHHHHHCCEEEEE-EEEEEEECCCCCEEEEEEEECCCCCHH
Q ss_conf             7999801389877889999998298054444311305867798719505232-799997437884389999617873002
Q gi|254780321|r   13 NFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQ-TVRLNYTSTDAKDYQLNLIDTPGHVDF   91 (606)
Q Consensus        13 N~~IiaHvDhGKTTL~d~lL~~tg~i~~~~~~~~vlD~~~~EreRGITIka~-~~~~~~~~~~~~~y~iNlIDTPGH~DF   91 (606)
                      -+.++|...-|||+|.-|+.  .+.+.+.. .              -||-.. +..+.   .+++.+.++|.||+|..+|
T Consensus         3 KivlvGd~~VGKTsLi~r~~--~~~F~~~y-~--------------pTi~~~~~~~~~---v~~~~v~l~iwDTaGqe~~   62 (178)
T cd04131           3 KIVVVGDVQCGKTALLQVFA--KDCYPETY-V--------------PTVFENYTASFE---IDEQRIELSLWDTSGSPYY   62 (178)
T ss_pred             EEEEECCCCCCHHHHHHHHH--CCCCCCCC-C--------------CCEEEEEEEEEE---ECCEEEEEEEEECCCCHHH
T ss_conf             99999999977899999996--39999985-7--------------856888899999---9999999999968987421


Q ss_pred             HHHHHHHHHHCCEEEEEEECCCCCCHHHH-HHHHHHHH---CCCCEEEEECCCCCCCCCC--------CC--HH-HHHHH
Q ss_conf             79999999730268999986878865589-99999997---0996799832678875321--------13--38-88775
Q gi|254780321|r   92 TYEVSRSLSACEGSLLVVDATQGVEAQTL-ANVYQAID---NNHEIITVLNKADLPSADP--------DR--VK-KQIEE  156 (606)
Q Consensus        92 ~~EV~r~l~a~dgaiLvVdA~~Gvq~QT~-~~~~~A~~---~~l~~I~viNKiD~~~A~~--------e~--v~-~ei~~  156 (606)
                      ..-.....+-+|++||+-|-+.---=+.. ..|..-..   -+.++|+|=||+|+..-..        ..  |. +|-+.
T Consensus        63 ~~l~~~~y~~a~~~ilvydit~~~Sf~~v~~~W~~ei~~~~~~~~iiLVGnK~DLr~~~~~~~~~~~~~~~~Vs~eeg~~  142 (178)
T cd04131          63 DNVRPLCYPDSDAVLICFDISRPETLDSVLKKWRGEIQEFCPNTKVLLVGCKTDLRTDLSTLMELSHQRQAPVSYEQGCA  142 (178)
T ss_pred             CCHHHHHHCCCCEEEEEEECCCHHHHHHHHHHHHHHHHHHCCCCCEEEEEECCCCCCCHHHHHHHHHCCCCCCCHHHHHH
T ss_conf             10366773468789999737987889999999999999868799889999854366444556677644677768999999


Q ss_pred             HH-HHHHHHHHHHHHHCCC-CCCHHHHHHHHH
Q ss_conf             55-3223210001110022-320067877632
Q gi|254780321|r  157 TI-GISTEDALLVSAKTGE-GIPLLLERIVQQ  186 (606)
Q Consensus       157 ~~-g~~~~~ii~vSAktG~-GV~~LLd~Iv~~  186 (606)
                      +. .+.+...+-|||+||. ||+++++.+...
T Consensus       143 ~A~~~ga~~y~EtSAktg~ngV~evF~~a~~~  174 (178)
T cd04131         143 IAKQLGAEIYLECSAFTSEKSVRDIFHVATMA  174 (178)
T ss_pred             HHHHCCCCEEEECCCCCCCCCHHHHHHHHHHH
T ss_conf             99974998999978486873989999999999


No 232
>cd04105 SR_beta Signal recognition particle receptor, beta subunit (SR-beta).  SR-beta and SR-alpha form the heterodimeric signal recognition particle (SRP or SR) receptor that binds SRP to regulate protein translocation across the ER membrane.  Nascent polypeptide chains are synthesized with an N-terminal hydrophobic signal sequence that binds SRP54, a component of the SRP.  SRP directs targeting of the ribosome-nascent chain complex (RNC) to the ER membrane via interaction with the SR, which is localized to the ER membrane.  The RNC is then transferred to the protein-conducting channel, or translocon, which facilitates polypeptide translation across the ER membrane or integration into the ER membrane.  SR-beta is found only in eukaryotes; it is believed to control the release of the signal sequence from SRP54 upon binding of the ribosome to the translocon.  High expression of SR-beta has been observed in human colon cancer, suggesting it may play a role in the development of this typ
Probab=99.04  E-value=1.2e-08  Score=77.64  Aligned_cols=127  Identities=22%  Similarity=0.412  Sum_probs=77.3

Q ss_pred             EEEEECCCCCCHHHHHHHHHHHCCCCCCCCCCCEEECCCHHHHHHCCEEEEEEEEEEEECCCCCEEEEEEEECCCCCHHH
Q ss_conf             79998013898778899999982980544443113058677987195052327999974378843899996178730027
Q gi|254780321|r   13 NFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVRLNYTSTDAKDYQLNLIDTPGHVDFT   92 (606)
Q Consensus        13 N~~IiaHvDhGKTTL~d~lL~~tg~i~~~~~~~~vlD~~~~EreRGITIka~~~~~~~~~~~~~~y~iNlIDTPGH~DF~   92 (606)
                      .|-|+|--++|||||.-+|.  .|....     ++ -          ||+.+.... ......+...++++|+|||.-+.
T Consensus         2 tvLl~Gl~~aGKT~Lf~~L~--~~~~~~-----T~-t----------S~~~n~~~~-~~~~~~~~~~~~lvD~PGH~klR   62 (203)
T cd04105           2 TVLLLGPSDSGKTALFTKLT--TGKYRS-----TV-T----------SIEPNVATF-ILNSEGKGKKFRLVDVPGHPKLR   62 (203)
T ss_pred             EEEEECCCCCCHHHHHHHHH--CCCCCC-----CC-C----------CCCCCCEEE-ECCCCCCCCEEEEEECCCCHHHH
T ss_conf             59999079998999999997--499888-----77-8----------887862066-40246687279999879968899


Q ss_pred             HHHHHHHH-HCCEEEEEEECCCCCC--HHHHHHHHHHH---H---CCCCEEEEECCCCCCCCCCCCH-HHHHHHHH
Q ss_conf             99999997-3026899998687886--55899999999---7---0996799832678875321133-88877555
Q gi|254780321|r   93 YEVSRSLS-ACEGSLLVVDATQGVE--AQTLANVYQAI---D---NNHEIITVLNKADLPSADPDRV-KKQIEETI  158 (606)
Q Consensus        93 ~EV~r~l~-a~dgaiLvVdA~~Gvq--~QT~~~~~~A~---~---~~l~~I~viNKiD~~~A~~e~v-~~ei~~~~  158 (606)
                      ....+.+. .+.|.|.||||++=.+  ..+-+.+|-.+   +   .++|++++.||.|++.|.+... +.++|.-+
T Consensus        63 ~~~~~~~~~~~~gIVfvVDs~~~~~~l~~~Ae~Ly~iL~~~~~~~~~iPvLIacNKqDl~tA~~~~~Ik~~LE~Ei  138 (203)
T cd04105          63 DKLLETLKNSAKGIVFVVDSATFQKNLKDVAEFLYDILTDLEKVKNKIPVLIACNKQDLFTAKPAKKIKEQLEKEL  138 (203)
T ss_pred             HHHHHHHHHCCCEEEEEEECCCCCHHHHHHHHHHHHHHHHHHHCCCCCCEEEEEECCCCCCCCCHHHHHHHHHHHH
T ss_conf             9999998754989999996887511199999999999862664368998899986614345789999999999999


No 233
>pfam01926 MMR_HSR1 GTPase of unknown function.
Probab=99.04  E-value=3.5e-09  Score=81.11  Aligned_cols=98  Identities=28%  Similarity=0.365  Sum_probs=70.6

Q ss_pred             CHHHHHHHHHHHCCCCCCCCCCCEEECCCHHHHHHCCEEEEEEEEEEEECCCCCEEEEEEEECCCCCH--------HHHH
Q ss_conf             87788999999829805444431130586779871950523279999743788438999961787300--------2799
Q gi|254780321|r   23 GKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVRLNYTSTDAKDYQLNLIDTPGHVD--------FTYE   94 (606)
Q Consensus        23 GKTTL~d~lL~~tg~i~~~~~~~~vlD~~~~EreRGITIka~~~~~~~~~~~~~~y~iNlIDTPGH~D--------F~~E   94 (606)
                      |||||.-+|+-..  +..      +      ...-|.|...+...+.|     ++..+.|+||||...        ....
T Consensus         1 GKSsLiN~L~~~~--~~~------v------~~~~gtT~~~~~~~~~~-----~~~~i~liDTPGi~~~~~~~~~~~~~~   61 (106)
T pfam01926         1 GKSTLINALTGKK--RAI------V------SDYPGTTRDPNEGRVEL-----DGKQIILVDTPGIIEGASKGEGELGNR   61 (106)
T ss_pred             CHHHHHHHHHCCC--CEE------E------CCCCCCCCCCEEEEEEE-----CCEEEEEEECCCCCCCCCHHHHHHHHH
T ss_conf             9127999997888--555------5------28899884635589988-----998899983787322650467888999


Q ss_pred             HHHHHHHCCEEEEEEECCCCCCHHHHHHHHHHHHCCCCEEEEECC
Q ss_conf             999997302689999868788655899999999709967998326
Q gi|254780321|r   95 VSRSLSACEGSLLVVDATQGVEAQTLANVYQAIDNNHEIITVLNK  139 (606)
Q Consensus        95 V~r~l~a~dgaiLvVdA~~Gvq~QT~~~~~~A~~~~l~~I~viNK  139 (606)
                      ..+++..+|.+++|+||.+++..+....+....+.+.|+|+++||
T Consensus        62 ~~~~~~~~d~il~viD~~~~~~~~d~~~~~~l~~~~~p~iiv~NK  106 (106)
T pfam01926        62 TLEAIEEADLILHVVDASEGLTEEDLEILDLLLELGKPVILVLNK  106 (106)
T ss_pred             HHHHCCCCCEEEEEEECCCCCCHHHHHHHHHHHHCCCCEEEEEEC
T ss_conf             997234573799999999999989999999999869988999939


No 234
>pfam09439 SRPRB Signal recognition particle receptor beta subunit. The beta subunit of the signal recognition particle receptor (SRP) is a transmembrane GTPase which anchors the alpha subunit to the endoplasmic reticulum membrane.
Probab=99.02  E-value=7.8e-09  Score=78.79  Aligned_cols=123  Identities=27%  Similarity=0.407  Sum_probs=75.0

Q ss_pred             EEEEEECCCCCCHHHHHHHHHHHCCCCCCCCCCCEEECCCHHHHHHCCEEEEEEEEEEEECCCCCEEEEEEEECCCCCHH
Q ss_conf             17999801389877889999998298054444311305867798719505232799997437884389999617873002
Q gi|254780321|r   12 RNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVRLNYTSTDAKDYQLNLIDTPGHVDF   91 (606)
Q Consensus        12 RN~~IiaHvDhGKTTL~d~lL~~tg~i~~~~~~~~vlD~~~~EreRGITIka~~~~~~~~~~~~~~y~iNlIDTPGH~DF   91 (606)
                      +-|-|+|=-|+|||||.-+|.  .|....     ++ -++          . .++...+..  .+...+++||+|||.-+
T Consensus         4 ptvLllGl~~sGKT~Lf~~L~--~~~~~~-----T~-tS~----------~-~n~~~~~~~--~~~~~~~lvD~PGh~kl   62 (181)
T pfam09439         4 PAVIIAGLCDSGKTSLFTLLT--TGSVRK-----TV-TSQ----------E-PSAAYKYMN--NKGNSLTLIDFPGHVKL   62 (181)
T ss_pred             CEEEEECCCCCCHHHHHHHHH--CCCCCC-----EE-CCC----------C-CCCEEEEEC--CCCCEEEEEECCCCHHH
T ss_conf             869998689998999999997--599487-----58-886----------7-864068751--68966899988996899


Q ss_pred             HHHHHHH---HHHCCEEEEEEECCCC--CCHHHHHHHHHHH------HCCCCEEEEECCCCCCCCCCCCHHH-HHH
Q ss_conf             7999999---9730268999986878--8655899999999------7099679983267887532113388-877
Q gi|254780321|r   92 TYEVSRS---LSACEGSLLVVDATQG--VEAQTLANVYQAI------DNNHEIITVLNKADLPSADPDRVKK-QIE  155 (606)
Q Consensus        92 ~~EV~r~---l~a~dgaiLvVdA~~G--vq~QT~~~~~~A~------~~~l~~I~viNKiD~~~A~~e~v~~-ei~  155 (606)
                      .......   ...+.|.|.|||++.-  -...+.+.+|-.+      ..++|++++.||.|++.|.+...+. ++|
T Consensus        63 R~~~~~~~~~~~~~~gIVfVVDS~~~~~~l~~~Ae~Ly~iL~~~~~~~~~vPvLI~cNKqDl~~A~~~~~Ik~~LE  138 (181)
T pfam09439        63 RYKLLETLKDSSSLRGLVFVVDSTAFPKEVTDTAEFLYDILSITELLKNGIDILIACNKQEIFTARPPKKIKQALE  138 (181)
T ss_pred             HHHHHHHHHHHCCCEEEEEEEECCCCHHHHHHHHHHHHHHHHCHHHCCCCCCEEEEEECCCCCCCCCHHHHHHHHH
T ss_conf             9999986430026449999997866566799999999999844543368997899973746335779999999999


No 235
>KOG1423 consensus
Probab=99.01  E-value=8.7e-09  Score=78.46  Aligned_cols=162  Identities=24%  Similarity=0.294  Sum_probs=100.9

Q ss_pred             HHHCEEEEEECCCCCCHHHHHHHHHHHCCCCCCCCCCCEEECCCHHHHHHCCEEEEEEEEEEEECCCCCEEEEEEEECCC
Q ss_conf             52531799980138987788999999829805444431130586779871950523279999743788438999961787
Q gi|254780321|r    8 LSRIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVRLNYTSTDAKDYQLNLIDTPG   87 (606)
Q Consensus         8 ~~~IRN~~IiaHvDhGKTTL~d~lL~~tg~i~~~~~~~~vlD~~~~EreRGITIka~~~~~~~~~~~~~~y~iNlIDTPG   87 (606)
                      -.++-++|+||--..|||||+..|+-. . +..      +.+.+.--|.        .+.-.+..   .++++=|.||||
T Consensus        69 ~~k~L~vavIG~PNvGKStLtN~mig~-k-v~~------vS~K~~TTr~--------~ilgi~ts---~eTQlvf~DTPG  129 (379)
T KOG1423          69 AQKSLYVAVIGAPNVGKSTLTNQMIGQ-K-VSA------VSRKVHTTRH--------RILGIITS---GETQLVFYDTPG  129 (379)
T ss_pred             CCEEEEEEEECCCCCCHHHHHHHHHCC-C-CCC------CCCCCCCEEE--------EEEEEEEC---CCEEEEEECCCC
T ss_conf             115789999708976545544576487-2-120------1156653020--------13578715---965899964876


Q ss_pred             CCH------------HHHHHHHHHHHCCEEEEEEECCCCCCHHH-HHHHHHHHH-CCCCEEEEECCCCCCCCC-------
Q ss_conf             300------------27999999973026899998687886558-999999997-099679983267887532-------
Q gi|254780321|r   88 HVD------------FTYEVSRSLSACEGSLLVVDATQGVEAQT-LANVYQAID-NNHEIITVLNKADLPSAD-------  146 (606)
Q Consensus        88 H~D------------F~~EV~r~l~a~dgaiLvVdA~~Gvq~QT-~~~~~~A~~-~~l~~I~viNKiD~~~A~-------  146 (606)
                      -+-            |.....+|+.-+|.+++|+||.. ...++ -.+++...+ ..+|-|.|+||+|.+--.       
T Consensus       130 lvs~~~~r~~~l~~s~lq~~~~a~q~AD~vvVv~Das~-tr~~l~p~vl~~l~~ys~ips~lvmnkid~~k~k~~Ll~l~  208 (379)
T KOG1423         130 LVSKKMHRRHHLMMSVLQNPRDAAQNADCVVVVVDASA-TRTPLHPRVLHMLEEYSKIPSILVMNKIDKLKQKRLLLNLK  208 (379)
T ss_pred             CCCCCHHHHHHHHHHHHHCHHHHHHHCCEEEEEEECCC-CCCCCCHHHHHHHHHHHCCCCEEECCCHHCCHHHHHHHHHH
T ss_conf             45334135678888765378988863887999985567-76756807877789986187203304000221466776667


Q ss_pred             -------CCCHHHHHHHHHHHHH--------------HHHHHHHHHCCCCCCHHHHHHHHHHHC
Q ss_conf             -------1133888775553223--------------210001110022320067877632100
Q gi|254780321|r  147 -------PDRVKKQIEETIGIST--------------EDALLVSAKTGEGIPLLLERIVQQLPS  189 (606)
Q Consensus       147 -------~e~v~~ei~~~~g~~~--------------~~ii~vSAktG~GV~~LLd~Iv~~iP~  189 (606)
                             ...-+.++.+.|-..+              ++++++||++|.||++|-+.+....|+
T Consensus       209 ~~Lt~g~l~~~kl~v~~~f~~~p~~~~~~~~~gwshfe~vF~vSaL~G~GikdlkqyLmsqa~~  272 (379)
T KOG1423         209 DLLTNGELAKLKLEVQEKFTDVPSDEKWRTICGWSHFERVFMVSALYGEGIKDLKQYLMSQAPP  272 (379)
T ss_pred             HHCCCCCCCHHHHHHHHHHCCCCCCCCCCCCCCCCCCEEEEEEECCCCCCHHHHHHHHHHCCCC
T ss_conf             7605551003456588873559743356432476453148998404666789999999723799


No 236
>TIGR00437 feoB ferrous iron transport protein B; InterPro: IPR003373 Escherichia coli has an iron(II) transport system (feo) which may make an important contribution to the iron supply of the cell under anaerobic conditions. FeoB has been identified as part of this transport system and may play a role in the transport of ferrous iron. FeoB is a large 700-800 amino acid integral membrane protein. The N terminus contains a P-loop motif suggesting that iron transport may be ATP dependent .; GO: 0005525 GTP binding, 0015093 ferrous iron transmembrane transporter activity, 0015684 ferrous iron transport, 0009276 1-2nm peptidoglycan-based cell wall, 0016021 integral to membrane.
Probab=98.99  E-value=1.3e-09  Score=83.99  Aligned_cols=136  Identities=25%  Similarity=0.411  Sum_probs=97.1

Q ss_pred             CCCCHHHHHHHHHHHCCCCCCCCCCCEEECCCHHHHHHCCEEEEEEEEEEEECCCCCEEEEEEEECCCCCHH---HH---
Q ss_conf             389877889999998298054444311305867798719505232799997437884389999617873002---79---
Q gi|254780321|r   20 IDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVRLNYTSTDAKDYQLNLIDTPGHVDF---TY---   93 (606)
Q Consensus        20 vDhGKTTL~d~lL~~tg~i~~~~~~~~vlD~~~~EreRGITIka~~~~~~~~~~~~~~y~iNlIDTPGH~DF---~~---   93 (606)
                      -.-|||||--+|   ||.  .-..+|.=          |.|+--+...+.+     +++.|.+||+||=-+|   |+   
T Consensus         3 PNVGKStlFN~L---TG~--~~~vGNwP----------G~TVek~eg~l~~-----~g~~i~ivDLPG~YSL~~~S~~dE   62 (733)
T TIGR00437         3 PNVGKSTLFNAL---TGA--NQKVGNWP----------GVTVEKKEGKLKF-----QGEDIEIVDLPGIYSLTTFSGLDE   62 (733)
T ss_pred             CCCHHHHHHHHH---HCC--CEEEEECC----------CCEEEEEEEEEEE-----CCEEEEEEECCCCCCCCCCCCCHH
T ss_conf             981589999874---158--70787358----------8707877889752-----462789984487300589987427


Q ss_pred             HHHHHHH---HCCEEEEEEECCCCCCHHHHHHHHHH---HHCCCCEEEEECCCCCCCCCCCCH---HHHHHHHHHHHHHH
Q ss_conf             9999997---30268999986878865589999999---970996799832678875321133---88877555322321
Q gi|254780321|r   94 EVSRSLS---ACEGSLLVVDATQGVEAQTLANVYQA---IDNNHEIITVLNKADLPSADPDRV---KKQIEETIGISTED  164 (606)
Q Consensus        94 EV~r~l~---a~dgaiLvVdA~~Gvq~QT~~~~~~A---~~~~l~~I~viNKiD~~~A~~e~v---~~ei~~~~g~~~~~  164 (606)
                      +|.|.--   ..|-.|-||||+.     =+.|+++.   ++.|+|.|+++|++|.  |+-+-+   .+-+++.+|+.   
T Consensus        63 ~v~~dyl~~e~~DLv~nVVDA~n-----LERnL~LTLQL~E~G~p~i~~LN~~De--A~k~GI~Id~~~Lee~LGvP---  132 (733)
T TIGR00437        63 KVARDYLLNEKPDLVVNVVDASN-----LERNLYLTLQLLELGIPMILALNLVDE--AEKKGIRIDEEKLEERLGVP---  132 (733)
T ss_pred             HHHHHHHHCCCCCEEEEEECHHH-----HHHHHHHHHHHHHHCCHHHHHHHHHHH--HHHCCCEECHHHHHHHCCCC---
T ss_conf             99989975389967999725667-----778999999999716258568726789--97729631257775433865---


Q ss_pred             HHHHHHHCCCCCCHHHHHHHH
Q ss_conf             000111002232006787763
Q gi|254780321|r  165 ALLVSAKTGEGIPLLLERIVQ  185 (606)
Q Consensus       165 ii~vSAktG~GV~~LLd~Iv~  185 (606)
                      ++++||..|.|+++|.++|.+
T Consensus       133 Vv~~~A~~g~G~~~L~~~i~~  153 (733)
T TIGR00437       133 VVPTSATEGRGIEELKDAIRE  153 (733)
T ss_pred             EEEEEEEECCCHHHHHHHHHH
T ss_conf             256532105778999999999


No 237
>cd04103 Centaurin_gamma Centaurin gamma.  The centaurins (alpha, beta, gamma, and delta) are large, multi-domain proteins that all contain an ArfGAP domain and ankyrin repeats, and in some cases, numerous additional domains.  Centaurin gamma contains an additional GTPase domain near its N-terminus.  The specific function of this GTPase domain has not been well characterized, but centaurin gamma 2 (CENTG2) may play a role in the development of autism.  Centaurin gamma 1 is also called PIKE (phosphatidyl inositol (PI) 3-kinase enhancer) and centaurin gamma 2 is also known as AGAP (ArfGAP protein with a GTPase-like domain, ankyrin repeats and a Pleckstrin homology domain) or GGAP.  Three isoforms of PIKE have been identified. PIKE-S (short) and PIKE-L (long) are brain-specific isoforms, with PIKE-S restricted to the nucleus and PIKE-L found in multiple cellular compartments.  A third isoform, PIKE-A was identified in human glioblastoma brain cancers and has been found in various tissues. 
Probab=98.98  E-value=2.4e-08  Score=75.51  Aligned_cols=149  Identities=17%  Similarity=0.265  Sum_probs=97.0

Q ss_pred             EEEECCCCCCHHHHHHHHHHHCCCCCCCCCCCEEECCCHHHHHHCCEEEEEEEEEEEECCCCCEEEEEEEECCCCCHHHH
Q ss_conf             99980138987788999999829805444431130586779871950523279999743788438999961787300279
Q gi|254780321|r   14 FSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVRLNYTSTDAKDYQLNLIDTPGHVDFTY   93 (606)
Q Consensus        14 ~~IiaHvDhGKTTL~d~lL~~tg~i~~~~~~~~vlD~~~~EreRGITIka~~~~~~~~~~~~~~y~iNlIDTPGH~DF~~   93 (606)
                      ++++|...-|||+|+-|++  +|.+....        .+..   | .. .+  .+.   .+++.+.+.|.||.|...|. 
T Consensus         3 ivllGd~~VGKTsl~~Rf~--~~~F~~~~--------~pt~---~-~~-~~--~~~---vdg~~~~l~i~DTaG~~~~~-   61 (158)
T cd04103           3 LGIVGNLQSGKSALVHRYL--TGSYVQLE--------SPEG---G-RF-KK--EVL---VDGQSHLLLIRDEGGAPDAQ-   61 (158)
T ss_pred             EEEECCCCCCHHHHHHHHH--HCCCCCCC--------CCCC---C-EE-EE--EEE---ECCEEEEEEEEECCCCCCHH-
T ss_conf             9999969987999999998--09478744--------4664---4-17-99--999---99999999999589983433-


Q ss_pred             HHHHHHHHCCEEEEEEECCCCCCHHHHHHHHHHH--H---CCCCEEEEECCCCCCCCCCCCHH-HHHHHHH-HHHHHHHH
Q ss_conf             9999997302689999868788655899999999--7---09967998326788753211338-8877555-32232100
Q gi|254780321|r   94 EVSRSLSACEGSLLVVDATQGVEAQTLANVYQAI--D---NNHEIITVLNKADLPSADPDRVK-KQIEETI-GISTEDAL  166 (606)
Q Consensus        94 EV~r~l~a~dgaiLvVdA~~Gvq~QT~~~~~~A~--~---~~l~~I~viNKiD~~~A~~e~v~-~ei~~~~-g~~~~~ii  166 (606)
                          .++.+||+|||-|-+.=--=+....|+.-+  .   ..+|+|+|=||-|+...+...|. ++.+.+. .+..-..+
T Consensus        62 ----~~~~ada~ilVydit~~~SF~~v~~~~~~i~~~~~~~~ipiilvGnK~dl~~~~~r~V~~~e~~~~a~~~~~~~f~  137 (158)
T cd04103          62 ----FASWVDAVIFVFSLENEASFQTVYNLYHQLSSYRNISEIPLILVGTQDAISESNPRVIDDARARQLCADMKRCSYY  137 (158)
T ss_pred             ----HHCCCCEEEEEEECCCHHHHHHHHHHHHHHHHHCCCCCCCEEEEEECCCCCCCCCEECCHHHHHHHHHHCCCCEEE
T ss_conf             ----3214998999998898889999999999999855978996899987700365776147999999999856998899


Q ss_pred             HHHHHCCCCCCHHHHHHHHHH
Q ss_conf             011100223200678776321
Q gi|254780321|r  167 LVSAKTGEGIPLLLERIVQQL  187 (606)
Q Consensus       167 ~vSAktG~GV~~LLd~Iv~~i  187 (606)
                      .+||++|.||+.+++.+++.+
T Consensus       138 EtSAk~~~NV~~~F~~~~~~i  158 (158)
T cd04103         138 ETCATYGLNVERVFQEAAQKI  158 (158)
T ss_pred             EEECCCCCCHHHHHHHHHHHC
T ss_conf             901799959899999999639


No 238
>PTZ00099 rab6; Provisional
Probab=98.97  E-value=7e-09  Score=79.11  Aligned_cols=116  Identities=23%  Similarity=0.263  Sum_probs=80.5

Q ss_pred             CCCCEEEEEEEECCCCCHHHHHHHHHHHHCCEEEEEEECCCCCCHHHHHHHHHH-HH---CCCCEEEEECCCCCCCCCCC
Q ss_conf             788438999961787300279999999730268999986878865589999999-97---09967998326788753211
Q gi|254780321|r   73 TDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQA-ID---NNHEIITVLNKADLPSADPD  148 (606)
Q Consensus        73 ~~~~~y~iNlIDTPGH~DF~~EV~r~l~a~dgaiLvVdA~~Gvq~QT~~~~~~A-~~---~~l~~I~viNKiD~~~A~~e  148 (606)
                      .+++.++++|.||+|+..|..-+....+-++|+|||-|-+.=--=+....|..- +.   .++++++|=||+|+..-+  
T Consensus        24 i~~~~v~l~IWDTAGqE~f~sl~~~y~r~a~~~ilVyDit~~~SF~~l~~W~~~i~~~~~~~~~iiLVGNK~DL~~~r--  101 (176)
T PTZ00099         24 LDEGPVRLQLWDTAGQERFRSLIPSYIRDSAAAIVVYDITNRQSFENTTKWIQDILNERGKDVIIALVGNKTDLGDLR--  101 (176)
T ss_pred             ECCEEEEEEEEECCCCCCHHHHHHHHHCCCCEEEEEECCCHHHHHHHHHHHHHHHHHHCCCCCCEEEEEECCCHHHHC--
T ss_conf             999999999997998634135768870798679998504207789999999999998538877439998556558616--


Q ss_pred             CH-HHHHHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHCC
Q ss_conf             33-8887755532232100011100223200678776321000
Q gi|254780321|r  149 RV-KKQIEETIGISTEDALLVSAKTGEGIPLLLERIVQQLPSP  190 (606)
Q Consensus       149 ~v-~~ei~~~~g~~~~~ii~vSAktG~GV~~LLd~Iv~~iP~P  190 (606)
                      .| .+|..++-.--.-..+.+|||+|.||+++++.|+..++.-
T Consensus       102 ~V~~ee~~~~A~~~~~~f~EtSAktg~nV~e~F~~la~~i~~~  144 (176)
T PTZ00099        102 KVTYEEGMQKAQEYNTMFHETSAKAGHNIKVLFKKIAAKLPNL  144 (176)
T ss_pred             CCCHHHHHHHHHHCCCEEEEEECCCCCCHHHHHHHHHHHHCCH
T ss_conf             8599999999998599999984899949899999999986080


No 239
>COG1100 GTPase SAR1 and related small G proteins [General function prediction only]
Probab=98.92  E-value=4.6e-08  Score=73.64  Aligned_cols=160  Identities=20%  Similarity=0.229  Sum_probs=97.7

Q ss_pred             EEEEEECCCCCCHHHHHHHHHHHCCCCCCCCCCCEEECCCHHHHHHCCEEEEEEEEEEEECCCCCEEEEEEEECCCCCHH
Q ss_conf             17999801389877889999998298054444311305867798719505232799997437884389999617873002
Q gi|254780321|r   12 RNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVRLNYTSTDAKDYQLNLIDTPGHVDF   91 (606)
Q Consensus        12 RN~~IiaHvDhGKTTL~d~lL~~tg~i~~~~~~~~vlD~~~~EreRGITIka~~~~~~~~~~~~~~y~iNlIDTPGH~DF   91 (606)
                      .-+.++|..+.|||||+-++..  +.+.+.               ...||-.....-... ......++.++||+|+.+|
T Consensus         6 ~kivv~G~~g~GKTtl~~~l~~--~~~~~~---------------~~~t~~~~~~~~~~~-~~~~~~~~~~~Dt~gq~~~   67 (219)
T COG1100           6 FKIVVLGDGGVGKTTLLNRLVG--DEFPEG---------------YPPTIGNLDPAKTIE-PYRRNIKLQLWDTAGQEEY   67 (219)
T ss_pred             EEEEEECCCCCCHHHHHHHHHC--CCCCCC---------------CCCCEEECCCCCEEE-CCCCCEEEEEEECCCHHHH
T ss_conf             7999999999988999999964--767655---------------676145404320362-2666002676767986999


Q ss_pred             HHHHHHHHHHCCEEEEEEECCCCCCH-HHHHHHHHHHHC----CCCEEEEECCCCCCCCCCCCHH-----------HHHH
Q ss_conf             79999999730268999986878865-589999999970----9967998326788753211338-----------8877
Q gi|254780321|r   92 TYEVSRSLSACEGSLLVVDATQGVEA-QTLANVYQAIDN----NHEIITVLNKADLPSADPDRVK-----------KQIE  155 (606)
Q Consensus        92 ~~EV~r~l~a~dgaiLvVdA~~Gvq~-QT~~~~~~A~~~----~l~~I~viNKiD~~~A~~e~v~-----------~ei~  155 (606)
                      ..-.......++|+++++|...-... +....|...+..    +.+++.+-||+|+.........           ....
T Consensus        68 ~~~~~~y~~~~~~~l~~~d~~~~~~~~~~~~~~~~~l~~~~~~~~~iilv~nK~Dl~~~~~~~~~~~~~~~~~~~~~~~~  147 (219)
T COG1100          68 RSLRPEYYRGANGILIVYDSTLRESSDELTEEWLEELRELAPDDVPILLVGNKIDLFDEQSSSEEILNQLNREVVLLVLA  147 (219)
T ss_pred             HHHHHHCCCCCCEEEEEEECCCHHHHHHHHHHHHHHHHHHCCCCCEEEEECCCCCCCCCHHHHHHHHHHHCCCCEEHHHH
T ss_conf             99887504389789999976205657889999999998746688679996976105543013678877532453000222


Q ss_pred             HH---H-HHHHHHHHHHHHH--CCCCCCHHHHHHHHHHHCC
Q ss_conf             55---5-3223210001110--0223200678776321000
Q gi|254780321|r  156 ET---I-GISTEDALLVSAK--TGEGIPLLLERIVQQLPSP  190 (606)
Q Consensus       156 ~~---~-g~~~~~ii~vSAk--tG~GV~~LLd~Iv~~iP~P  190 (606)
                      ..   . ..... .+.+||+  ++.+|..++..+...+...
T Consensus       148 ~~~~~~~~~~~~-~~~~s~~~~~~~~v~~~~~~~~~~~~~~  187 (219)
T COG1100         148 PKAVLPEVANPA-LLETSAKSLTGPNVNELFKELLRKLLEE  187 (219)
T ss_pred             HHHHHHHHHHHH-HHEEEEECCCCCCHHHHHHHHHHHHHHH
T ss_conf             344423320004-4324210167878789999999999886


No 240
>cd03693 EF1_alpha_II EF1_alpha_II: this family represents the domain II of elongation factor 1-alpha (EF-1a) that is found in archaea and all eukaryotic lineages. EF-1A is very abundant in the cytosol, where it is involved in the GTP-dependent binding of aminoacyl-tRNAs to the A site of the ribosomes in the second step of translation from mRNAs to proteins. Both domain II of EF1A and domain IV of IF2/eIF5B have been implicated in recognition of the 3'-ends of tRNA. More than 61% of eukaryotic elongation factor 1A (eEF-1A) in cells is estimated to be associated with actin cytoskeleton. The binding of eEF1A to actin is a noncanonical function that may link two distinct cellular processes, cytoskeleton organization and gene expression.
Probab=98.91  E-value=8.9e-10  Score=85.10  Aligned_cols=88  Identities=18%  Similarity=0.369  Sum_probs=75.4

Q ss_pred             HCCCCCCCCCEEECCCCCEEEEEEECCCCCCCCCEEEEECCCCCCCCCCCCCCCCCEEEEHHCCCCC-HHHHHHCCCCCC
Q ss_conf             0123310121011475725999981698735584588733556421012223355412401012471-233220110024
Q gi|254780321|r  197 NAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVERIGILTPKMIDIEALYPGE-IGVMIASIKEVS  275 (606)
Q Consensus       197 ~~Pl~alVfds~~D~~~G~I~~~RV~sG~lk~Gd~I~~~~~g~~~~v~~ig~~~~~~~~v~~l~aGd-VG~ii~gik~l~  275 (606)
                      |+|||+.|-+.+..+..|.|+.|+|.+|+|+.||++.+++++.+.+|..+..   +..+++++.||| ||.-+.++ +..
T Consensus         2 dkPlRmpId~vf~i~G~GtVvtG~v~~G~i~~gd~v~i~P~~~~~~VksI~~---~~~~~~~a~aGd~v~l~L~gi-~~~   77 (91)
T cd03693           2 DKPLRLPIQDVYKIGGIGTVPVGRVETGVLKPGMVVTFAPAGVTGEVKSVEM---HHEPLEEALPGDNVGFNVKNV-SKK   77 (91)
T ss_pred             CCCEEEEEEEEEECCCCEEEEEEEEEECEEECCCEEEECCCCCEEEEEEEEE---CCCCCCEECCCCEEEEEECCC-CHH
T ss_conf             9875889988997299569999998117785799977278643379999999---884958888998999998799-899


Q ss_pred             CCCCCCEECCCCC
Q ss_conf             4445420004667
Q gi|254780321|r  276 HTRVGDTITDDSS  288 (606)
Q Consensus       276 ~~~vGDTl~~~~~  288 (606)
                      +++.||.||++++
T Consensus        78 ~i~rG~Vl~~~~n   90 (91)
T cd03693          78 DIKRGDVAGDSKN   90 (91)
T ss_pred             HCCCCCEEECCCC
T ss_conf             9267689955689


No 241
>KOG0092 consensus
Probab=98.87  E-value=3.2e-08  Score=74.64  Aligned_cols=159  Identities=23%  Similarity=0.270  Sum_probs=96.2

Q ss_pred             EEEECCCCCCHHHHHHHHHHHCCCCCCCCCCCEEECCCHHHHHHCCEEEEEEEEEEEECCCCCEEEEEEEECCCCCHHHH
Q ss_conf             99980138987788999999829805444431130586779871950523279999743788438999961787300279
Q gi|254780321|r   14 FSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVRLNYTSTDAKDYQLNLIDTPGHVDFTY   93 (606)
Q Consensus        14 ~~IiaHvDhGKTTL~d~lL~~tg~i~~~~~~~~vlD~~~~EreRGITIka~~~~~~~~~~~~~~y~iNlIDTPGH~DF~~   93 (606)
                      ++++|-...|||||+.|+.  .|.+.+..           |    =||-+.-.+-.+...+ ...++-|.||-|..-|.+
T Consensus         8 vvLLG~~~VGKSSlV~Rfv--k~~F~e~~-----------e----~TIGaaF~tktv~~~~-~~ikfeIWDTAGQERy~s   69 (200)
T KOG0092           8 VVLLGDSGVGKSSLVLRFV--KDQFHENI-----------E----PTIGAAFLTKTVTVDD-NTIKFEIWDTAGQERYHS   69 (200)
T ss_pred             EEEECCCCCCCHHHHHHHH--HCCCCCCC-----------C----CCCCEEEEEEEEEECC-CEEEEEEEECCCCCCCCC
T ss_conf             9998678777024112223--27566323-----------4----5400078999998489-578999987677300335


Q ss_pred             HHHHHHHHCCEEEEEEECCCCCCHHHHHHHHHHHHCCC-C-EEE--EECCCCCCCCCCCCH-HHHHHHHHHHHHHHHHHH
Q ss_conf             99999973026899998687886558999999997099-6-799--832678875321133-888775553223210001
Q gi|254780321|r   94 EVSRSLSACEGSLLVVDATQGVEAQTLANVYQAIDNNH-E-IIT--VLNKADLPSADPDRV-KKQIEETIGISTEDALLV  168 (606)
Q Consensus        94 EV~r~l~a~dgaiLvVdA~~Gvq~QT~~~~~~A~~~~l-~-~I~--viNKiD~~~A~~e~v-~~ei~~~~g~~~~~ii~v  168 (606)
                      =..--.|-++.||+|-|.++-=-=++..+|-+-+.... | +++  |=||+|+...+  +| .+|..+.-+-..--.+-+
T Consensus        70 lapMYyRgA~AAivvYDit~~~SF~~aK~WvkeL~~~~~~~~vialvGNK~DL~~~R--~V~~~ea~~yAe~~gll~~ET  147 (200)
T KOG0092          70 LAPMYYRGANAAIVVYDITDEESFEKAKNWVKELQRQASPNIVIALVGNKADLLERR--EVEFEEAQAYAESQGLLFFET  147 (200)
T ss_pred             CCCCEECCCCEEEEEEECCCHHHHHHHHHHHHHHHHHCCCCEEEEEECCHHHHHCCC--CCCHHHHHHHHHHCCCEEEEE
T ss_conf             561010477679999855667899999999999986279875999832516541034--546888898998549879998


Q ss_pred             HHHCCCCCCHHHHHHHHHHHCCCC
Q ss_conf             110022320067877632100011
Q gi|254780321|r  169 SAKTGEGIPLLLERIVQQLPSPTS  192 (606)
Q Consensus       169 SAktG~GV~~LLd~Iv~~iP~P~~  192 (606)
                      |||||.||++|+.+|.+.+|....
T Consensus       148 SAKTg~Nv~~if~~Ia~~lp~~~~  171 (200)
T KOG0092         148 SAKTGENVNEIFQAIAEKLPCSDP  171 (200)
T ss_pred             ECCCCCCHHHHHHHHHHHCCCCCC
T ss_conf             525565899999999975667662


No 242
>COG2262 HflX GTPases [General function prediction only]
Probab=98.87  E-value=3.8e-08  Score=74.16  Aligned_cols=154  Identities=29%  Similarity=0.388  Sum_probs=93.7

Q ss_pred             HCEEEEEECCCCCCHHHHHHHHHHHCCCCCCCCCCCEEECCCHHHHHHCCEEEEEEEEEEEECCCCCEEEEEEEECCCCC
Q ss_conf             53179998013898778899999982980544443113058677987195052327999974378843899996178730
Q gi|254780321|r   10 RIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVRLNYTSTDAKDYQLNLIDTPGHV   89 (606)
Q Consensus        10 ~IRN~~IiaHvDhGKTTL~d~lL~~tg~i~~~~~~~~vlD~~~~EreRGITIka~~~~~~~~~~~~~~y~iNlIDTPGH~   89 (606)
                      .+--|+++|--.+|||||.-+|   ||...-  ..+++--+++          ..+=.+.+  .++  ..+-|-||=|..
T Consensus       191 ~~p~vaLvGYTNAGKSTL~N~L---T~~~~~--~~d~LFATLd----------pttR~~~l--~~g--~~vlLtDTVGFI  251 (411)
T COG2262         191 GIPLVALVGYTNAGKSTLFNAL---TGADVY--VADQLFATLD----------PTTRRIEL--GDG--RKVLLTDTVGFI  251 (411)
T ss_pred             CCCEEEEEEECCCCHHHHHHHH---HCCCEE--CCCCCCCCCC----------CCEEEEEE--CCC--CEEEEECCCCCC
T ss_conf             9975898732344499999887---245713--0466642105----------74048980--799--649986575671


Q ss_pred             H---------HHHHHHHHHHHCCEEEEEEECCCC-CCHHHHHHHHHHHHC---CCCEEEEECCCCCCCCCCCCHHHHHHH
Q ss_conf             0---------279999999730268999986878-865589999999970---996799832678875321133888775
Q gi|254780321|r   90 D---------FTYEVSRSLSACEGSLLVVDATQG-VEAQTLANVYQAIDN---NHEIITVLNKADLPSADPDRVKKQIEE  156 (606)
Q Consensus        90 D---------F~~EV~r~l~a~dgaiLvVdA~~G-vq~QT~~~~~~A~~~---~l~~I~viNKiD~~~A~~e~v~~ei~~  156 (606)
                      +         |..--+. ..-+|-.|.||||++- +..|-.++...-.+.   ..|+|+|.||+|+-... + ....+..
T Consensus       252 ~~LP~~LV~AFksTLEE-~~~aDlllhVVDaSdp~~~~~~~~v~~vL~el~~~~~p~i~v~NKiD~~~~~-~-~~~~~~~  328 (411)
T COG2262         252 RDLPHPLVEAFKSTLEE-VKEADLLLHVVDASDPEILEKLEAVEDVLAEIGADEIPIILVLNKIDLLEDE-E-ILAELER  328 (411)
T ss_pred             CCCCHHHHHHHHHHHHH-HHCCCEEEEEEECCCHHHHHHHHHHHHHHHHCCCCCCCEEEEEECCCCCCCH-H-HHHHHHH
T ss_conf             55986799999998987-6227779997406885189999999999997488999789997641015732-2-2345663


Q ss_pred             HHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHC
Q ss_conf             553223210001110022320067877632100
Q gi|254780321|r  157 TIGISTEDALLVSAKTGEGIPLLLERIVQQLPS  189 (606)
Q Consensus       157 ~~g~~~~~ii~vSAktG~GV~~LLd~Iv~~iP~  189 (606)
                      ..   + +.+++||++|.|++.|.+.|.+.++.
T Consensus       329 ~~---~-~~v~iSA~~~~gl~~L~~~i~~~l~~  357 (411)
T COG2262         329 GS---P-NPVFISAKTGEGLDLLRERIIELLSG  357 (411)
T ss_pred             CC---C-CEEEEEECCCCCHHHHHHHHHHHHHH
T ss_conf             48---9-74899806675989999999998631


No 243
>cd04174 Rnd1_Rho6 Rnd1/Rho6 subfamily.  Rnd1/Rho6 is a member of the novel Rho subfamily Rnd, together with Rnd2/Rho7 and Rnd3/RhoE/Rho8.  Rnd1/Rho6 binds GTP but does not hydrolyze it to GDP, indicating that it is constitutively active.  In rat, Rnd1/Rho6 is highly expressed in the cerebral cortex and hippocampus during synapse formation, and plays a role in spine formation.  Rnd1/Rho6 is also expressed in the liver and in endothelial cells, and is upregulated in uterine myometrial cells during pregnancy.  Like Rnd3/RhoE/Rho8, Rnd1/Rho6 is believed to function as an antagonist to RhoA.  Most Rho proteins contain a lipid modification site at the C-terminus, with a typical sequence motif CaaX, where a = an aliphatic amino acid and X = any amino acid.  Lipid binding is essential for membrane attachment, a key feature of most Rho proteins.  Due to the presence of truncated sequences in this CD, the lipid modification site is not available for annotation.
Probab=98.87  E-value=3.6e-07  Score=67.64  Aligned_cols=159  Identities=22%  Similarity=0.239  Sum_probs=99.3

Q ss_pred             CCCCHHHCEEEEEECCCCCCHHHHHHHHHHHCCCCCCCCCCCEEECCCHHHHHHCCEEEEE-EEEEEEECCCCCEEEEEE
Q ss_conf             8998525317999801389877889999998298054444311305867798719505232-799997437884389999
Q gi|254780321|r    4 KPTPLSRIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQ-TVRLNYTSTDAKDYQLNL   82 (606)
Q Consensus         4 ~~~p~~~IRN~~IiaHvDhGKTTL~d~lL~~tg~i~~~~~~~~vlD~~~~EreRGITIka~-~~~~~~~~~~~~~y~iNl   82 (606)
                      -|.|..----+.++|...-|||+|.-++.  .+.+.+.-               --||... +..+.   .+++.+.++|
T Consensus         6 ~~~p~~~~~KiVlVGD~~VGKTsLl~~~~--~~~F~~~y---------------~pTv~~~~~~~i~---v~~~~v~L~l   65 (232)
T cd04174           6 IPQPLVMRCKLVLVGDVQCGKTAMLQVLA--KDCYPETY---------------VPTVFENYTAGLE---TEEQRVELSL   65 (232)
T ss_pred             CCCCCCEEEEEEEECCCCCCHHHHHHHHH--HCCCCCCC---------------CCCEEEEEEEEEE---ECCEEEEEEE
T ss_conf             99998558899999989989999999997--39899985---------------8836888899999---9999999999


Q ss_pred             EECCCCCHHHHHHHHHHHHCCEEEEEEECCCCCCHHHHHH----HHHHH-H--CCCCEEEEECCCCCCCCCCCCHHHHHH
Q ss_conf             6178730027999999973026899998687886558999----99999-7--099679983267887532113388877
Q gi|254780321|r   83 IDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLAN----VYQAI-D--NNHEIITVLNKADLPSADPDRVKKQIE  155 (606)
Q Consensus        83 IDTPGH~DF~~EV~r~l~a~dgaiLvVdA~~Gvq~QT~~~----~~~A~-~--~~l~~I~viNKiD~~~A~~e~v~~ei~  155 (606)
                      .||-|+.+|..-..-..+-+|++||+-|-+   .++|..+    |..-+ +  -+.++|+|=||+|+.. |+. +..++.
T Consensus        66 WDTAGqE~y~~lr~~yY~~a~~~ll~Fdvt---~~~Sfe~~~~~Wi~Ei~~~~p~~piiLVGnK~DLr~-d~~-~l~~L~  140 (232)
T cd04174          66 WDTSGSPYYDNVRPLCYSDSDAVLLCFDIS---RPETVDSALKKWKAEIMDYCPSTRILLIGCKTDLRT-DLS-TLMELS  140 (232)
T ss_pred             EECCCCCCCCHHHHHHHCCCCEEEEEEECC---CHHHHHHHHHHHHHHHHHHCCCCCEEEEEECHHCCC-CHH-HHHHHH
T ss_conf             838997010036799740687899999689---879999899999999998689997899987602154-757-788997


Q ss_pred             H-------------HH-HHHHHHHHHHHHHCCC-CCCHHHHHHHHHH
Q ss_conf             5-------------55-3223210001110022-3200678776321
Q gi|254780321|r  156 E-------------TI-GISTEDALLVSAKTGE-GIPLLLERIVQQL  187 (606)
Q Consensus       156 ~-------------~~-g~~~~~ii~vSAktG~-GV~~LLd~Iv~~i  187 (606)
                      +             +- .+.+...+-|||+||. ||+++++.....+
T Consensus       141 ~~~~~pVt~eeg~~~Ak~iga~~Y~E~SA~tge~~v~~vF~~a~~~~  187 (232)
T cd04174         141 NQKQAPISYEQGCALAKQLGAEVYLECSAFTSEKSIHSIFRSASLLC  187 (232)
T ss_pred             HCCCCCCCHHHHHHHHHHCCCCEEEECCCCCCCCCHHHHHHHHHHHH
T ss_conf             56888757999999999749978998756866625999999999999


No 244
>COG1084 Predicted GTPase [General function prediction only]
Probab=98.86  E-value=1.1e-07  Score=71.19  Aligned_cols=153  Identities=23%  Similarity=0.362  Sum_probs=98.0

Q ss_pred             HCEEEEEECCCCCCHHHHHHHHHHHCCCCCCCCCCCEEECCCHHHHHHCCEEEEEEEEEEEECCCCCEEEEEEEECCCCC
Q ss_conf             53179998013898778899999982980544443113058677987195052327999974378843899996178730
Q gi|254780321|r   10 RIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVRLNYTSTDAKDYQLNLIDTPGHV   89 (606)
Q Consensus        10 ~IRN~~IiaHvDhGKTTL~d~lL~~tg~i~~~~~~~~vlD~~~~EreRGITIka~~~~~~~~~~~~~~y~iNlIDTPGH~   89 (606)
                      +.+.+.|.|+-.-|||||+-++   |++  +.+...    |       -.|-  +.+.+.|...+|.  ++-+|||||--
T Consensus       167 ~~pTivVaG~PNVGKSSlv~~l---T~A--kpEvA~----Y-------PFTT--K~i~vGhfe~~~~--R~QvIDTPGlL  226 (346)
T COG1084         167 DLPTIVVAGYPNVGKSSLVRKL---TTA--KPEVAP----Y-------PFTT--KGIHVGHFERGYL--RIQVIDTPGLL  226 (346)
T ss_pred             CCCEEEEECCCCCCHHHHHHHH---HCC--CCCCCC----C-------CCCC--CCEEEEEEECCCC--EEEEECCCCCC
T ss_conf             9973898569987589999887---548--976678----8-------8533--6546765504870--58984288645


Q ss_pred             HHH----HHHHH----HHHHC-CEEEEEEECCC----CCCHHHHHHHHHHH--HCCCCEEEEECCCCCCCCCCCCHHHHH
Q ss_conf             027----99999----99730-26899998687----88655899999999--709967998326788753211338887
Q gi|254780321|r   90 DFT----YEVSR----SLSAC-EGSLLVVDATQ----GVEAQTLANVYQAI--DNNHEIITVLNKADLPSADPDRVKKQI  154 (606)
Q Consensus        90 DF~----~EV~r----~l~a~-dgaiLvVdA~~----Gvq~QT~~~~~~A~--~~~l~~I~viNKiD~~~A~~e~v~~ei  154 (606)
                      |=-    .++++    ||+-. +..|.++|+++    +++.|-  +++.-.  ..+.++++|+||+|.  ++.++..+.-
T Consensus       227 DRPl~ErN~IE~qAi~AL~hl~~~IlF~~D~Se~cgy~lE~Q~--~L~~eIk~~f~~p~v~V~nK~D~--~~~e~~~~~~  302 (346)
T COG1084         227 DRPLEERNEIERQAILALRHLAGVILFLFDPSETCGYSLEEQI--SLLEEIKELFKAPIVVVINKIDI--ADEEKLEEIE  302 (346)
T ss_pred             CCCHHHHCHHHHHHHHHHHHHCCEEEEEECCCCCCCCCHHHHH--HHHHHHHHHCCCCEEEEEECCCC--CCHHHHHHHH
T ss_conf             7885773689999999999742858999768500289999999--99999998538876999741012--4666789999


Q ss_pred             HHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHH
Q ss_conf             75553223210001110022320067877632
Q gi|254780321|r  155 EETIGISTEDALLVSAKTGEGIPLLLERIVQQ  186 (606)
Q Consensus       155 ~~~~g~~~~~ii~vSAktG~GV~~LLd~Iv~~  186 (606)
                      ..+.....++.+.+|+..+.+++.+-+.+...
T Consensus       303 ~~~~~~~~~~~~~~~~~~~~~~d~~~~~v~~~  334 (346)
T COG1084         303 ASVLEEGGEEPLKISATKGCGLDKLREEVRKT  334 (346)
T ss_pred             HHHHHHCCCCCCCEEEEEHHHHHHHHHHHHHH
T ss_conf             99876326554313543000178899999887


No 245
>cd04172 Rnd3_RhoE_Rho8 Rnd3/RhoE/Rho8 subfamily.  Rnd3/RhoE/Rho8 is a member of the novel Rho subfamily Rnd, together with Rnd1/Rho6 and Rnd2/Rho7.  Rnd3/RhoE is known to bind the serine-threonine kinase ROCK I.  Unphosphorylated Rnd3/RhoE associates primarily with membranes, but ROCK I-phosphorylated Rnd3/RhoE localizes in the cytosol.  Phosphorylation of Rnd3/RhoE correlates with its activity in disrupting RhoA-induced stress fibers and inhibiting Ras-induced fibroblast transformation.  In cells that lack stress fibers, such as macrophages and monocytes, Rnd3/RhoE induces a redistribution of actin, causing morphological changes in the cell.  In addition, Rnd3/RhoE has been shown to inhibit cell cycle progression in G1 phase at a point upstream of the pRb family pocket protein checkpoint.  Rnd3/RhoE has also been shown to inhibit Ras- and Raf-induced fibroblast transformation.  In mammary epithelial tumor cells, Rnd3/RhoE regulates the assembly of the apical junction complex and tight
Probab=98.86  E-value=1.7e-07  Score=69.75  Aligned_cols=153  Identities=19%  Similarity=0.201  Sum_probs=94.5

Q ss_pred             EEEEECCCCCCHHHHHHHHHHHCCCCCCCCCCCEEECCCHHHHHHCCEEEEE-EEEEEEECCCCCEEEEEEEECCCCCHH
Q ss_conf             7999801389877889999998298054444311305867798719505232-799997437884389999617873002
Q gi|254780321|r   13 NFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQ-TVRLNYTSTDAKDYQLNLIDTPGHVDF   91 (606)
Q Consensus        13 N~~IiaHvDhGKTTL~d~lL~~tg~i~~~~~~~~vlD~~~~EreRGITIka~-~~~~~~~~~~~~~y~iNlIDTPGH~DF   91 (606)
                      -+.++|...-|||+|.-|+.  .+.+.+.- ..              ||-.. +..+.   .+++.+.++|.||+|+.+|
T Consensus         7 KivlvGd~~VGKTsLi~r~~--~~~F~~~y-~p--------------Ti~~~~~~~~~---i~~~~v~l~iwDTaGqe~f   66 (182)
T cd04172           7 KIVVVGDSQCGKTALLHVFA--KDCFPENY-VP--------------TVFENYTASFE---IDTQRIELSLWDTSGSPYY   66 (182)
T ss_pred             EEEEECCCCCCHHHHHHHHH--HCCCCCCC-CC--------------EEEEEEEEEEE---ECCEEEEEEEEECCCCHHC
T ss_conf             99999999989999999998--39999986-87--------------35322689999---9999999999968986201


Q ss_pred             HHHHHHHHHHCCEEEEEEECCCCCCHHHH-HHHHHHHH---CCCCEEEEECCCCCCCCCCCC----------HH-HHHHH
Q ss_conf             79999999730268999986878865589-99999997---099679983267887532113----------38-88775
Q gi|254780321|r   92 TYEVSRSLSACEGSLLVVDATQGVEAQTL-ANVYQAID---NNHEIITVLNKADLPSADPDR----------VK-KQIEE  156 (606)
Q Consensus        92 ~~EV~r~l~a~dgaiLvVdA~~Gvq~QT~-~~~~~A~~---~~l~~I~viNKiD~~~A~~e~----------v~-~ei~~  156 (606)
                      ..-.....+-+|++||+-|-++=--=+.. ..|..-..   -+.++|+|=||.|+.......          |. +|-++
T Consensus        67 ~~l~~~~y~~~~~~ilvydit~~~Sf~~v~~~W~~ei~~~~~~~~iiLVGnK~DLr~~~~~~~~l~~~~~~~Vs~eeg~~  146 (182)
T cd04172          67 DNVRPLSYPDSDAVLICFDISRPETLDSVLKKWKGEIQEFCPNTKMLLVGCKSDLRTDLTTLVELSNHRQTPVSYDQGAN  146 (182)
T ss_pred             CCCCHHHHCCCCEEEEEEECCCHHHHHHHHHHHHHHHHHHCCCCCEEEEEECCCCCCCHHHHHHHHHCCCCCCCHHHHHH
T ss_conf             22125551278789999648977889999999999999868799889996171012441456677645677869999999


Q ss_pred             HH-HHHHHHHHHHHHHCCC-CCCHHHHHHHH
Q ss_conf             55-3223210001110022-32006787763
Q gi|254780321|r  157 TI-GISTEDALLVSAKTGE-GIPLLLERIVQ  185 (606)
Q Consensus       157 ~~-g~~~~~ii~vSAktG~-GV~~LLd~Iv~  185 (606)
                      +- .+.+...+-+||++|. ||+++++..+.
T Consensus       147 ~A~~~g~~~y~EtSAk~~~n~V~e~F~~a~~  177 (182)
T cd04172         147 MAKQIGAATYIECSALQSENSVRDIFHVATL  177 (182)
T ss_pred             HHHHCCCCEEEECCCCCCCCCHHHHHHHHHH
T ss_conf             9997699799991707899598999999999


No 246
>cd04173 Rnd2_Rho7 Rnd2/Rho7 subfamily.  Rnd2/Rho7 is a member of the novel Rho subfamily Rnd, together with Rnd1/Rho6 and Rnd3/RhoE/Rho8.  Rnd2/Rho7 is transiently expressed in radially migrating cells in the brain while they are within the subventricular zone of the hippocampus and cerebral cortex.  These migrating cells typically develop into pyramidal neurons.  Cells that exogenously expressed Rnd2/Rho7 failed to migrate to upper layers of the brain, suggesting that Rnd2/Rho7 plays a role in the radial migration and morphological changes of developing pyramidal neurons, and that Rnd2/Rho7 degradation is necessary for proper cellular migration.  The Rnd2/Rho7 GEF Rapostlin is found primarily in the brain and together with Rnd2/Rho7 induces dendrite branching.  Unlike Rnd1/Rho6 and Rnd3/RhoE/Rho8, which are RhoA antagonists, Rnd2/Rho7 binds the GEF Pragmin and significantly stimulates RhoA activity and Rho-A mediated cell contraction.  Rnd2/Rho7 is also found to be expressed in sperma
Probab=98.86  E-value=2.3e-07  Score=68.91  Aligned_cols=147  Identities=17%  Similarity=0.252  Sum_probs=92.4

Q ss_pred             EEEECCCCCCHHHHHHHHHHHCCCCCCCCCCCEEECCCHHHHHHCCEEEEE-EEEEEEECCCCCEEEEEEEECCCCCHHH
Q ss_conf             999801389877889999998298054444311305867798719505232-7999974378843899996178730027
Q gi|254780321|r   14 FSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQ-TVRLNYTSTDAKDYQLNLIDTPGHVDFT   92 (606)
Q Consensus        14 ~~IiaHvDhGKTTL~d~lL~~tg~i~~~~~~~~vlD~~~~EreRGITIka~-~~~~~~~~~~~~~y~iNlIDTPGH~DF~   92 (606)
                      +.++|...-|||+|.-++.  .+.+...-               --||... +..+.   .+++.+.++|.||.|..+|.
T Consensus         4 iVlvGD~~VGKTsLl~~f~--~~~F~~~y---------------~pTi~~~~~~~~~---vd~~~v~L~iWDTAGqE~y~   63 (222)
T cd04173           4 IVVVGDAECGKTALLQVFA--KDAYPGSY---------------VPTVFENYTASFE---IDKRRIELNMWDTSGSSYYD   63 (222)
T ss_pred             EEEECCCCCCHHHHHHHHH--CCCCCCCC---------------CCCEEEEEEEEEE---ECCEEEEEEEECCCCCCHHH
T ss_conf             9998989989899999996--39999984---------------7845877899999---99999999997688850345


Q ss_pred             HHHHHHHHHCCEEEEEEECCCCCCHHHHHH---HHH-HHH---CCCCEEEEECCCCCCCCCCCCHHHHHHH---------
Q ss_conf             999999973026899998687886558999---999-997---0996799832678875321133888775---------
Q gi|254780321|r   93 YEVSRSLSACEGSLLVVDATQGVEAQTLAN---VYQ-AID---NNHEIITVLNKADLPSADPDRVKKQIEE---------  156 (606)
Q Consensus        93 ~EV~r~l~a~dgaiLvVdA~~Gvq~QT~~~---~~~-A~~---~~l~~I~viNKiD~~~A~~e~v~~ei~~---------  156 (606)
                      .-..-..+-+|++||+.|-+.   ++|..+   +|. -..   .+.|+|+|=||+|+-. |++. ..++.+         
T Consensus        64 ~lr~~yyr~a~~~llvfdit~---~~SF~~v~~~W~~ei~~~~p~~piiLVGnK~DLR~-d~~~-~~el~~~~~~pVt~e  138 (222)
T cd04173          64 NVRPLAYPDSDAVLICFDISR---PETLDSVLKKWQGETQEFCPNAKVVLVGCKLDMRT-DLAT-LRELSKQRLIPVTHE  138 (222)
T ss_pred             HHHHHHCCCCCEEEEEEECCC---HHHHHHHHHHHHHHHHHHCCCCCEEEEEECCCCCC-CHHH-HHHHHHCCCCCCCHH
T ss_conf             567875036989999983897---78899999999999998589997899958742456-8788-999985578887899


Q ss_pred             ----HH-HHHHHHHHHHHHHCCC-CCCHHHHHHHH
Q ss_conf             ----55-3223210001110022-32006787763
Q gi|254780321|r  157 ----TI-GISTEDALLVSAKTGE-GIPLLLERIVQ  185 (606)
Q Consensus       157 ----~~-g~~~~~ii~vSAktG~-GV~~LLd~Iv~  185 (606)
                          +- .+.+...+-||||+|. ||+++++....
T Consensus       139 eg~~lA~~~ga~~y~EcSAk~~~n~V~evF~~a~~  173 (222)
T cd04173         139 QGTVLAKQVGAVSYVECSSRSSERSVRDVFHVATV  173 (222)
T ss_pred             HHHHHHHHCCCCEEEECCCCCCCCCHHHHHHHHHH
T ss_conf             99999997699889988848687498999999999


No 247
>KOG1489 consensus
Probab=98.84  E-value=4.4e-08  Score=73.73  Aligned_cols=157  Identities=28%  Similarity=0.452  Sum_probs=93.8

Q ss_pred             CHHHCEEEEEECCCCCCHHHHHHHHHHHCCCCCCCCCCCEEECCCHHHHHHCCEEEEEEEEEEEECCCCCEEEEEEEECC
Q ss_conf             85253179998013898778899999982980544443113058677987195052327999974378843899996178
Q gi|254780321|r    7 PLSRIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVRLNYTSTDAKDYQLNLIDTP   86 (606)
Q Consensus         7 p~~~IRN~~IiaHvDhGKTTL~d~lL~~tg~i~~~~~~~~vlD~~~~EreRGITIka~~~~~~~~~~~~~~y~iNlIDTP   86 (606)
                      +++-|-++++||--.+|||||..+|   |.+-.+      |-||-      =.|++-+.-...|.  ++.  .+.+-|-|
T Consensus       192 ELKsiadvGLVG~PNAGKSTLL~al---s~AKpk------Va~Ya------FTTL~P~iG~v~yd--df~--q~tVADiP  252 (366)
T KOG1489         192 ELKSIADVGLVGFPNAGKSTLLNAL---SRAKPK------VAHYA------FTTLRPHIGTVNYD--DFS--QITVADIP  252 (366)
T ss_pred             EEEEECCCCEECCCCCCHHHHHHHH---HCCCCC------CCCCC------EEEECCCCCEEECC--CCC--EEEECCCC
T ss_conf             8621055432128988678898776---405875------45542------03444641125135--451--46850476


Q ss_pred             CCCH-------HHHHHHHHHHHCCEEEEEEECCCC---CCHHHHHHHHHHH---HCCC---CEEEEECCCCCCCCCCCCH
Q ss_conf             7300-------279999999730268999986878---8655899999999---7099---6799832678875321133
Q gi|254780321|r   87 GHVD-------FTYEVSRSLSACEGSLLVVDATQG---VEAQTLANVYQAI---DNNH---EIITVLNKADLPSADPDRV  150 (606)
Q Consensus        87 GH~D-------F~~EV~r~l~a~dgaiLvVdA~~G---vq~QT~~~~~~A~---~~~l---~~I~viNKiD~~~A~~e~v  150 (606)
                      |-.-       -+++--|-+--|++-++|||...+   ---|+..-++.-+   +.+|   +.++|.||||.|.|.-+. 
T Consensus       253 GiI~GAh~nkGlG~~FLrHiER~~~l~fVvD~s~~~~~~p~~~~~lL~~ELe~yek~L~~rp~liVaNKiD~~eae~~~-  331 (366)
T KOG1489         253 GIIEGAHMNKGLGYKFLRHIERCKGLLFVVDLSGKQLRNPWQQLQLLIEELELYEKGLADRPALIVANKIDLPEAEKNL-  331 (366)
T ss_pred             CCCCCCCCCCCCCHHHHHHHHHHCEEEEEEECCCCCCCCHHHHHHHHHHHHHHHHHHHCCCCEEEEEECCCCHHHHHHH-
T ss_conf             5344543467654899998875334899997787555887899999999999986542358538997446736678889-


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHH
Q ss_conf             88877555322321000111002232006787763
Q gi|254780321|r  151 KKQIEETIGISTEDALLVSAKTGEGIPLLLERIVQ  185 (606)
Q Consensus       151 ~~ei~~~~g~~~~~ii~vSAktG~GV~~LLd~Iv~  185 (606)
                      ..++...+  ....++++||++|+|+++|++.+-+
T Consensus       332 l~~L~~~l--q~~~V~pvsA~~~egl~~ll~~lr~  364 (366)
T KOG1489         332 LSSLAKRL--QNPHVVPVSAKSGEGLEELLNGLRE  364 (366)
T ss_pred             HHHHHHHC--CCCCEEEEEECCCCCHHHHHHHHHH
T ss_conf             99999873--7981787640046456889987763


No 248
>TIGR02528 EutP ethanolamine utilization protein, EutP; InterPro: IPR012381   Members of this family function in ethanolamine  and propanediol  degradation pathways. Both pathways require coenzyme B12 (adenosylcobalamin, AdoCbl). Bacteria that harbour these pathways can use ethanolamine as a source of carbon and nitrogen, or propanediol as a sole carbon and energy source, respectively.  The exact roles of the EutP and PduV proteins in these respective pathways are not yet determined. Members of this family contain P-loop consensus motifs in the N-terminal part, and are distantly related to various GTPases and ATPases, including ATPase components of transport systems.  Propanediol degradation is thought to be important for the natural Salmonella populations, since propanediol is produced by the fermentation of the common plant sugars rhamnose and fucose , . More than 10f the Salmonella enterica genome is devoted to the utilisation of propanediol and cobalamin biosynthesis. In vivo expression technology has indicated that propanediol utilisation (pdu) genes may be important for growth in host tissues, and competitive index studies with mice have shown that pdu mutations confer a virulence defect , . The pdu operon is contiguous and co-regulated with the cobalamin (B12) biosynthesis cob operon, indicating that propanediol catabolism may be the primary reason for de novo B12 synthesis in Salmonella , , . Please see IPR003207 from INTERPRO, IPR003208 from INTERPRO, IPR009204 from INTERPRO, IPR009191 from INTERPRO, IPR009192 from INTERPRO for more details on the propanediol utilisation pathway and the pdu operon.; GO: 0005524 ATP binding, 0006576 biogenic amine metabolic process.
Probab=98.82  E-value=6e-09  Score=79.58  Aligned_cols=134  Identities=25%  Similarity=0.370  Sum_probs=83.1

Q ss_pred             EEEECCCCCCHHHHHHHHHHHCCC-CCCCCCCCEEECCCHHHHHHCCEEEEEEEEEEEECCCCCEEEEEEEECCCCCHHH
Q ss_conf             999801389877889999998298-0544443113058677987195052327999974378843899996178730027
Q gi|254780321|r   14 FSIVAHIDHGKSTLADRFIQHCRG-LTEREMSSQVLDNMDIERERGITIKAQTVRLNYTSTDAKDYQLNLIDTPGHVDFT   92 (606)
Q Consensus        14 ~~IiaHvDhGKTTL~d~lL~~tg~-i~~~~~~~~vlD~~~~EreRGITIka~~~~~~~~~~~~~~y~iNlIDTPGH~DF~   92 (606)
                      +.+||.+++|||||+-+|   -|- +.-+                    |.|  ++.|..+       +.|||||--==.
T Consensus         3 ~~f~G~~gCGKTTL~q~L---~g~~~~YK--------------------KTQ--AvE~~~k-------~~IDTPGEY~en   50 (144)
T TIGR02528         3 IMFIGSVGCGKTTLTQAL---QGEEIKYK--------------------KTQ--AVEYKDK-------EAIDTPGEYVEN   50 (144)
T ss_pred             EEEEECCCCCHHHHHHHC---CCCCCCEE--------------------EEE--EEEECCC-------CCCCCCCCCCCC
T ss_conf             788715888744354311---68732102--------------------334--4542588-------865598500157


Q ss_pred             HHHHHHHH--HCCE--EEEEEECCCCCCHHHHHHHHHHHHCCCCEEEEECCCCCCCC--CCCCHHHHHHHHHHHHHHHHH
Q ss_conf             99999997--3026--89999868788655899999999709967998326788753--211338887755532232100
Q gi|254780321|r   93 YEVSRSLS--ACEG--SLLVVDATQGVEAQTLANVYQAIDNNHEIITVLNKADLPSA--DPDRVKKQIEETIGISTEDAL  166 (606)
Q Consensus        93 ~EV~r~l~--a~dg--aiLvVdA~~Gvq~QT~~~~~~A~~~~l~~I~viNKiD~~~A--~~e~v~~ei~~~~g~~~~~ii  166 (606)
                      -.-..||-  +||.  -+||-+|.++-+  +..--..+.-..-+.|-+|.|+|++.+  +.+++.+.+...   -.++++
T Consensus        51 r~~Y~AL~vtaaDAd~i~lV~~a~~~~~--~f~PgF~~~f~kK~~IG~vTK~DLA~~d~~i~r~~~~L~~A---G~~~iF  125 (144)
T TIGR02528        51 RRYYSALIVTAADADVIALVQSATDEES--RFSPGFASIFVKKEVIGIVTKIDLAEADKDIERAKRLLETA---GAEKIF  125 (144)
T ss_pred             CCHHHHHHHHHHCCEEEEEEECCCCCCC--CCCCCCCCCCCCCCEEEEEEECCCCCCHHHHHHHHHHHHHC---CCCCCE
T ss_conf             5237888888721023667735776422--37850002367886347884037887734799999998723---654331


Q ss_pred             HHHHHCCCCCCHHHHHHH
Q ss_conf             011100223200678776
Q gi|254780321|r  167 LVSAKTGEGIPLLLERIV  184 (606)
Q Consensus       167 ~vSAktG~GV~~LLd~Iv  184 (606)
                      .+|+....||++|++.+.
T Consensus       126 ~~~~~d~~G~~~l~~yL~  143 (144)
T TIGR02528       126 EISSVDEKGIEELVDYLN  143 (144)
T ss_pred             EECCCCCHHHHHHHHHHC
T ss_conf             650778045899999844


No 249
>PRK12298 obgE GTPase ObgE; Reviewed
Probab=98.77  E-value=3.2e-07  Score=68.01  Aligned_cols=156  Identities=22%  Similarity=0.320  Sum_probs=90.5

Q ss_pred             HHCEEEEEECCCCCCHHHHHHHHHHHCCCCCCCCCCCEEECCCHHHHHHCCEEEEEEEEEEEECCCCCEEEEEEEECCCC
Q ss_conf             25317999801389877889999998298054444311305867798719505232799997437884389999617873
Q gi|254780321|r    9 SRIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVRLNYTSTDAKDYQLNLIDTPGH   88 (606)
Q Consensus         9 ~~IRN~~IiaHvDhGKTTL~d~lL~~tg~i~~~~~~~~vlD~~~~EreRGITIka~~~~~~~~~~~~~~y~iNlIDTPGH   88 (606)
                      +-|-.++++|--.+|||||.-++   |.+-.+      +-||-=      -|+.-+-=.+.|  .+.+  .+-+-|.||-
T Consensus       157 KliADVGLvG~PNAGKSTll~~i---S~AkPK------IAdYpF------TTL~PnLGvV~~--~~~~--~fviADIPGL  217 (380)
T PRK12298        157 KLLADVGLLGLPNAGKSTFIRAV---SAAKPK------VADYPF------TTLVPNLGVVRV--DDER--SFVIADIPGL  217 (380)
T ss_pred             EEECCCCEEECCCCCCHHHHHHH---HCCCCC------CCCCCC------CCCCCEEEEEEE--CCCC--EEEEEECCCC
T ss_conf             97516514636988610899885---558975------478875------336874679994--6986--6999877755


Q ss_pred             C-----------HHHHHHHHHHHHCCEEEEEEECCC--CCCHH----HHHH---HHHHHHCCCCEEEEECCCCCCCCC-C
Q ss_conf             0-----------027999999973026899998687--88655----8999---999997099679983267887532-1
Q gi|254780321|r   89 V-----------DFTYEVSRSLSACEGSLLVVDATQ--GVEAQ----TLAN---VYQAIDNNHEIITVLNKADLPSAD-P  147 (606)
Q Consensus        89 ~-----------DF~~EV~r~l~a~dgaiLvVdA~~--Gvq~Q----T~~~---~~~A~~~~l~~I~viNKiD~~~A~-~  147 (606)
                      .           .|---++|    |..-+.|||++.  +-.|.    ++.+   .|-......|.|+|+||||++.++ .
T Consensus       218 IeGAs~G~GLG~~FLrHieR----t~~LlhviD~s~~~~~dp~~~~~~i~~EL~~Y~~~L~~kp~iiv~NK~Dl~~~~e~  293 (380)
T PRK12298        218 IEGAAEGAGLGIRFLKHLER----CRVLLHLIDIAPIDGSDPVENARIIVNELEKYSPKLAEKPRWLVFNKIDLLDEEEA  293 (380)
T ss_pred             CCCCCCCCCHHHHHHHHHHH----HCEEEEEEECCCCCCCCHHHHHHHHHHHHHHHCHHHCCCCEEEEEECCCCCCHHHH
T ss_conf             57755587728999999875----35899999688777519999999999999985976605987999988548997999


Q ss_pred             CCHHHHHHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHH
Q ss_conf             13388877555322321000111002232006787763210
Q gi|254780321|r  148 DRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERIVQQLP  188 (606)
Q Consensus       148 e~v~~ei~~~~g~~~~~ii~vSAktG~GV~~LLd~Iv~~iP  188 (606)
                      ....+++.+.++.+ ..++++||.||.|+++|+.+|.+++.
T Consensus       294 ~~~~~~~~~~~~~~-~~v~~ISA~tgeG~~~L~~~i~~~l~  333 (380)
T PRK12298        294 EERAKEIVEALGWE-GPVYLISAASGEGTKELCWDLMTFIE  333 (380)
T ss_pred             HHHHHHHHHHCCCC-CCEEEEECCCCCCHHHHHHHHHHHHH
T ss_conf             99999999970888-88799978768799999999999998


No 250
>cd03700 eEF2_snRNP_like_II EF2_snRNP_like_II: this subfamily represents domain II of elongation factor (EF) EF-2 found eukaryotes and archaea and, the C-terminal portion of the spliceosomal human 116kD U5 small nuclear ribonucleoprotein (snRNP) protein (U5-116 kD) and, its yeast counterpart Snu114p. During the process of peptide synthesis and tRNA site changes, the ribosome is moved along the mRNA a distance equal to one codon with the addition of each amino acid. This translocation step is catalyzed by EF-2_GTP, which is hydrolyzed to provide the required energy. Thus, this action releases the uncharged tRNA from the P site and transfers the newly formed peptidyl-tRNA from the A site to the P site. Yeast Snu114p is essential for cell viability and for splicing in vivo. U5-116 kD binds GTP.  Experiments suggest that GTP binding and probably GTP hydrolysis is important for the function of the U5-116 kD/Snu114p.
Probab=98.76  E-value=9.3e-09  Score=78.26  Aligned_cols=79  Identities=22%  Similarity=0.373  Sum_probs=60.8

Q ss_pred             CCCCCEEECC-CCCEEEEEEECCCCCCCCCEEEEECCC---------CCCCCCCCCCC-CCCEEEEHHCCCCCHHHHHHC
Q ss_conf             1012101147-572599998169873558458873355---------64210122233-554124010124712332201
Q gi|254780321|r  202 ALLIDSWYNS-YLGVMVLVRIINGQLTKGQSIRLMGTN---------AKYQVERIGIL-TPKMIDIEALYPGEIGVMIAS  270 (606)
Q Consensus       202 alVfds~~D~-~~G~I~~~RV~sG~lk~Gd~I~~~~~g---------~~~~v~~ig~~-~~~~~~v~~l~aGdVG~ii~g  270 (606)
                      +++.+.+-++ .-+-++++|||||+|++||+|++++.+         .+.++.++++| +.++.+++++.||+|    ++
T Consensus         3 ~~v~k~~~~~d~~~fia~gRV~SGtl~~G~~V~vlgp~y~~~~~~~~~~~~I~~l~~~~G~~~~~v~~~~AGnI----v~   78 (93)
T cd03700           3 MYVTKMVPTPDKGGFIAFGRVFSGTIRKGQKVRVLGPNYSPEDEEDLSKKTIQRLYLMMGRYREPVDEVPAGNI----VL   78 (93)
T ss_pred             EEEEEEEECCCCCEEEEEEEEEECEEECCCEEEEECCCCCCCCCCEEEEEEEEEEEEEECCCEEECCEECCCCE----EE
T ss_conf             99997165699978999999986668089999997887888877613388986999995688999098889999----99


Q ss_pred             CCCCCCCCCCCEEC
Q ss_conf             10024444542000
Q gi|254780321|r  271 IKEVSHTRVGDTIT  284 (606)
Q Consensus       271 ik~l~~~~vGDTl~  284 (606)
                      +.+++++++|+|.+
T Consensus        79 i~Gld~~~~g~~~t   92 (93)
T cd03700          79 IVGLDQLKSGTTAT   92 (93)
T ss_pred             EECCCCCEEEEEEE
T ss_conf             97765443775983


No 251
>cd04102 RabL3 RabL3 (Rab-like3) subfamily.  RabL3s are novel proteins that have high sequence similarity with Rab family members, but display features that are distinct from Rabs, and have been termed Rab-like.  As in other Rab-like proteins, RabL3 lacks a prenylation site at the C-terminus.  The specific function of RabL3 remains unknown.
Probab=98.75  E-value=8.1e-07  Score=65.26  Aligned_cols=156  Identities=18%  Similarity=0.254  Sum_probs=95.7

Q ss_pred             EEEECCCCCCHHHHHHHHHHHCCCCCCCCCCCEEECCCHHHHHHCCEEEEEEEEEEEE--CCCCCEEEEEEEECCCCCHH
Q ss_conf             9998013898778899999982980544443113058677987195052327999974--37884389999617873002
Q gi|254780321|r   14 FSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVRLNYT--STDAKDYQLNLIDTPGHVDF   91 (606)
Q Consensus        14 ~~IiaHvDhGKTTL~d~lL~~tg~i~~~~~~~~vlD~~~~EreRGITIka~~~~~~~~--~~~~~~y~iNlIDTPGH~DF   91 (606)
                      +.++|..+-|||+|+.++.  .+.+..+. ..++          |.++..+.  ..|.  ..+.+.+.+.|.||.|...|
T Consensus         3 IlllGDsgVGKTSL~~~~~--~~~f~~~~-~~Ti----------G~~v~~k~--~~~~~~~~~~k~~~l~lWDtaGqery   67 (202)
T cd04102           3 VLVVGDSGVGKSSLVHLIC--KNQVLGRP-SWTV----------GCSVDVKH--HTYKEGTPEEKTFFVELWDVGGSESV   67 (202)
T ss_pred             EEEECCCCCCHHHHHHHHH--CCCCCCCC-CCCE----------EEEEEEEE--EEECCCCCCCCEEEEEEEECCCCHHH
T ss_conf             9999999989999999998--39888888-8850----------36789999--99337876783899999989987757


Q ss_pred             HHHHHHHHHHCCEEEEEEECCCCCCHHHHHHH--HHHH------------------------HCCCCEEEEECCCCCCCC
Q ss_conf             79999999730268999986878865589999--9999------------------------709967998326788753
Q gi|254780321|r   92 TYEVSRSLSACEGSLLVVDATQGVEAQTLANV--YQAI------------------------DNNHEIITVLNKADLPSA  145 (606)
Q Consensus        92 ~~EV~r~l~a~dgaiLvVdA~~Gvq~QT~~~~--~~A~------------------------~~~l~~I~viNKiD~~~A  145 (606)
                      ..-...-.+-++|+|||-|-+.   .+|-.++  |+..                        ...+|+++|=||.|+..-
T Consensus        68 ~sl~~~yYr~a~gvILVyDvTn---r~SF~nL~~Wl~Eil~~~~~~~~~~~~~~~~~~~~~~~~~vPilvVGtK~D~~~~  144 (202)
T cd04102          68 KSTRAVFYNQVNGIILVHDLTN---RKSSQNLQRWSLEALNKDTFPTGLLVTNGDYDSEQFGGNQIPLLVIGTKLDQIPE  144 (202)
T ss_pred             HHHHHHHHCCCCEEEEEEECCC---HHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCEEEEEECHHHCCC
T ss_conf             7678997588989999998949---8999869999999975367666545566655533346789758999760652434


Q ss_pred             CC------C----CHHHH--HHHH-HHHHHHHHHHHHHHCCCCCCHHHHHHHHHH
Q ss_conf             21------1----33888--7755-532232100011100223200678776321
Q gi|254780321|r  146 DP------D----RVKKQ--IEET-IGISTEDALLVSAKTGEGIPLLLERIVQQL  187 (606)
Q Consensus       146 ~~------e----~v~~e--i~~~-~g~~~~~ii~vSAktG~GV~~LLd~Iv~~i  187 (606)
                      +.      +    .+.+|  .+++ +++-...-+.+|++++.++...||.+|++.
T Consensus       145 r~~~~~~~~~~~~~ia~q~~~eei~~~c~~~~~~~~~~~~~~kl~~ff~~vie~~  199 (202)
T cd04102         145 KESSGNLVLTARGFVAEQGNAEEINLNCTNGRLLAAGSSDAVKLSRFFDKVIEKR  199 (202)
T ss_pred             CCCCCCHHHHHHHHHHHHCCHHHHHHHCCCCCCCCCCCCCHHHHHHHHHHHHHHH
T ss_conf             3555423555302577751667888745684400346755168999999998888


No 252
>PRK12296 obgE GTPase ObgE; Reviewed
Probab=98.74  E-value=3.1e-07  Score=68.10  Aligned_cols=159  Identities=22%  Similarity=0.302  Sum_probs=91.8

Q ss_pred             HHHCEEEEEECCCCCCHHHHHHHHHHHCCCCCCCCCCCEEECCCHHHHHHCCEEEEEEEEEEEECCCCCEEEEEEEECCC
Q ss_conf             52531799980138987788999999829805444431130586779871950523279999743788438999961787
Q gi|254780321|r    8 LSRIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVRLNYTSTDAKDYQLNLIDTPG   87 (606)
Q Consensus         8 ~~~IRN~~IiaHvDhGKTTL~d~lL~~tg~i~~~~~~~~vlD~~~~EreRGITIka~~~~~~~~~~~~~~y~iNlIDTPG   87 (606)
                      ++-|-.+++||--.+|||||.-++   |.+-.+  ..    ||-=      -|+.-   .+.....  .+..+.+.|-||
T Consensus       156 LK~iADVGLvG~PNaGKSTLl~~i---S~Akpk--IA----~YpF------TTL~P---nLGvv~~--~d~~f~iADiPG  215 (495)
T PRK12296        156 LKSVADVGLVGFPSAGKSSLISAI---SAAKPK--IA----DYPF------TTLVP---NLGVVSA--GDHTFTVADVPG  215 (495)
T ss_pred             EEEEECCCEECCCCCCHHHHHHHH---HCCCCC--CC----CCCC------CCCCC---EEEEEEC--CCCEEEEEECCC
T ss_conf             998613110118999615899887---548876--57----8775------54575---4678970--795289985664


Q ss_pred             CCH-------HHHHHHHHHHHCCEEEEEEECCC---CCCH----HHHHHHHHHH-------------HCCCCEEEEECCC
Q ss_conf             300-------27999999973026899998687---8865----5899999999-------------7099679983267
Q gi|254780321|r   88 HVD-------FTYEVSRSLSACEGSLLVVDATQ---GVEA----QTLANVYQAI-------------DNNHEIITVLNKA  140 (606)
Q Consensus        88 H~D-------F~~EV~r~l~a~dgaiLvVdA~~---Gvq~----QT~~~~~~A~-------------~~~l~~I~viNKi  140 (606)
                      -..       -+.+--|-+.=|---+.|||+..   |--|    .|+.. .++.             ...-|.|+|+|||
T Consensus       216 LIeGAs~g~GLG~~FLRHieR~~vL~hviD~~~~e~~rDP~~d~~~I~~-EL~~Y~~~l~~~~~~~~L~erpqIVvlNKi  294 (495)
T PRK12296        216 LIPGASEGRGLGLDFLRHIERCAVLVHVVDCATLEPGRDPISDIDALEA-ELAAYTPTLQGDAGLGDLAERPRLVVLNKI  294 (495)
T ss_pred             CCCCCCCCCCCHHHHHHHHHHCCEEEEEEECCCCCCCCCHHHHHHHHHH-HHHHCCHHHHCCCCCCCCCCCCEEEEEECC
T ss_conf             3465003898439999987525479999968876667896999999999-999719143044332321019659999665


Q ss_pred             CCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHC
Q ss_conf             8875321133888775553223210001110022320067877632100
Q gi|254780321|r  141 DLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERIVQQLPS  189 (606)
Q Consensus       141 D~~~A~~e~v~~ei~~~~g~~~~~ii~vSAktG~GV~~LLd~Iv~~iP~  189 (606)
                      |+|.|+  ...+.+.+.+.-....++++||.++.|+++|+.++.+.++.
T Consensus       295 Dlp~a~--e~~e~~~~~l~~~g~~Vf~ISA~t~eGl~eL~~~l~elv~~  341 (495)
T PRK12296        295 DVPDAR--ELAEFVRPELEERGWPVFEVSTVTREGLRPLSFALAELVSA  341 (495)
T ss_pred             CCCCHH--HHHHHHHHHHHHCCCCEEEEECCCCCCHHHHHHHHHHHHHH
T ss_conf             675769--99999999998749957998641003899999999999985


No 253
>PRK12297 obgE GTPase ObgE; Reviewed
Probab=98.73  E-value=4.4e-07  Score=67.04  Aligned_cols=160  Identities=22%  Similarity=0.301  Sum_probs=93.5

Q ss_pred             HHHCEEEEEECCCCCCHHHHHHHHHHHCCCCCCCCCCCEEECCCHHHHHHCCEEEEEEEEEEEECCCCCEEEEEEEECCC
Q ss_conf             52531799980138987788999999829805444431130586779871950523279999743788438999961787
Q gi|254780321|r    8 LSRIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVRLNYTSTDAKDYQLNLIDTPG   87 (606)
Q Consensus         8 ~~~IRN~~IiaHvDhGKTTL~d~lL~~tg~i~~~~~~~~vlD~~~~EreRGITIka~~~~~~~~~~~~~~y~iNlIDTPG   87 (606)
                      ++-|-.+++||--.+|||||.-++   |.+-.+  ..    ||-=      -|+.-+--.+.|  .+  ++.+-+.|-||
T Consensus       155 LkliADVGLvG~PNaGKSTll~~i---s~A~pk--Ia----~YpF------TTl~P~lGvv~~--~~--~~~~~iADiPG  215 (429)
T PRK12297        155 LKLLADVGLVGFPNVGKSTLLSVV---SNAKPK--IA----NYHF------TTLVPNLGVVET--DD--GRSFVMADLPG  215 (429)
T ss_pred             EEEECCCCEEECCCCCHHHHHHHH---HCCCCC--CC----CCCC------CCCCCEEEEEEE--CC--CCEEEEEECCC
T ss_conf             995327633647998457899887---548975--57----8774------025766668985--69--86699962674


Q ss_pred             CCH-------HHHHHHHHHHHCCEEEEEEECC--CCCCH----HHHHH---HHHHHHCCCCEEEEECCCCCCCCCCCCHH
Q ss_conf             300-------2799999997302689999868--78865----58999---99999709967998326788753211338
Q gi|254780321|r   88 HVD-------FTYEVSRSLSACEGSLLVVDAT--QGVEA----QTLAN---VYQAIDNNHEIITVLNKADLPSADPDRVK  151 (606)
Q Consensus        88 H~D-------F~~EV~r~l~a~dgaiLvVdA~--~Gvq~----QT~~~---~~~A~~~~l~~I~viNKiD~~~A~~e~v~  151 (606)
                      -..       -+.+--|-+.-|..-+.|||++  ++-.|    +++..   .|-......|.|+|+||||+|.++  ...
T Consensus       216 LIeGA~~g~GLG~~FLrHieR~~~L~hviD~s~~~~~dp~~d~~~i~~EL~~y~~~L~~kp~ivv~NK~Dl~~~~--~~~  293 (429)
T PRK12297        216 LIEGASEGVGLGHQFLRHIERTRVIVHVIDMSGSEGRDPIEDYETINKELKKYNLRLLERPQIIVANKMDLPEAE--ENL  293 (429)
T ss_pred             CCCCCCCCCCCCHHHHHHHHHCCEEEEEEECCCCCCCCHHHHHHHHHHHHHHHCHHHHCCCEEEEEECCCCCCHH--HHH
T ss_conf             567744688866888887662467999997878777798999999999999868987269669999764585769--999


Q ss_pred             HHHHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHC
Q ss_conf             88775553223210001110022320067877632100
Q gi|254780321|r  152 KQIEETIGISTEDALLVSAKTGEGIPLLLERIVQQLPS  189 (606)
Q Consensus       152 ~ei~~~~g~~~~~ii~vSAktG~GV~~LLd~Iv~~iP~  189 (606)
                      +.+.+.+. +..+++++||.||.|+++|++.+.+.+..
T Consensus       294 ~~~~~~~~-~~~~i~~iSa~t~egl~~l~~~i~~~l~~  330 (429)
T PRK12297        294 EEFKEKLA-KGKKVFPISALTKQGLDELLYAIAELLEK  330 (429)
T ss_pred             HHHHHHHH-CCCCEEEEECCCCCCHHHHHHHHHHHHHH
T ss_conf             99999753-46978999684451999999999999985


No 254
>KOG0078 consensus
Probab=98.71  E-value=1.6e-06  Score=63.25  Aligned_cols=164  Identities=26%  Similarity=0.326  Sum_probs=106.6

Q ss_pred             CCCCCCCHHHCEEEEEECCCCCCHHHHHHHHHHHCCCCCCCCCCCEEECCCHHHHHHCCEEEEEEEEEEEECCCCCEEEE
Q ss_conf             98889985253179998013898778899999982980544443113058677987195052327999974378843899
Q gi|254780321|r    1 MQKKPTPLSRIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVRLNYTSTDAKDYQL   80 (606)
Q Consensus         1 ~~~~~~p~~~IRN~~IiaHvDhGKTTL~d~lL~~tg~i~~~~~~~~vlD~~~~EreRGITIka~~~~~~~~~~~~~~y~i   80 (606)
                      |+++++  +.+=-+.+||-.+.|||.+..|+...+-  ... ...++          ||--|..++.+     +++..++
T Consensus         4 ~~~~~~--d~~~kvlliGDs~vGKt~~l~rf~d~~f--~~~-~~sTi----------GIDFk~kti~l-----~g~~i~l   63 (207)
T KOG0078           4 MAKEDY--DYLFKLLLIGDSGVGKTCLLLRFSDDSF--NTS-FISTI----------GIDFKIKTIEL-----DGKKIKL   63 (207)
T ss_pred             CCCCCC--CEEEEEEEECCCCCCHHHHHHHHHHCCC--CCC-CCCEE----------EEEEEEEEEEE-----CCEEEEE
T ss_conf             445784--5189999977898765576665440667--677-65158----------78878889983-----8908999


Q ss_pred             EEEECCCCCHHHHHHHHHHHHCCEEEEEEECCCCCCHHHHHHHHHHHHC----CCCEEEEECCCCCCCCCCCCHH----H
Q ss_conf             9961787300279999999730268999986878865589999999970----9967998326788753211338----8
Q gi|254780321|r   81 NLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQAIDN----NHEIITVLNKADLPSADPDRVK----K  152 (606)
Q Consensus        81 NlIDTPGH~DF~~EV~r~l~a~dgaiLvVdA~~Gvq~QT~~~~~~A~~~----~l~~I~viNKiD~~~A~~e~v~----~  152 (606)
                      -+.||-|..-|.--.....+-++|++||+|-+.-.--.-...|..-.+.    +.++|+|=||+|+...+  .|.    +
T Consensus        64 QiWDtaGQerf~ti~~sYyrgA~gi~LvyDitne~Sfeni~~W~~~I~e~a~~~v~~~LvGNK~D~~~~R--~V~~e~ge  141 (207)
T KOG0078          64 QIWDTAGQERFRTITTAYYRGAMGILLVYDITNEKSFENIRNWIKNIDEHASDDVVKILVGNKCDLEEKR--QVSKERGE  141 (207)
T ss_pred             EEEECCCCHHHHHHHHHHHHHCCEEEEEEECCCHHHHHHHHHHHHHHHHHCCCCCCEEEEECCCCCCCCC--CCCHHHHH
T ss_conf             9997243056788999998654824999984525777779999999986378887489851141210133--35679999


Q ss_pred             HHHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHC
Q ss_conf             8775553223210001110022320067877632100
Q gi|254780321|r  153 QIEETIGISTEDALLVSAKTGEGIPLLLERIVQQLPS  189 (606)
Q Consensus       153 ei~~~~g~~~~~ii~vSAktG~GV~~LLd~Iv~~iP~  189 (606)
                      .+..-+|+   ....+|||+|.||++.+-.+...+-.
T Consensus       142 ~lA~e~G~---~F~EtSAk~~~NI~eaF~~La~~i~~  175 (207)
T KOG0078         142 ALAREYGI---KFFETSAKTNFNIEEAFLSLARDILQ  175 (207)
T ss_pred             HHHHHHCC---EEEECCCCCCCCHHHHHHHHHHHHHH
T ss_conf             99998498---27971336799889999999999986


No 255
>TIGR00450 thdF tRNA modification GTPase TrmE; InterPro: IPR004520   The GTP-binding domain of all TrmE/ThdF orthologues is found in the C-terminal portion of the molecule. The N-terminal half can be removed without affecting the GTP-binding/hydrolysis function of the GTP-binding domain. The last four amino acids of all orthologues of ThdF/TrmE are highly conserved, being either CIGK or CLGK. This matches the Caax (where 'a' represents an aliphatic amino acid, and 'x' represents any amino acid) motif for isoprenylation that anchors small GTP-binding proteins to cell membranes in eukaryotic cells. However, protein isoprenylation has never been shown to occur in bacteria. Interestingly, biochemical experiments have shown that the Escherichia coli TrmE protein peripherally associates with the membrane fraction .    Although the biochemical properties of TrmE have been investigated for the E. coli and Thermotoga maritima proteins, nothing is known about the relationship of this protein to tRNA modification. Orthologues of TrmE are present in eukaryotes and bacteria, but are not present in archaea. In Saccharomyces cerevisiae, Mss1p is a nuclear-encoded mitochondrial protein that is the yeast orthologue of TrmE. Mss1p interacts with the 15S rRNA of the yeast mitochondria, which is equivalent to the 16S rRNA of bacteria. Subsequent analysis of the S. cerevisiae MTO1 gene suggests that MSS1 and MTO1 act together in a pathway involved in optimizing mitochondrial protein synthesis.    TrmE may play a role in tRNA processing and may be directly or indirectly involved in regulating ribosome function.; GO: 0003924 GTPase activity, 0005525 GTP binding, 0006400 tRNA modification, 0005622 intracellular.
Probab=98.70  E-value=4.4e-07  Score=67.05  Aligned_cols=111  Identities=23%  Similarity=0.411  Sum_probs=71.7

Q ss_pred             EEEEECCCCCCHHHHHHHHHHHCCCCCCC-CCCCEEECCCHHHHHHCCEEEEEEEEEEEECCCCCEEEEEEEECCC---C
Q ss_conf             79998013898778899999982980544-4431130586779871950523279999743788438999961787---3
Q gi|254780321|r   13 NFSIVAHIDHGKSTLADRFIQHCRGLTER-EMSSQVLDNMDIERERGITIKAQTVRLNYTSTDAKDYQLNLIDTPG---H   88 (606)
Q Consensus        13 N~~IiaHvDhGKTTL~d~lL~~tg~i~~~-~~~~~vlD~~~~EreRGITIka~~~~~~~~~~~~~~y~iNlIDTPG---H   88 (606)
                      -++|||.+..|||+|.-+||..-.+|-.. .+..|  |.          |-+   .+..     +.|.++++||-|   |
T Consensus       227 k~ai~G~~NvGKSSLLNa~l~~DrAiVS~~kGtTR--D~----------vE~---~~~L-----~G~~~~~lDTAGiR~~  286 (473)
T TIGR00450       227 KLAIVGKPNVGKSSLLNALLKQDRAIVSDIKGTTR--DV----------VEG---DFEL-----NGILVKLLDTAGIREH  286 (473)
T ss_pred             EEEEECCCCCCHHHHHHHHHHCCCEEEECCCCCCC--CE----------EEE---EEEE-----CCEEEEEEECCCCCCC
T ss_conf             79996478875789999876228705527668832--04----------420---5777-----4678998514675102


Q ss_pred             CHHH--HHHHHHHH---HCCEEEEEEECCCCCCHHHHHHHHHHHHCCCCEEEEECCCCCC
Q ss_conf             0027--99999997---3026899998687886558999999997099679983267887
Q gi|254780321|r   89 VDFT--YEVSRSLS---ACEGSLLVVDATQGVEAQTLANVYQAIDNNHEIITVLNKADLP  143 (606)
Q Consensus        89 ~DF~--~EV~r~l~---a~dgaiLvVdA~~Gvq~QT~~~~~~A~~~~l~~I~viNKiD~~  143 (606)
                      .|+.  --+++|..   -||-+|.|+||.++....-..-+-.....+-++++|+||+|+.
T Consensus       287 ~~~~E~~GiekS~~~i~~A~LVi~~~D~~~~~~~ddf~li~~~~k~~k~~~~V~NK~DL~  346 (473)
T TIGR00450       287 ADKVERLGIEKSFKAIKQADLVIYVLDASQPLTKDDFELIITLNKKKKPLILVLNKIDLA  346 (473)
T ss_pred             HHHHHHHHHHHHHHHHHHCCEEEEEEECCCCCCHHHHHHHHHHHHCCCCEEEEECCCCCC
T ss_conf             004667768998999860573478887478988105899999732179779997350165


No 256
>KOG0080 consensus
Probab=98.68  E-value=2.5e-07  Score=68.71  Aligned_cols=154  Identities=25%  Similarity=0.331  Sum_probs=96.3

Q ss_pred             EEEEEECCCCCCHHHHHHHHHHHCCCCCCCCCCCEEECCCHHHHHHCCEEEEEEEEEEEECCCCCEEEEEEEECCCCCHH
Q ss_conf             17999801389877889999998298054444311305867798719505232799997437884389999617873002
Q gi|254780321|r   12 RNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVRLNYTSTDAKDYQLNLIDTPGHVDF   91 (606)
Q Consensus        12 RN~~IiaHvDhGKTTL~d~lL~~tg~i~~~~~~~~vlD~~~~EreRGITIka~~~~~~~~~~~~~~y~iNlIDTPGH~DF   91 (606)
                      --+-|||..+-|||+|.=|+.  ..+++..... ++          |.-.|.     .+...+|+++++.|.||-|..-|
T Consensus        12 ~KiLlIGeSGVGKSSLllrFv--~~~fd~~~~~-tI----------GvDFkv-----k~m~vdg~~~KlaiWDTAGqErF   73 (209)
T KOG0080          12 FKILLIGESGVGKSSLLLRFV--SNTFDDLHPT-TI----------GVDFKV-----KVMQVDGKRLKLAIWDTAGQERF   73 (209)
T ss_pred             EEEEEECCCCCCHHHHHHHHH--HCCCCCCCCC-EE----------EEEEEE-----EEEEECCCEEEEEEEECCCHHHH
T ss_conf             799998168765789999987--6436766773-44----------345788-----99987582678998743452766


Q ss_pred             HHHHHHHHHHCCEEEEEEECCCCCCHHHHHHHHHHHH-----CCCCEEEEECCCCCCCCCCCCHHHHHHHHHHHHHHH--
Q ss_conf             7999999973026899998687886558999999997-----099679983267887532113388877555322321--
Q gi|254780321|r   92 TYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQAID-----NNHEIITVLNKADLPSADPDRVKKQIEETIGISTED--  164 (606)
Q Consensus        92 ~~EV~r~l~a~dgaiLvVdA~~Gvq~QT~~~~~~A~~-----~~l~~I~viNKiD~~~A~~e~v~~ei~~~~g~~~~~--  164 (606)
                      -.-...-.+-+.|+|||-|-+.------..+|..-++     .++-.++|=||||+++   +++..- +|-+.+...-  
T Consensus        74 RtLTpSyyRgaqGiIlVYDVT~Rdtf~kLd~W~~Eld~Ystn~diikmlVgNKiDkes---~R~V~r-eEG~kfAr~h~~  149 (209)
T KOG0080          74 RTLTPSYYRGAQGIILVYDVTSRDTFVKLDIWLKELDLYSTNPDIIKMLVGNKIDKES---ERVVDR-EEGLKFARKHRC  149 (209)
T ss_pred             HCCCHHHHCCCCEEEEEEECCCHHHHHHHHHHHHHHHHHCCCCCHHHHHHCCCCCCHH---CCCCCH-HHHHHHHHHHCC
T ss_conf             1168767455750699997122356775999999887644881376765425445012---021348-887899986082


Q ss_pred             -HHHHHHHCCCCCCHHHHHHHHHH
Q ss_conf             -00011100223200678776321
Q gi|254780321|r  165 -ALLVSAKTGEGIPLLLERIVQQL  187 (606)
Q Consensus       165 -ii~vSAktG~GV~~LLd~Iv~~i  187 (606)
                       .+.+|||+-.||+..++.+++.|
T Consensus       150 LFiE~SAkt~~~V~~~FeelveKI  173 (209)
T KOG0080         150 LFIECSAKTRENVQCCFEELVEKI  173 (209)
T ss_pred             EEEECCHHHHCCHHHHHHHHHHHH
T ss_conf             789825434301888999999998


No 257
>cd04089 eRF3_II eRF3_II: domain II of the eukaryotic class II release factor (eRF3). In eukaryotes, translation termination is mediated by two interacting release factors, eRF1 and eRF3, which act as class I and II factors, respectively. eRF1 functions as an omnipotent release factor, decoding all three stop codons and triggering the release of the nascent peptide catalyzed by the ribsome. eRF3 is a GTPase, which enhances the termination efficiency by stimulating the eRF1 activity in a GTP-dependent manner. Sequence comparison of class II release factors with elongation factors shows that eRF3 is more similar to eEF1alpha whereas prokaryote RF3 is more similar to EF-G, implying that their precise function may differ. Only eukaryote RF3s are found in this group. Saccharomyces cerevisiae eRF3 (Sup35p) is a translation termination factor which is divided into three regions N, M and a C-terminal eEF1a-like region essential for translation termination.  Sup35NM  is a non-pathogenic prion-li
Probab=98.65  E-value=2.2e-08  Score=75.78  Aligned_cols=81  Identities=23%  Similarity=0.427  Sum_probs=68.0

Q ss_pred             CCCCCCCCEEECCCCCEEEEEEECCCCCCCCCEEEEECCCCCCCCCCCCCCCCCEEEEHHCCCCC-HHHHHHCCCCCCCC
Q ss_conf             23310121011475725999981698735584588733556421012223355412401012471-23322011002444
Q gi|254780321|r  199 PLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVERIGILTPKMIDIEALYPGE-IGVMIASIKEVSHT  277 (606)
Q Consensus       199 Pl~alVfds~~D~~~G~I~~~RV~sG~lk~Gd~I~~~~~g~~~~v~~ig~~~~~~~~v~~l~aGd-VG~ii~gik~l~~~  277 (606)
                      |||+.|-|.+  ...|.+.+|||.+|+++.||+|.+++++...++..+..   +..+++++.||| |+.-+.|+ +..++
T Consensus         1 PlR~pi~dv~--kg~G~vV~G~vesG~v~~Gd~v~i~P~~~~~~Vk~I~~---~~~~v~~A~aGd~V~l~L~gv-d~~~i   74 (82)
T cd04089           1 PLRLPIIDKY--KDMGTVVLGKVESGTIKKGDKLLVMPNKTQVEVLSIYN---EDVEVRYARPGENVRLRLKGI-EEEDI   74 (82)
T ss_pred             CEEEEEEEEE--ECCCEEEEEEEEEEEECCCCEEEEECCCCEEEEEEEEE---CCEEECEECCCCCEEEEECCC-CHHHC
T ss_conf             9782687899--28988999999367782999999958998899999999---997958886997326888488-88844


Q ss_pred             CCCCEECC
Q ss_conf             45420004
Q gi|254780321|r  278 RVGDTITD  285 (606)
Q Consensus       278 ~vGDTl~~  285 (606)
                      +.||-||+
T Consensus        75 ~rG~vlcs   82 (82)
T cd04089          75 SPGFVLCS   82 (82)
T ss_pred             CCCCEECC
T ss_conf             78879959


No 258
>pfam08477 Miro Miro-like protein. Mitochondrial Rho proteins (Miro-1 and Miro-2), are atypical Rho GTPases. They have a unique domain organisation, with tandem GTP-binding domains and two EF hand domains (pfam00036), that may bind calcium. They are also larger than classical small GTPases. It has been proposed that they are involved in mitochondrial homeostasis and apoptosis.
Probab=98.65  E-value=1.1e-06  Score=64.46  Aligned_cols=111  Identities=19%  Similarity=0.244  Sum_probs=74.4

Q ss_pred             EEEECCCCCCHHHHHHHHHHHCCCCCCCCCCCEEECCCHHHHHHCCEEEEEEEEEEEECCCCCEEEEEEEECCCCCHHHH
Q ss_conf             99980138987788999999829805444431130586779871950523279999743788438999961787300279
Q gi|254780321|r   14 FSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVRLNYTSTDAKDYQLNLIDTPGHVDFTY   93 (606)
Q Consensus        14 ~~IiaHvDhGKTTL~d~lL~~tg~i~~~~~~~~vlD~~~~EreRGITIka~~~~~~~~~~~~~~y~iNlIDTPGH~DF~~   93 (606)
                      +.++|--+.|||||..|++  .+.+......          ...+.++     .......+++.+.+++.||+|+..|..
T Consensus         2 ivvvG~~~vGKTSLi~r~~--~~~f~~~~~~----------~~~~~~~-----~~~~~~~~~~~~~l~i~Dt~g~~~~~~   64 (118)
T pfam08477         2 VVVIGDKGSGKSSLLSQLV--GGEFPPEIPE----------EIQGDTL-----AVDTLEVDGDTELLHIWDFGGREELKF   64 (118)
T ss_pred             EEEECCCCCCHHHHHHHHH--HCCCCCCCCC----------CCCCCEE-----EEEEEEECCCEEEEEEEECCCCHHHHH
T ss_conf             9999989978999999998--3988876667----------8777768-----889999999289999998999677766


Q ss_pred             HHHHHHHHCCEEEEEEECCCCCCHHHHHHH---HHH-H--HCCCCEEEEECCCC
Q ss_conf             999999730268999986878865589999---999-9--70996799832678
Q gi|254780321|r   94 EVSRSLSACEGSLLVVDATQGVEAQTLANV---YQA-I--DNNHEIITVLNKAD  141 (606)
Q Consensus        94 EV~r~l~a~dgaiLvVdA~~Gvq~QT~~~~---~~A-~--~~~l~~I~viNKiD  141 (606)
                      ...+.++-+|++|||.|.++----+....|   ... .  ..++|+|+|=||.|
T Consensus        65 ~~~~~~~~~d~~ilvydit~~~Sf~~~~~~~~~i~~~~~~~~~~piilVGnK~D  118 (118)
T pfam08477        65 EHIIFMKTADAILLVYDLTDRESLNRVSRLIAWLPHLRKLGKKIPVILVGNKFD  118 (118)
T ss_pred             HHHHHCCCCCEEEEEEECCCHHHHHHHHHHHHHHHHHHHCCCCCCEEEEEECCC
T ss_conf             665422587467899979987899999999999999982099998899996859


No 259
>cd01873 RhoBTB RhoBTB subfamily.  Members of the RhoBTB subfamily of Rho GTPases are present in vertebrates, Drosophila, and Dictyostelium.  RhoBTB proteins are characterized by a modular organization, consisting of a GTPase domain, a proline rich region, a tandem of two BTB (Broad-Complex, Tramtrack, and Bric a brac) domains, and a C-terminal region of unknown function.  RhoBTB proteins may act as docking points for multiple components participating in signal transduction cascades.  RhoBTB genes appeared upregulated in some cancer cell lines, suggesting a participation of RhoBTB proteins in the pathogenesis of particular tumors.  Note that the Dictyostelium RacA GTPase domain is more closely related to Rac proteins than to RhoBTB proteins, where RacA actually belongs.  Thus, the Dictyostelium RacA is not included here.  Most Rho proteins contain a lipid modification site at the C-terminus; however, RhoBTB is one of few Rho subfamilies that lack this feature.
Probab=98.64  E-value=9e-07  Score=64.94  Aligned_cols=156  Identities=22%  Similarity=0.271  Sum_probs=88.2

Q ss_pred             EEEEECCCCCCHHHHHHHHHHHCC-CCCCCCCC----CEE--ECCCHHHHHHCCEEEEEEEEEEEECCCCCEEEEEEEEC
Q ss_conf             799980138987788999999829-80544443----113--05867798719505232799997437884389999617
Q gi|254780321|r   13 NFSIVAHIDHGKSTLADRFIQHCR-GLTEREMS----SQV--LDNMDIERERGITIKAQTVRLNYTSTDAKDYQLNLIDT   85 (606)
Q Consensus        13 N~~IiaHvDhGKTTL~d~lL~~tg-~i~~~~~~----~~v--lD~~~~EreRGITIka~~~~~~~~~~~~~~y~iNlIDT   85 (606)
                      -+.++|-.+-|||+|.=+..  ++ ...+....    .++  .|.        .++........+...+++.+.++|.||
T Consensus         4 KiVlvGDs~VGKTsLl~~~~--~n~~~~~~~~~~~~~pTv~~~~~--------~~~~~~~~~~~~~~vdg~~v~L~iWDT   73 (195)
T cd01873           4 KCVVVGDNAVGKTRLICARA--CNKTLTQYQLLATHVPTVWAIDQ--------YRVCQEVLERSRDVVDGVSVSLRLWDT   73 (195)
T ss_pred             EEEEECCCCCCHHHHHHHHH--HCCCCCCCCCCCCCCCCCCCCCC--------CEEEEEECCCCEEEECCEEEEEEEEEC
T ss_conf             99998789989899997787--47876556566675886633333--------134444302211421895999999978


Q ss_pred             CCCCHHHHHHHHH--HHHCCEEEEEEECCCCCCHHHHHH-HHHHHH---CCCCEEEEECCCCCCCCCCCCHH--------
Q ss_conf             8730027999999--973026899998687886558999-999997---09967998326788753211338--------
Q gi|254780321|r   86 PGHVDFTYEVSRS--LSACEGSLLVVDATQGVEAQTLAN-VYQAID---NNHEIITVLNKADLPSADPDRVK--------  151 (606)
Q Consensus        86 PGH~DF~~EV~r~--l~a~dgaiLvVdA~~Gvq~QT~~~-~~~A~~---~~l~~I~viNKiD~~~A~~e~v~--------  151 (606)
                      .|..++    .|.  .+-+|+++|+.|-++---=+.... |..-+.   .+.|+|+|=||+|+-..+.+...        
T Consensus        74 AG~~~~----~r~~~y~~~~~~ll~fdv~~~~Sf~~v~~~W~~ei~~~~~~~piiLVG~K~DLr~~~~~~~~~~~~~~~~  149 (195)
T cd01873          74 FGDHDK----DRRFAYGRSDVVLLCFSIASPNSLRNVKTMWYPEIRHFCPRVPVILVGCKLDLRYADLDEVNRARRPLAR  149 (195)
T ss_pred             CCCHHH----CCCCCCCCCCEEEEEEECCCCHHHHHHHHHHHHHHHHHCCCCCEEEEEECHHHCCCCCHHHHHHHHCCCC
T ss_conf             996200----1214356888999999669801489999999999998689998899963757544630245554300136


Q ss_pred             ----------HH---HHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHH
Q ss_conf             ----------88---77555322321000111002232006787763
Q gi|254780321|r  152 ----------KQ---IEETIGISTEDALLVSAKTGEGIPLLLERIVQ  185 (606)
Q Consensus       152 ----------~e---i~~~~g~~~~~ii~vSAktG~GV~~LLd~Iv~  185 (606)
                                +|   +..-+|+   .-+-|||++|.||+++++..+.
T Consensus       150 ~~~~~~~v~~ee~~~~A~~~g~---~y~EtSAkt~~gV~e~F~~air  193 (195)
T cd01873         150 PIKNADILPPETGRAVAKELGI---PYYETSVVTQFGVKDVFDNAIR  193 (195)
T ss_pred             CCCCCCCCCHHHHHHHHHHHCC---EEEECCCCCCCCHHHHHHHHHH
T ss_conf             5543576789999999998299---8998284879897999999998


No 260
>cd03698 eRF3_II_like eRF3_II_like: domain similar to domain II of the eukaryotic class II release factor (eRF3). In eukaryotes, translation termination is mediated by two interacting release factors, eRF1 and eRF3, which act as class I and II factors, respectively. eRF1 functions as an omnipotent release factor, decoding all three stop codons and triggering the release of the nascent peptide catalyzed by the ribsome. eRF3 is a GTPase, which enhances the termination efficiency by stimulating the eRF1 activity in a GTP-dependent manner. Sequence comparison of class II release factors with elongation factors shows that eRF3 is more similar to eEF1alpha whereas prokaryote RF3 is more similar to EF-G, implying that their precise function may differ. Only eukaryote RF3s are found in this group. Saccharomyces cerevisiae eRF3 (Sup35p) is a translation termination factor which is divided into three regions N, M and a C-terminal eEF1a-like region essential for translation termination.  Sup35NM  
Probab=98.61  E-value=3.3e-08  Score=74.56  Aligned_cols=82  Identities=18%  Similarity=0.384  Sum_probs=67.4

Q ss_pred             CCCCCCCCEEECCCCCEEEEEEECCCCCCCCCEEEEECCCCCCCCCCCCCCCCCEEEEHHCCCCC-HHHHHHCCCCCCCC
Q ss_conf             23310121011475725999981698735584588733556421012223355412401012471-23322011002444
Q gi|254780321|r  199 PLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVERIGILTPKMIDIEALYPGE-IGVMIASIKEVSHT  277 (606)
Q Consensus       199 Pl~alVfds~~D~~~G~I~~~RV~sG~lk~Gd~I~~~~~g~~~~v~~ig~~~~~~~~v~~l~aGd-VG~ii~gik~l~~~  277 (606)
                      |||+.|.|.+-++. |.+.+|||.+|++++||+|.+++++++.+|..+..   +..+++++.||| |+.-+.|+ +..++
T Consensus         1 P~R~pI~~v~~~~g-G~vv~G~v~sG~i~~Gd~v~i~P~~~~~~VksI~~---~~~~~~~A~aG~~V~l~L~gi-d~~~i   75 (83)
T cd03698           1 PFRLPISDKYKDQG-GTVVSGKVESGSIQKGDTLLVMPSKESVEVKSIYV---DDEEVDYAVAGENVRLKLKGI-DEEDI   75 (83)
T ss_pred             CEEEEEEEEEECCC-CCEEEEEEEECEECCCCEEEEECCCCEEEEEEEEE---CCEEECEECCCCEEEEEECCC-CHHHC
T ss_conf             97989974798699-73999999025872899999978998899999999---991729888999799998489-89994


Q ss_pred             CCCCEECC
Q ss_conf             45420004
Q gi|254780321|r  278 RVGDTITD  285 (606)
Q Consensus       278 ~vGDTl~~  285 (606)
                      +.||-||+
T Consensus        76 ~rG~vlcs   83 (83)
T cd03698          76 SPGDVLCS   83 (83)
T ss_pred             CCCCEEEC
T ss_conf             79889949


No 261
>COG1163 DRG Predicted GTPase [General function prediction only]
Probab=98.55  E-value=4.7e-07  Score=66.81  Aligned_cols=149  Identities=23%  Similarity=0.339  Sum_probs=86.5

Q ss_pred             CEEEEEECCCCCCHHHHHHHHHHHCCCCCCCCCCCEEECCCHHHHHHCCEEEEEEEEEEEECCCCCEEEEEEEECCCCCH
Q ss_conf             31799980138987788999999829805444431130586779871950523279999743788438999961787300
Q gi|254780321|r   11 IRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVRLNYTSTDAKDYQLNLIDTPGHVD   90 (606)
Q Consensus        11 IRN~~IiaHvDhGKTTL~d~lL~~tg~i~~~~~~~~vlD~~~~EreRGITIka~~~~~~~~~~~~~~y~iNlIDTPGH~D   90 (606)
                      .-.+++||--..|||||.-+|   |++-++-..-+    +.        |...-.--+.|.     +-.|-|+|+||-..
T Consensus        63 da~v~lVGfPsvGKStLL~~L---Tnt~seva~y~----FT--------Tl~~vPG~l~Y~-----ga~IQild~Pgii~  122 (365)
T COG1163          63 DATVALVGFPSVGKSTLLNKL---TNTKSEVADYP----FT--------TLEPVPGMLEYK-----GAQIQLLDLPGIIE  122 (365)
T ss_pred             CEEEEEECCCCCCHHHHHHHH---HCCCCCCCCCC----CE--------ECCCCCCEEEEC-----CCEEEEECCCCCCC
T ss_conf             738999768874589999887---68876434567----41--------024457447547-----81699972763125


Q ss_pred             -H------HHHHHHHHHHCCEEEEEEECCCCCCH-HHH------------------------------------------
Q ss_conf             -2------79999999730268999986878865-589------------------------------------------
Q gi|254780321|r   91 -F------TYEVSRSLSACEGSLLVVDATQGVEA-QTL------------------------------------------  120 (606)
Q Consensus        91 -F------~~EV~r~l~a~dgaiLvVdA~~Gvq~-QT~------------------------------------------  120 (606)
                       +      +-||-...+.||..++|+|+.+.... ..+                                          
T Consensus       123 gas~g~grG~~vls~~R~ADlIiiVld~~~~~~~~~~i~~ELe~~GIrlnk~~p~V~I~kk~~gGI~i~~t~~l~~~d~~  202 (365)
T COG1163         123 GASSGRGRGRQVLSVARNADLIIIVLDVFEDPHHRDIIERELEDVGIRLNKRPPDVTIKKKESGGIRINGTGPLTHLDED  202 (365)
T ss_pred             CCCCCCCCCCEEEEEECCCCEEEEEEECCCCHHHHHHHHHHHHHCCEEECCCCCCEEEEEECCCCEEEECCCCCCCCCHH
T ss_conf             76568887646546521588899997168882488999999985676821799965999952598798045456668999


Q ss_pred             ------------------------HHHHHHHHCCC---CEEEEECCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHCC
Q ss_conf             ------------------------99999997099---679983267887532113388877555322321000111002
Q gi|254780321|r  121 ------------------------ANVYQAIDNNH---EIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTG  173 (606)
Q Consensus       121 ------------------------~~~~~A~~~~l---~~I~viNKiD~~~A~~e~v~~ei~~~~g~~~~~ii~vSAktG  173 (606)
                                              .-+--|+..+.   |-|.|+||+|+++.  |. .+.+.+.     .+.+++||++|
T Consensus       203 ~ir~iL~Ey~I~nA~V~Ir~dvTlDd~id~l~~nrvY~p~l~v~NKiD~~~~--e~-~~~l~~~-----~~~v~isa~~~  274 (365)
T COG1163         203 TVRAILREYRIHNADVLIREDVTLDDLIDALEGNRVYKPALYVVNKIDLPGL--EE-LERLARK-----PNSVPISAKKG  274 (365)
T ss_pred             HHHHHHHHHCCCCEEEEEECCCCHHHHHHHHHHCCEEEEEEEEEECCCCCCH--HH-HHHHHHC-----CCEEEEECCCC
T ss_conf             9999999728363069994688689999998416213236899952556687--88-9999734-----56289865568


Q ss_pred             CCCCHHHHHHHHHH
Q ss_conf             23200678776321
Q gi|254780321|r  174 EGIPLLLERIVQQL  187 (606)
Q Consensus       174 ~GV~~LLd~Iv~~i  187 (606)
                      .|++.|++.|-+.+
T Consensus       275 ~nld~L~e~i~~~L  288 (365)
T COG1163         275 INLDELKERIWDVL  288 (365)
T ss_pred             CCHHHHHHHHHHHH
T ss_conf             79889999999874


No 262
>PRK13768 GTPase; Provisional
Probab=98.55  E-value=1.3e-06  Score=63.87  Aligned_cols=110  Identities=28%  Similarity=0.392  Sum_probs=67.2

Q ss_pred             CEEEEEEEECCCCC------HHHHHHHHHHHHC--CEEEEEEECCCCCCHHHH-HHHHHH----HHCCCCEEEEECCCCC
Q ss_conf             43899996178730------0279999999730--268999986878865589-999999----9709967998326788
Q gi|254780321|r   76 KDYQLNLIDTPGHV------DFTYEVSRSLSAC--EGSLLVVDATQGVEAQTL-ANVYQA----IDNNHEIITVLNKADL  142 (606)
Q Consensus        76 ~~y~iNlIDTPGH~------DF~~EV~r~l~a~--dgaiLvVdA~~Gvq~QT~-~~~~~A----~~~~l~~I~viNKiD~  142 (606)
                      .+|.  |+||||..      +.+....+.|..-  -.++.++|+.-=..|.+- +++..|    ...++|.|.|+||+|+
T Consensus        97 ~dY~--i~D~PGQiElft~~~~~~~i~~~L~~~~~~~~v~l~D~~~~~~~~~fiS~~L~a~s~m~~l~lP~inVlsK~Dl  174 (253)
T PRK13768         97 ADYV--LVDTPGQMELFAFRESGRYLVEKLSSGSKSLSVYLIDAVLAKDPSDFVSLLLLALSVQLRLGLPQIPVLNKIDL  174 (253)
T ss_pred             CCEE--EEECCCCEEEEECCHHHHHHHHHHHCCCCEEEEEEECHHHHCCHHHHHHHHHHHHHHHHHCCCCEEEEEEHHHC
T ss_conf             8759--98268744322234079999999863686289998450563788799999999999999739997998676862


Q ss_pred             CCCC-----------CCCHHHHHHHH-----------H----HHH-HHHHHHHHHHCCCCCCHHHHHHHHHH
Q ss_conf             7532-----------11338887755-----------5----322-32100011100223200678776321
Q gi|254780321|r  143 PSAD-----------PDRVKKQIEET-----------I----GIS-TEDALLVSAKTGEGIPLLLERIVQQL  187 (606)
Q Consensus       143 ~~A~-----------~e~v~~ei~~~-----------~----g~~-~~~ii~vSAktG~GV~~LLd~Iv~~i  187 (606)
                      -..+           ++...+++.+.           .    ++. .-..+|+|+++|.|++.|+.+|-+.+
T Consensus       175 l~~~~~~~i~~~~~D~~~l~~~l~~~~~~~~~l~~~l~~~l~e~~~~v~~ipvS~~~~eg~~~l~~~I~~~~  246 (253)
T PRK13768        175 LSEEELERIRKWLEDPETLLEELKLDKGVQGDLAEELLSALEESGIPVRVIPVSAKTGEGFEELYALLQEVF  246 (253)
T ss_pred             CCHHHHHHHHHHHCCHHHHHHHHHCCCCHHHHHHHHHHHHHHHHCCCCCEEEEECCCCCCHHHHHHHHHHHH
T ss_conf             783779999998629999999985061158999999999999846666527756898787999999999996


No 263
>cd01342 Translation_Factor_II_like Translation_Factor_II_like: Elongation factor Tu (EF-Tu) domain II-like proteins. Elongation factor Tu consists of three structural domains, this family represents the second domain. Domain II adopts a beta barrel structure and is involved in binding to charged tRNA. Domain II is found in other proteins such as elongation factor G and translation initiation factor IF-2. This group also includes the C2 subdomain of domain IV of IF-2 that has the same fold as domain II of (EF-Tu). Like IF-2 from certain prokaryotes such as Thermus thermophilus, mitochondrial IF-2 lacks domain II, which is thought  to be involved in binding of E.coli IF-2 to 30S subunits.
Probab=98.55  E-value=6.1e-08  Score=72.79  Aligned_cols=81  Identities=23%  Similarity=0.407  Sum_probs=63.4

Q ss_pred             CCCCCCCEEECCCCCEEEEEEECCCCCCCCCEEEEEC--CCCCCCCCCCCCCCCCEEEEHHCCCCCHHHHHHCCCCCCCC
Q ss_conf             3310121011475725999981698735584588733--55642101222335541240101247123322011002444
Q gi|254780321|r  200 LKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMG--TNAKYQVERIGILTPKMIDIEALYPGEIGVMIASIKEVSHT  277 (606)
Q Consensus       200 l~alVfds~~D~~~G~I~~~RV~sG~lk~Gd~I~~~~--~g~~~~v~~ig~~~~~~~~v~~l~aGdVG~ii~gik~l~~~  277 (606)
                      ++++|++++.+++.|.++++||++|++++||.+.+.+  .....++..+..+.   .+++++.||+++.++..  +..+.
T Consensus         1 ~~~~v~~~~~~~~~g~v~~~rv~~G~l~~g~~v~~~~~~~~~~~~v~~i~~~~---~~~~~~~aG~~~~~~~~--~~~~~   75 (83)
T cd01342           1 LRALVFKVFKDKGRGTVATGRVESGTLKKGDKVRVGPGGGGVKGKVKSLKRFK---GEVDEAVAGDIVGIVLK--DKDDI   75 (83)
T ss_pred             CEEEEEEEEEECCCEEEEEEEECCCEEECCCEEEEECCCCCEEEEEEEEEEEC---CCCCEECCCCEEEEEEC--CHHHC
T ss_conf             91299999991896899999993429989999999709963899998999922---37779848989999971--63534


Q ss_pred             CCCCEECC
Q ss_conf             45420004
Q gi|254780321|r  278 RVGDTITD  285 (606)
Q Consensus       278 ~vGDTl~~  285 (606)
                      ++||+++.
T Consensus        76 ~~gd~~~~   83 (83)
T cd01342          76 KIGDTLTD   83 (83)
T ss_pred             CCCCEECC
T ss_conf             79989829


No 264
>pfam03308 ArgK ArgK protein. The ArgK protein acts as an ATPase enzyme and as a kinase, and phosphorylates periplasmic binding proteins involved in the LAO (lysine, arginine, ornithine)/AO transport systems.
Probab=98.52  E-value=2.3e-07  Score=68.94  Aligned_cols=172  Identities=26%  Similarity=0.258  Sum_probs=106.3

Q ss_pred             HCEEEEEECCCCCCHHHHHHHHHHHC---C----C--CCC---CCCCCEEECCCHH---HHHHCCEEEEEEEEEEEEC--
Q ss_conf             53179998013898778899999982---9----8--054---4443113058677---9871950523279999743--
Q gi|254780321|r   10 RIRNFSIVAHIDHGKSTLADRFIQHC---R----G--LTE---REMSSQVLDNMDI---ERERGITIKAQTVRLNYTS--   72 (606)
Q Consensus        10 ~IRN~~IiaHvDhGKTTL~d~lL~~t---g----~--i~~---~~~~~~vlD~~~~---EreRGITIka~~~~~~~~~--   72 (606)
                      +-.-|+|-|--++|||||.|+|...-   |    .  |+.   ...+.-+=|..-.   -+..++=|.+.+.+-..-+  
T Consensus        28 ~a~~iGiTG~PGaGKStli~~l~~~~~~~g~~vaVlAvDPSS~~sgGaiLGDr~RM~~~~~~~~vfiRs~~srg~lGGls  107 (267)
T pfam03308        28 RAHRVGITGVPGAGKSTLIEALGMELRRRGHRVAVLAVDPSSPFTGGSILGDRTRMQRLAVDPGAFIRSSPSRGALGGLS  107 (267)
T ss_pred             CCEEEEEECCCCCCHHHHHHHHHHHHHHCCCEEEEEEECCCCCCCCCCCCCCHHHHHHHCCCCCEEEEECCCCCCCCCCC
T ss_conf             95599876899887999999999999968986899997899988886300107777650589985886457788888714


Q ss_pred             ---------CCCCEEEEEEEECCCCCHHHHHHHHHHHHCCEEEEEEECCCCCCHHHHHHHHHHHHCCCCEEEEECCCCCC
Q ss_conf             ---------78843899996178730027999999973026899998687886558999999997099679983267887
Q gi|254780321|r   73 ---------TDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQAIDNNHEIITVLNKADLP  143 (606)
Q Consensus        73 ---------~~~~~y~iNlIDTPGH~DF~~EV~r~l~a~dgaiLvVdA~~Gvq~QT~~~~~~A~~~~l~~I~viNKiD~~  143 (606)
                               ++.-.|-+=||.|-|--  ..|+. ...++|..+||.-.-.|=+-|..    +|--+.+.=|+||||.|++
T Consensus       108 ~~t~~~i~lleaaGfD~IivETVGVG--QsE~~-v~~~aD~~llv~~Pg~GDeiQ~i----KaGImEiaDi~vVNKaD~~  180 (267)
T pfam03308       108 RATREAILLLDAAGFDVIIIETVGVG--QSEVD-IANMADTFVLVTIPGGGDDLQGI----KAGLMEIADIYVVNKADLP  180 (267)
T ss_pred             HHHHHHHHHHHHCCCCEEEEECCCCC--CCCHH-HHHHCCEEEEEECCCCCHHHHHH----HHHHHHHCCEEEEECCCHH
T ss_conf             76999999999779999999247777--53035-55415768999558876088898----7537653548999667647


Q ss_pred             CCCCCCHHHHHHHHHHHHHH-------HHHHHHHHCCCCCCHHHHHHHHHHHCC
Q ss_conf             53211338887755532232-------100011100223200678776321000
Q gi|254780321|r  144 SADPDRVKKQIEETIGISTE-------DALLVSAKTGEGIPLLLERIVQQLPSP  190 (606)
Q Consensus       144 ~A~~e~v~~ei~~~~g~~~~-------~ii~vSAktG~GV~~LLd~Iv~~iP~P  190 (606)
                      +|+  +...++...+.+...       .++.+||.+|.|+++|.++|.++.-.-
T Consensus       181 ~A~--~~~~~l~~~l~l~~~~~~~W~p~Vl~tSA~~g~Gi~el~~~I~~~~~~l  232 (267)
T pfam03308       181 GAE--RTARELRSALHLLTPKEAGWRPPVLTTSAVTGEGIDELWDAIEEHREFL  232 (267)
T ss_pred             HHH--HHHHHHHHHHHCCCCCCCCCCCCEEEEECCCCCCHHHHHHHHHHHHHHH
T ss_conf             699--9999999998517987789999989987478899999999999999999


No 265
>KOG0098 consensus
Probab=98.51  E-value=4.2e-06  Score=60.45  Aligned_cols=150  Identities=28%  Similarity=0.391  Sum_probs=87.2

Q ss_pred             EEEEECCCCCCHHHHHHHHHHHCCC-CCCCCCCCEEECCCHHHHHHCCEEEEEEEEEEEECCCCCEEEEEEEECCCCCHH
Q ss_conf             7999801389877889999998298-054444311305867798719505232799997437884389999617873002
Q gi|254780321|r   13 NFSIVAHIDHGKSTLADRFIQHCRG-LTEREMSSQVLDNMDIERERGITIKAQTVRLNYTSTDAKDYQLNLIDTPGHVDF   91 (606)
Q Consensus        13 N~~IiaHvDhGKTTL~d~lL~~tg~-i~~~~~~~~vlD~~~~EreRGITIka~~~~~~~~~~~~~~y~iNlIDTPGH~DF   91 (606)
                      -.-|||.-+-|||.|.   |..|.. +..      +-| .-+    |+---+..+     ..+++.-++++.||-||.-|
T Consensus         8 KyIiiGd~gVGKScll---lrf~~krF~~------~hd-~Ti----Gvefg~r~~-----~id~k~IKlqiwDtaGqe~f   68 (216)
T KOG0098           8 KYIIIGDTGVGKSCLL---LRFTDKRFQP------VHD-LTI----GVEFGARMV-----TIDGKQIKLQIWDTAGQESF   68 (216)
T ss_pred             EEEEECCCCCCHHHHH---HHHHCCCCCC------CCC-CEE----EEEECEEEE-----EECCCEEEEEEEECCCCHHH
T ss_conf             8999877773288999---9985157654------534-302----244023698-----88581689999755786769


Q ss_pred             HHHHHHH-HHHCCEEEEEEECCCCCCHHHHH---HHH-HHHHC---CCCEEEEECCCCCCCCCCCCHHHHHHHHHHHH-H
Q ss_conf             7999999-97302689999868788655899---999-99970---99679983267887532113388877555322-3
Q gi|254780321|r   92 TYEVSRS-LSACEGSLLVVDATQGVEAQTLA---NVY-QAIDN---NHEIITVLNKADLPSADPDRVKKQIEETIGIS-T  162 (606)
Q Consensus        92 ~~EV~r~-l~a~dgaiLvVdA~~Gvq~QT~~---~~~-~A~~~---~l~~I~viNKiD~~~A~~e~v~~ei~~~~g~~-~  162 (606)
                       ++|.|+ .+-+.|||||-|-+.   ..|--   .|. -+.++   +..+++.=||+|+..-+  .|.+|=-+.|.=. .
T Consensus        69 -rsv~~syYr~a~GalLVydit~---r~sF~hL~~wL~D~rq~~~~NmvImLiGNKsDL~~rR--~Vs~EEGeaFA~ehg  142 (216)
T KOG0098          69 -RSVTRSYYRGAAGALLVYDITR---RESFNHLTSWLEDARQHSNENMVIMLIGNKSDLEARR--EVSKEEGEAFAREHG  142 (216)
T ss_pred             -HHHHHHHHCCCCCEEEEEECCC---HHHHHHHHHHHHHHHHHCCCCCEEEEECCHHHHHCCC--CCCHHHHHHHHHHCC
T ss_conf