HHsearch alignment for GI: 254780321 and conserved domain: pfam00448

>pfam00448 SRP54 SRP54-type protein, GTPase domain. This family includes relatives of the G-domain of the SRP54 family of proteins.
Probab=91.31  E-value=1.2  Score=23.94  Aligned_cols=154  Identities=23%  Similarity=0.255  Sum_probs=69.1

Q ss_pred             EEEEECCCCCCHHHHHHHHHHHCCCCCCCCCCCE--EECCC---HHHHHH------CCEEEEE-----EEEEEEEC---C
Q ss_conf             7999801389877889999998298054444311--30586---779871------9505232-----79999743---7
Q gi|254780321|r   13 NFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQ--VLDNM---DIERER------GITIKAQ-----TVRLNYTS---T   73 (606)
Q Consensus        13 N~~IiaHvDhGKTTL~d~lL~~tg~i~~~~~~~~--vlD~~---~~EreR------GITIka~-----~~~~~~~~---~   73 (606)
T Consensus         3 vi~lvGptGvGKTTTiaKLAa~~~---~~~~~V~lit~Dt~R~gA~eQL~~ya~~l~v~~~~~~~~~d~~~~~~~~l~~~   79 (196)
T pfam00448         3 VILLVGLQGSGKTTTIAKLAAYLK---KQGKKVLLVAADTFRAAAIEQLKQLAERLGVPVFGSGTGSDPAAVAFDAVEKA   79 (196)
T ss_pred             EEEEECCCCCCHHHHHHHHHHHHH---HCCCEEEEEECCCCCHHHHHHHHHHHHHCCCEEEECCCCCCHHHHHHHHHHHH
T ss_conf             999989999988999999999999---77992899975877688999999999863981781487778789999999998


Q ss_pred             CCCEEEEEEEECCCC--CHH--HHHHHHHHHH--CCEEEEEEECCCCCCHHHHHHHHHHHHCCCCEEEEECCCCCCCCCC
Q ss_conf             884389999617873--002--7999999973--0268999986878865589999999970996799832678875321
Q gi|254780321|r   74 DAKDYQLNLIDTPGH--VDF--TYEVSRSLSA--CEGSLLVVDATQGVEAQTLANVYQAIDNNHEIITVLNKADLPSADP  147 (606)
Q Consensus        74 ~~~~y~iNlIDTPGH--~DF--~~EV~r~l~a--~dgaiLvVdA~~Gvq~QT~~~~~~A~~~~l~~I~viNKiD~~~A~~  147 (606)
T Consensus        80 ~~~~~D~IlIDTaGr~~~d~~~~~el~~~~~~~~~~~~~LVl~a~~~~~~~~~~-~~f~~~~~~~~-~I~TKlDe-t~~~  156 (196)
T pfam00448        80 KAENYDVVLVDTAGRLQNDKNLMDELKKIKRVIAPDEVLLVLDATTGQNALNQA-KAFNEAVGITG-VILTKLDG-DAKG  156 (196)
T ss_pred             HHCCCCEEEEECCCCCCCCHHHHHHHHHHHHHCCCCCEEEEEECCCCCCHHHHH-HHHHHHCCCCC-EEEEEECC-CCCC
T ss_conf             846899999989998747677899999998522873028998567782137899-98760047762-68884057-8875


Q ss_pred             CCHHHHHHHHHHHHHHHHHHHHHH-CCCCCCHH
Q ss_conf             133888775553223210001110-02232006
Q gi|254780321|r  148 DRVKKQIEETIGISTEDALLVSAK-TGEGIPLL  179 (606)
Q Consensus       148 e~v~~ei~~~~g~~~~~ii~vSAk-tG~GV~~L  179 (606)
T Consensus       157 G~~l~-------~~~~~~~Pi~~~t~Gq~v~Dl  182 (196)
T pfam00448       157 GAALS-------IAAETGKPIKFIGVGEKIDDL  182 (196)
T ss_pred             CHHHH-------HHHHHCCCEEEEECCCCHHHC
T ss_conf             29998-------999989697999679981206