HHsearch alignment for GI: 254780321 and conserved domain: pfam05049

>pfam05049 IIGP Interferon-inducible GTPase (IIGP). Interferon-inducible GTPase (IIGP) is thought to play a role in in intracellular defence. IIGP is predominantly associated with the Golgi apparatus and also localizes to the endoplasmic reticulum and exerts a distinct role in IFN-induced intracellular membrane trafficking or processing.
Probab=96.47  E-value=0.08  Score=31.73  Aligned_cols=159  Identities=19%  Similarity=0.251  Sum_probs=89.6

Q ss_pred             EEEEEECCCCCCHHHHHHHHHHHCCCCCCCCCCCEEECCCHHHHHHCCEEEEEEEEEEEECCCCCEEEEEEEECCCC--C
Q ss_conf             17999801389877889999998298054444311305867798719505232799997437884389999617873--0
Q gi|254780321|r   12 RNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVRLNYTSTDAKDYQLNLIDTPGH--V   89 (606)
Q Consensus        12 RN~~IiaHvDhGKTTL~d~lL~~tg~i~~~~~~~~vlD~~~~EreRGITIka~~~~~~~~~~~~~~y~iNlIDTPGH--~   89 (606)
T Consensus        36 lnIavtGesG~GkSsfINalR---g~g~e~~~aA----------~tGvve-tT~~~~~Y~hp~~pn--V~lwDLPG~gt~   99 (375)
T pfam05049        36 LKIAVTGDSGNGKSSFINALR---GIGHEEDGSA----------PTGVVE-TTMKRTPYSHPHFPN--VVLWDLPGLGAT   99 (375)
T ss_pred             EEEEEECCCCCCHHHHHHHHH---CCCCCCCCCC----------CCCCEE-ECCCCCCCCCCCCCC--EEEECCCCCCCC
T ss_conf             479985489986789999874---7898777768----------768766-326755678999998--079628999989


Q ss_pred             HHHHHHHHH---HHHCCEEEEEEECCCCCCHHHHHHHHHH---HHCCCCEEEEECCCCCC----------CCCCCCHHHH
Q ss_conf             027999999---9730268999986878865589999999---97099679983267887----------5321133888
Q gi|254780321|r   90 DFTYEVSRS---LSACEGSLLVVDATQGVEAQTLANVYQA---IDNNHEIITVLNKADLP----------SADPDRVKKQ  153 (606)
Q Consensus        90 DF~~EV~r~---l~a~dgaiLvVdA~~Gvq~QT~~~~~~A---~~~~l~~I~viNKiD~~----------~A~~e~v~~e  153 (606)
T Consensus       100 ~f~~~~Yl~~~~f~~yDfFi-iiss~rf~~----n~v~LAk~i~~mgK~fyfVrtKvD~Dl~~e~~~kp~~F~~e~~Lq~  174 (375)
T pfam05049       100 NFTVETYLEEMKFSEYDFFI-IISSERFSL----NDVKLAKAIQRMGKRFYFVRTKLDSDLSNEQKGKPQTFPKEKVLQN  174 (375)
T ss_pred             CCCHHHHHHHCCCCCCCEEE-EEECCCCCH----HHHHHHHHHHHHCCCEEEEEEECCCCCHHHHHCCCCCCCHHHHHHH
T ss_conf             98989999874856477899-996775432----0189999999838947999862367606576258999998999999


Q ss_pred             HHHHH-------HHHHHHHHHHHHHC--CCCCCHHHHHHHHHHHCCC
Q ss_conf             77555-------32232100011100--2232006787763210001
Q gi|254780321|r  154 IEETI-------GISTEDALLVSAKT--GEGIPLLLERIVQQLPSPT  191 (606)
Q Consensus       154 i~~~~-------g~~~~~ii~vSAkt--G~GV~~LLd~Iv~~iP~P~  191 (606)
T Consensus       175 IR~~c~~~L~k~gv~eP~VFLvSnfdl~~yDFp~L~~TL~~eLP~hK  221 (375)
T pfam05049       175 IQDNCRNNLQKEGVKEPPIFLVSNLDPSHYDFPKLRDTLLKDLPIIK  221 (375)
T ss_pred             HHHHHHHHHHHCCCCCCCEEEEECCCHHHCCHHHHHHHHHHHHHHHH
T ss_conf             99999999987588899789981788132681899999998736867