HHsearch alignment for GI: 254780321 and conserved domain: smart00175

>smart00175 RAB Rab subfamily of small GTPases. Rab GTPases are implicated in vesicle trafficking.
Probab=99.43  E-value=4.8e-12  Score=100.33  Aligned_cols=156  Identities=25%  Similarity=0.317  Sum_probs=99.9

Q ss_pred             EEEEECCCCCCHHHHHHHHHHHCCCCCCCCCCCEEECCCHHHHHHCCEEEEEEEEEEEECCCCCEEEEEEEECCCCCHHH
Q ss_conf             79998013898778899999982980544443113058677987195052327999974378843899996178730027
Q gi|254780321|r   13 NFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVRLNYTSTDAKDYQLNLIDTPGHVDFT   92 (606)
Q Consensus        13 N~~IiaHvDhGKTTL~d~lL~~tg~i~~~~~~~~vlD~~~~EreRGITIka~~~~~~~~~~~~~~y~iNlIDTPGH~DF~   92 (606)
T Consensus         2 Ki~vvG~~~vGKTsli~r~~--~~~f~~~~-~~T----------i~~~~~~~--~i~---~~~~~~~l~iwDt~G~e~~~   63 (164)
T smart00175        2 KIILIGDSGVGKSSLLSRFT--DGKFSEQY-KST----------IGVDFKTK--TIE---VDGKRVKLQIWDTAGQERFR   63 (164)
T ss_pred             EEEEECCCCCCHHHHHHHHH--HCCCCCCC-CCC----------CCEEEEEE--EEE---ECCEEEEEEEEECCCCHHHH
T ss_conf             89999989977999999994--19999986-884----------56666779--999---99999999999679944664


Q ss_pred             HHHHHHHHHCCEEEEEEECCCCCCHHHHHHHHHHH-H---CCCCEEEEECCCCCCCCCCCCHHHHHHHHHHHHHHHHHHH
Q ss_conf             99999997302689999868788655899999999-7---0996799832678875321133888775553223210001
Q gi|254780321|r   93 YEVSRSLSACEGSLLVVDATQGVEAQTLANVYQAI-D---NNHEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLV  168 (606)
Q Consensus        93 ~EV~r~l~a~dgaiLvVdA~~Gvq~QT~~~~~~A~-~---~~l~~I~viNKiD~~~A~~e~v~~ei~~~~g~~~~~ii~v  168 (606)
T Consensus        64 ~l~~~~~~~~~~~ilvfdi~~~~Sf~~i~~w~~~i~~~~~~~~piilvgnK~Dl~~~r~V-~~~e~~~~a~~~~~~~~e~  142 (164)
T smart00175       64 SITSSYYRGAVGALLVYDITNRESFENLKNWLKELREYADPNVVIMLVGNKSDLEDQRQV-SREEAEAFAEEHGLPFFET  142 (164)
T ss_pred             HHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHHHHCCCCCCEEECCCCCCHHHHCCC-CHHHHHHHHHHCCCEEEEE
T ss_conf             779988336653688436899899999999999999867999825511645685651879-9999999999849979998


Q ss_pred             HHHCCCCCCHHHHHHHHHH
Q ss_conf             1100223200678776321
Q gi|254780321|r  169 SAKTGEGIPLLLERIVQQL  187 (606)
Q Consensus       169 SAktG~GV~~LLd~Iv~~i  187 (606)
T Consensus       143 SAk~~~~v~e~F~~l~~~i  161 (164)
T smart00175      143 SAKTNTNVEEAFEELAREI  161 (164)
T ss_pred             CCCCCCCHHHHHHHHHHHH
T ss_conf             3166908899999999999