HHsearch alignment for GI: 254780321 and conserved domain: smart00176

>smart00176 RAN Ran (Ras-related nuclear proteins) /TC4 subfamily of small GTPases. Ran is involved in the active transport of proteins through nuclear pores.
Probab=99.31  E-value=8e-11  Score=92.15  Aligned_cols=150  Identities=19%  Similarity=0.194  Sum_probs=98.5

Q ss_pred             ECCCCCCHHHHHHHHHHHCCCCCCCCCCCEEECCCHHHHHHCCEEEEEEEEEEEECCCCCEEEEEEEECCCCCHHHHHHH
Q ss_conf             80138987788999999829805444431130586779871950523279999743788438999961787300279999
Q gi|254780321|r   17 VAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVRLNYTSTDAKDYQLNLIDTPGHVDFTYEVS   96 (606)
Q Consensus        17 iaHvDhGKTTL~d~lL~~tg~i~~~~~~~~vlD~~~~EreRGITIka~~~~~~~~~~~~~~y~iNlIDTPGH~DF~~EV~   96 (606)
T Consensus         1 vGD~gVGKTsli~R~~--~~~F~~~y~---------------pTiGvd~~~~~~-~~~~~~i~l~iWDTAGqE~f~sl~~   62 (200)
T smart00176        1 VGDGGTGKTTFVKRHL--TGEFEKKYV---------------ATLGVEVHPLVF-HTNRGPIRFNVWDTAGQEKFGGLRD   62 (200)
T ss_pred             CCCCCCCHHHHHHHHH--CCCCCCCCC---------------CCEEEEEEEEEE-EECCEEEEEEEEECCCCCCCCCCCH
T ss_conf             9898878999999994--099999978---------------871489899999-9899899999998988700011026


Q ss_pred             HHHHHCCEEEEEEECCCCCCHHHHHHHHHHH---HCCCCEEEEECCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHCC
Q ss_conf             9997302689999868788655899999999---7099679983267887532113388877555322321000111002
Q gi|254780321|r   97 RSLSACEGSLLVVDATQGVEAQTLANVYQAI---DNNHEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTG  173 (606)
Q Consensus        97 r~l~a~dgaiLvVdA~~Gvq~QT~~~~~~A~---~~~l~~I~viNKiD~~~A~~e~v~~ei~~~~g~~~~~ii~vSAktG  173 (606)
T Consensus        63 ~yyr~a~~~IlvfDvt~~~SF~~l~~W~~~l~~~~~~ipiiLvGNK~DL~~r~---V~~e~~~~a~~~~~~y~EtSAKt~  139 (200)
T smart00176       63 GYYIQGQCAIIMFDVTARVTYKNVPNWHRDLVRVCENIPIVLCGNKVDVKDRK---VKAKSITFHRKKNLQYYDISAKSN  139 (200)
T ss_pred             HHCCCCCEEEEEEECCCHHHHHHHHHHHHHHHHHCCCCCEEEEEECCCCCCCC---CCHHHHHHHHHCCCCEEEEECCCC
T ss_conf             55057878899963587789998999999999857999889999887574043---659999999987997898300469


Q ss_pred             CCCCHHHHHHHHHH
Q ss_conf             23200678776321
Q gi|254780321|r  174 EGIPLLLERIVQQL  187 (606)
Q Consensus       174 ~GV~~LLd~Iv~~i  187 (606)
T Consensus       140 ~Nv~e~F~~Lar~L  153 (200)
T smart00176      140 YNFEKPFLWLARKL  153 (200)
T ss_pred             CCHHHHHHHHHHHH
T ss_conf             69799999999998