BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.


Reference for composition-based statistics starting in round 2:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254780321|ref|YP_003064734.1| GTP-binding protein LepA
[Candidatus Liberibacter asiaticus str. psy62]
         (606 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done


Results from round 1


>gi|254780321|ref|YP_003064734.1| GTP-binding protein LepA [Candidatus Liberibacter asiaticus str.
           psy62]
 gi|254039998|gb|ACT56794.1| GTP-binding protein LepA [Candidatus Liberibacter asiaticus str.
           psy62]
          Length = 606

 Score = 1246 bits (3225), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 606/606 (100%), Positives = 606/606 (100%)

Query: 1   MQKKPTPLSRIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGIT 60
           MQKKPTPLSRIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGIT
Sbjct: 1   MQKKPTPLSRIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGIT 60

Query: 61  IKAQTVRLNYTSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTL 120
           IKAQTVRLNYTSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTL
Sbjct: 61  IKAQTVRLNYTSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTL 120

Query: 121 ANVYQAIDNNHEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLL 180
           ANVYQAIDNNHEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLL
Sbjct: 121 ANVYQAIDNNHEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLL 180

Query: 181 ERIVQQLPSPTSPEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAK 240
           ERIVQQLPSPTSPEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAK
Sbjct: 181 ERIVQQLPSPTSPEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAK 240

Query: 241 YQVERIGILTPKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPI 300
           YQVERIGILTPKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPI
Sbjct: 241 YQVERIGILTPKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPI 300

Query: 301 QPVVFCGLFPVDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEII 360
           QPVVFCGLFPVDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEII
Sbjct: 301 QPVVFCGLFPVDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEII 360

Query: 361 QERLEREFSLNLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITP 420
           QERLEREFSLNLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITP
Sbjct: 361 QERLEREFSLNLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITP 420

Query: 421 NEYLGSILKLCQERRGIQIDMSHLDNRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYN 480
           NEYLGSILKLCQERRGIQIDMSHLDNRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYN
Sbjct: 421 NEYLGSILKLCQERRGIQIDMSHLDNRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYN 480

Query: 481 VIDYRDSDLVKLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAA 540
           VIDYRDSDLVKLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAA
Sbjct: 481 VIDYRDSDLVKLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAA 540

Query: 541 IGGRIIARETVKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISI 600
           IGGRIIARETVKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISI
Sbjct: 541 IGGRIIARETVKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISI 600

Query: 601 LKTDNE 606
           LKTDNE
Sbjct: 601 LKTDNE 606


>gi|315122254|ref|YP_004062743.1| GTP-binding protein LepA [Candidatus Liberibacter solanacearum
           CLso-ZC1]
 gi|313495656|gb|ADR52255.1| GTP-binding protein LepA [Candidatus Liberibacter solanacearum
           CLso-ZC1]
          Length = 606

 Score = 1129 bits (2921), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 538/606 (88%), Positives = 581/606 (95%)

Query: 1   MQKKPTPLSRIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGIT 60
           MQ KPTPLSRIRNFSIVAHIDHGKSTLADRFIQ+CRGLTEREMSSQVLDNMDIERERGIT
Sbjct: 1   MQNKPTPLSRIRNFSIVAHIDHGKSTLADRFIQYCRGLTEREMSSQVLDNMDIERERGIT 60

Query: 61  IKAQTVRLNYTSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTL 120
           IKAQTVRLNYTS + +DY LNLIDTPGHVDFTYEVSRSLSACEGSLLVVDA+QGVEAQT+
Sbjct: 61  IKAQTVRLNYTSENGQDYLLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDASQGVEAQTI 120

Query: 121 ANVYQAIDNNHEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLL 180
           ANVYQAIDNNHE+ITVLNKADLPSADP+RVKKQIEETIGI+T+D+LL+SAKTGEGI  LL
Sbjct: 121 ANVYQAIDNNHELITVLNKADLPSADPERVKKQIEETIGINTDDSLLISAKTGEGIQQLL 180

Query: 181 ERIVQQLPSPTSPEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAK 240
           E+I+QQLP PTSPEG NAPLKALLIDSWYNSYLGVMVLVRIING+LTKGQ+IRLMGTNAK
Sbjct: 181 EKIIQQLPHPTSPEGENAPLKALLIDSWYNSYLGVMVLVRIINGKLTKGQTIRLMGTNAK 240

Query: 241 YQVERIGILTPKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPI 300
           Y+VERIG+LTPKM+DIE LYPGEIGVM+ASIKEVSHTRVGDTITDD  PTTSALPGFK I
Sbjct: 241 YKVERIGVLTPKMVDIETLYPGEIGVMMASIKEVSHTRVGDTITDDDFPTTSALPGFKEI 300

Query: 301 QPVVFCGLFPVDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEII 360
           QPVVFCGLFPVDA+QFENLRTAI KLRLNDASFSFELENSTALGFGFRCGFLGLLHLEII
Sbjct: 301 QPVVFCGLFPVDASQFENLRTAIKKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEII 360

Query: 361 QERLEREFSLNLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITP 420
           QERLEREF L+LIGTSPSV+Y L M DGS+ +LSNP DMP++TKI+EL+EPWI VTIITP
Sbjct: 361 QERLEREFDLDLIGTSPSVIYNLSMRDGSIIELSNPSDMPDITKISELKEPWISVTIITP 420

Query: 421 NEYLGSILKLCQERRGIQIDMSHLDNRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYN 480
            EYLGSILKLCQERRGIQIDM+H++NR ++ YELPLNEVIFDFYDRLKSVS+GYASFDY 
Sbjct: 421 TEYLGSILKLCQERRGIQIDMNHIENRTILAYELPLNEVIFDFYDRLKSVSRGYASFDYT 480

Query: 481 VIDYRDSDLVKLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAA 540
           VIDYR+ DLVKLTILVN+ET+DALSILVHRSV+EKRGRGICEKLKNLIPQQMFQIAIQAA
Sbjct: 481 VIDYRNGDLVKLTILVNDETVDALSILVHRSVAEKRGRGICEKLKNLIPQQMFQIAIQAA 540

Query: 541 IGGRIIARETVKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISI 600
           IGGRIIARETVKARRKDVTAKCYGGDITRKRKLLEKQK+GKKRMRRFG+VDIPQ+AFISI
Sbjct: 541 IGGRIIARETVKARRKDVTAKCYGGDITRKRKLLEKQKDGKKRMRRFGKVDIPQNAFISI 600

Query: 601 LKTDNE 606
           LK++NE
Sbjct: 601 LKSNNE 606


>gi|222084518|ref|YP_002543047.1| GTP-binding protein LepA [Agrobacterium radiobacter K84]
 gi|221721966|gb|ACM25122.1| GTP-binding protein LepA [Agrobacterium radiobacter K84]
          Length = 610

 Score =  981 bits (2535), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 460/601 (76%), Positives = 532/601 (88%)

Query: 6   TPLSRIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQT 65
           TPLS IRNFSIVAHIDHGKSTLADR IQ   GL EREMS QVLDNM+IERERGITIKAQT
Sbjct: 10  TPLSHIRNFSIVAHIDHGKSTLADRLIQTTGGLAEREMSEQVLDNMEIERERGITIKAQT 69

Query: 66  VRLNYTSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQ 125
           VRL+Y + + + Y LNLIDTPGHVDF YEVSRSLSACEGSLLVVDA+QGVEAQTLANVYQ
Sbjct: 70  VRLHYKANNGETYILNLIDTPGHVDFAYEVSRSLSACEGSLLVVDASQGVEAQTLANVYQ 129

Query: 126 AIDNNHEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERIVQ 185
           AIDNNHEI+TVLNK DLP+A+PDR+K QIEE IGI   +A+L+SAKTG GIP +LE IV 
Sbjct: 130 AIDNNHEIVTVLNKIDLPAAEPDRIKDQIEEVIGIDASEAVLISAKTGLGIPDVLEAIVH 189

Query: 186 QLPSPTSPEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVER 245
           +LP+P SP G  APLKALL+DSWY++YLGVMVLVRII+G +TKGQ+IR+MGT+ KYQVER
Sbjct: 190 KLPAPKSPGGEKAPLKALLVDSWYDTYLGVMVLVRIIDGVMTKGQTIRMMGTDVKYQVER 249

Query: 246 IGILTPKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVVF 305
           +G+LTPKM+ +E+L PGEIG + ASIKEV+ TRVGDTIT+D  PT  ALPGFKP QPVVF
Sbjct: 250 VGVLTPKMLTVESLGPGEIGFITASIKEVADTRVGDTITEDKRPTAQALPGFKPAQPVVF 309

Query: 306 CGLFPVDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERLE 365
           CGLFPVDA  FE+LR+A+ KLRLNDASFSFE+E+S ALGFGFRCGFLGLLHLEIIQERLE
Sbjct: 310 CGLFPVDAADFEDLRSAMGKLRLNDASFSFEMESSAALGFGFRCGFLGLLHLEIIQERLE 369

Query: 366 REFSLNLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEYLG 425
           REF+L+LI T+PSVVY+L M DG+  +L NP DMP+V KIAE REPWI+ TI+TP+EYLG
Sbjct: 370 REFNLDLIATAPSVVYQLTMTDGTEIELHNPADMPDVVKIAEFREPWIKATILTPDEYLG 429

Query: 426 SILKLCQERRGIQIDMSHLDNRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDYR 485
           SILKLCQ+RRG+Q +++++ NRAMI Y+LPLNEV+FDFYDRLKS+SKGYASFDYN+ DYR
Sbjct: 430 SILKLCQDRRGVQTELTYVGNRAMITYDLPLNEVVFDFYDRLKSISKGYASFDYNLTDYR 489

Query: 486 DSDLVKLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGGRI 545
           DSDLVK++ILVN E +DALS+LVHRS +EKRGR +CEKLK+LIPQ MFQI IQAAIGGRI
Sbjct: 490 DSDLVKMSILVNAEPVDALSMLVHRSAAEKRGRVMCEKLKDLIPQHMFQIPIQAAIGGRI 549

Query: 546 IARETVKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISILKTDN 605
           IARETVKA RKDVTAKCYGGD +RKRKLL+KQKEGKKRMR+FG+V+IPQ AFI+ LK  +
Sbjct: 550 IARETVKALRKDVTAKCYGGDASRKRKLLDKQKEGKKRMRQFGKVEIPQEAFIAALKMGD 609

Query: 606 E 606
           E
Sbjct: 610 E 610


>gi|325291676|ref|YP_004277540.1| GTP-binding protein lepA [Agrobacterium sp. H13-3]
 gi|325059529|gb|ADY63220.1| GTP-binding protein lepA [Agrobacterium sp. H13-3]
          Length = 608

 Score =  963 bits (2489), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 446/601 (74%), Positives = 527/601 (87%)

Query: 6   TPLSRIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQT 65
           TPL  IRNFSIVAHIDHGKSTLADR IQ   GL ER+MS QVLD+MDIERERGITIKAQT
Sbjct: 8   TPLDHIRNFSIVAHIDHGKSTLADRLIQSTGGLAERDMSEQVLDSMDIERERGITIKAQT 67

Query: 66  VRLNYTSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQ 125
           VRL+Y   + + Y LNLIDTPGHVDF YEVSRSLSACEGSLLVVDA+QGVEAQTLANVYQ
Sbjct: 68  VRLHYKGNNGETYVLNLIDTPGHVDFAYEVSRSLSACEGSLLVVDASQGVEAQTLANVYQ 127

Query: 126 AIDNNHEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERIVQ 185
           AIDNNHE++TVLNK DLP+A+PDR+K+QIEE IGI   +A+L+SAKTG GIP +LE IV 
Sbjct: 128 AIDNNHELVTVLNKIDLPAAEPDRIKEQIEEVIGIDASEAVLISAKTGLGIPDVLEAIVN 187

Query: 186 QLPSPTSPEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVER 245
           +LP P S  G N PLKALL+DSWY++YLGVMVLVR+I+G LTKGQ IR+MG+ AKY VER
Sbjct: 188 RLPPPKSEVGENGPLKALLVDSWYDTYLGVMVLVRVIDGVLTKGQQIRMMGSGAKYGVER 247

Query: 246 IGILTPKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVVF 305
           +G+LTPKM+++++L PGEIG + ASIKEV+ TRVGDTITDD  PT  ALPGFKP QPVVF
Sbjct: 248 VGVLTPKMVNVDSLGPGEIGFITASIKEVADTRVGDTITDDKRPTAQALPGFKPAQPVVF 307

Query: 306 CGLFPVDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERLE 365
           CGLFPVDA  FE+LR A+ KLRLNDASFSFE+E+S ALGFGFRCGFLGLLHLEIIQERLE
Sbjct: 308 CGLFPVDAADFEDLRAAVGKLRLNDASFSFEMESSAALGFGFRCGFLGLLHLEIIQERLE 367

Query: 366 REFSLNLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEYLG 425
           REF+L+L+ T+PSVVYE+ + DG+ ++L NP DMP+V KI E+REPWI+ TI+TP+EYLG
Sbjct: 368 REFNLDLVATAPSVVYEMTLTDGTEKELHNPADMPDVVKIKEIREPWIKATILTPDEYLG 427

Query: 426 SILKLCQERRGIQIDMSHLDNRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDYR 485
            ILKLCQ+RRG+Q +++++ NRAMI YELPLNEV+FDFYDRLKS+SKGYASFDYN+IDYR
Sbjct: 428 GILKLCQDRRGLQTELTYVGNRAMITYELPLNEVVFDFYDRLKSISKGYASFDYNIIDYR 487

Query: 486 DSDLVKLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGGRI 545
           + DLVK++ILVN + +DALS+LVHRS +++RGRG+CEKLK LIP  MFQI IQAAIGG++
Sbjct: 488 EGDLVKMSILVNGDPVDALSMLVHRSAADRRGRGMCEKLKELIPPHMFQIPIQAAIGGKV 547

Query: 546 IARETVKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISILKTDN 605
           IARETV+A RKDVTAKCYGGD TRKRKLL+KQKEGKKRMR+FG+V+IPQ AFI+ LK ++
Sbjct: 548 IARETVRALRKDVTAKCYGGDATRKRKLLDKQKEGKKRMRQFGKVEIPQEAFIAALKMND 607

Query: 606 E 606
           E
Sbjct: 608 E 608


>gi|15887591|ref|NP_353272.1| GTP-binding protein LepA [Agrobacterium tumefaciens str. C58]
 gi|24211907|sp|Q8UIQ2|LEPA_AGRT5 RecName: Full=Elongation factor 4; Short=EF-4; AltName:
           Full=Ribosomal back-translocase LepA
 gi|15155132|gb|AAK86057.1| GTP-binding protein LepA [Agrobacterium tumefaciens str. C58]
          Length = 608

 Score =  962 bits (2488), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 445/601 (74%), Positives = 528/601 (87%)

Query: 6   TPLSRIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQT 65
           TPL  IRNFSIVAHIDHGKSTLADR IQ   GL ER+MS QVLD+MDIERERGITIKAQT
Sbjct: 8   TPLDHIRNFSIVAHIDHGKSTLADRLIQSTGGLAERDMSEQVLDSMDIERERGITIKAQT 67

Query: 66  VRLNYTSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQ 125
           VRL+Y + + + Y LNLIDTPGHVDF YEVSRSLSACEGSLLVVDA+QGVEAQTLANVYQ
Sbjct: 68  VRLHYKANNGETYVLNLIDTPGHVDFAYEVSRSLSACEGSLLVVDASQGVEAQTLANVYQ 127

Query: 126 AIDNNHEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERIVQ 185
           AIDNNHE++TVLNK DLP+A+P+R+K+QIEE IGI   DA+++SAKTG GIP +LE IV 
Sbjct: 128 AIDNNHELVTVLNKIDLPAAEPERIKEQIEEVIGIDASDAVMISAKTGLGIPDVLEAIVN 187

Query: 186 QLPSPTSPEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVER 245
           +LP P S  G N PLKALL+DSWY++YLGVMVLVR+I+G LTKGQ IR+MG+ AKY VER
Sbjct: 188 RLPPPKSDVGENGPLKALLVDSWYDTYLGVMVLVRVIDGVLTKGQQIRMMGSGAKYGVER 247

Query: 246 IGILTPKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVVF 305
           +G+LTPKM+++++L PGEIG + ASIKEV+ TRVGDTITDD  PT  ALPGFKP QPVVF
Sbjct: 248 VGVLTPKMVNVDSLGPGEIGFITASIKEVADTRVGDTITDDKRPTAQALPGFKPAQPVVF 307

Query: 306 CGLFPVDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERLE 365
           CGLFPVDA  FE+LR A+ KLRLNDASFSFE+E+S ALGFGFRCGFLGLLHLEIIQERLE
Sbjct: 308 CGLFPVDAADFEDLRAAVGKLRLNDASFSFEMESSAALGFGFRCGFLGLLHLEIIQERLE 367

Query: 366 REFSLNLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEYLG 425
           REF+L+L+ T+PSVVYE+ + DG+ ++L NP DMP+V KI E+REPWI+ TI+TP+EYLG
Sbjct: 368 REFNLDLVATAPSVVYEMTLTDGTEKELHNPADMPDVVKIKEIREPWIKATILTPDEYLG 427

Query: 426 SILKLCQERRGIQIDMSHLDNRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDYR 485
            ILKLCQ+RRG+Q +++++ NRAMI YELPLNEV+FDFYDRLKS+SKGYASFDYN+IDYR
Sbjct: 428 GILKLCQDRRGLQTELTYVGNRAMITYELPLNEVVFDFYDRLKSISKGYASFDYNIIDYR 487

Query: 486 DSDLVKLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGGRI 545
           + DLVK++ILVN + +DALS+LVHRS +++RGRG+CEKLK LIP  MFQI IQAAIGG++
Sbjct: 488 EGDLVKMSILVNGDPVDALSMLVHRSAADRRGRGMCEKLKELIPPHMFQIPIQAAIGGKV 547

Query: 546 IARETVKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISILKTDN 605
           IARETV+A RKDVTAKCYGGD TRKRKLL+KQKEGKKRMR+FG+V+IPQ AFI+ LK ++
Sbjct: 548 IARETVRALRKDVTAKCYGGDATRKRKLLDKQKEGKKRMRQFGKVEIPQEAFIAALKMND 607

Query: 606 E 606
           E
Sbjct: 608 E 608


>gi|190889913|ref|YP_001976455.1| GTP-binding elongation factor protein [Rhizobium etli CIAT 652]
 gi|238692536|sp|B3PYC6|LEPA_RHIE6 RecName: Full=Elongation factor 4; Short=EF-4; AltName:
           Full=Ribosomal back-translocase LepA
 gi|190695192|gb|ACE89277.1| GTP-binding elongation factor protein [Rhizobium etli CIAT 652]
          Length = 610

 Score =  960 bits (2482), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 444/601 (73%), Positives = 529/601 (88%)

Query: 6   TPLSRIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQT 65
           TPLS IRNFSIVAHIDHGKSTLADR IQ   GL EREMS QVLDNMDIERERGITIKAQT
Sbjct: 10  TPLSHIRNFSIVAHIDHGKSTLADRLIQTTGGLAEREMSEQVLDNMDIERERGITIKAQT 69

Query: 66  VRLNYTSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQ 125
           VRL+Y + + + Y LNLIDTPGHVDF YEVSRSLSACEGSLLVVDA+QGVEAQTLANVYQ
Sbjct: 70  VRLHYQANNGEKYILNLIDTPGHVDFAYEVSRSLSACEGSLLVVDASQGVEAQTLANVYQ 129

Query: 126 AIDNNHEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERIVQ 185
           AIDNNHE++TVLNK DLP+A+PDR+K+QIEE IGI   +A+L+SAKTG GIP +LE IV+
Sbjct: 130 AIDNNHELVTVLNKIDLPAAEPDRIKEQIEEVIGIDASEAVLISAKTGLGIPDVLEAIVR 189

Query: 186 QLPSPTSPEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVER 245
           +LP+P SP G  APLKALL+DSWY++YLGVMVLVRII+G LTKGQ+IR+MGT+AKYQVER
Sbjct: 190 KLPAPKSPGGEKAPLKALLVDSWYDTYLGVMVLVRIIDGVLTKGQTIRMMGTDAKYQVER 249

Query: 246 IGILTPKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVVF 305
           +G+LTPKM+++++L PGEIG + ASIKEV+ TRVGDTIT+D  PT  ALPGFKP QPVVF
Sbjct: 250 VGVLTPKMVNVDSLGPGEIGFITASIKEVADTRVGDTITEDKRPTAQALPGFKPAQPVVF 309

Query: 306 CGLFPVDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERLE 365
           CGLFPVDA  FE+LR A+ KLRLNDASFSFE+E+S ALGFGFRCGFLGLLHLEIIQERLE
Sbjct: 310 CGLFPVDAADFEDLRAAMGKLRLNDASFSFEMESSAALGFGFRCGFLGLLHLEIIQERLE 369

Query: 366 REFSLNLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEYLG 425
           REF L+LI T+PSVVY++YM DG+ ++L NP DMP+V KI+E+ EPWI+ TI+TP++YLG
Sbjct: 370 REFDLDLIATAPSVVYKMYMTDGTERELHNPADMPDVVKISEIHEPWIRATILTPDDYLG 429

Query: 426 SILKLCQERRGIQIDMSHLDNRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDYR 485
            ILKLCQ+RRGIQI+++++  RAM+ Y+LPLNEV+FDFYDRLKS+SKGYASFDY + D+R
Sbjct: 430 GILKLCQDRRGIQIELTYVGTRAMLTYDLPLNEVVFDFYDRLKSISKGYASFDYTLTDHR 489

Query: 486 DSDLVKLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGGRI 545
           + +LVK++ILVN E +DALS++VHR+ +EKRGR +CEKLK LIP+ MF+I IQAAIGG +
Sbjct: 490 EGNLVKMSILVNGEPVDALSMMVHRTAAEKRGRDMCEKLKELIPKHMFKIPIQAAIGGNV 549

Query: 546 IARETVKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISILKTDN 605
           IARET+ A RKDVTAKCYGGD TRKRKLL+KQK GKKRMR+FG+V+IPQ AFI+ LK  +
Sbjct: 550 IARETISALRKDVTAKCYGGDATRKRKLLDKQKAGKKRMRQFGKVEIPQEAFIAALKMGD 609

Query: 606 E 606
           E
Sbjct: 610 E 610


>gi|327191557|gb|EGE58570.1| GTP-binding protein LepA [Rhizobium etli CNPAF512]
          Length = 610

 Score =  959 bits (2480), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 444/601 (73%), Positives = 528/601 (87%)

Query: 6   TPLSRIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQT 65
           TPLS IRNFSIVAHIDHGKSTLADR IQ   GL EREMS QVLDNMDIERERGITIKAQT
Sbjct: 10  TPLSHIRNFSIVAHIDHGKSTLADRLIQTTGGLAEREMSEQVLDNMDIERERGITIKAQT 69

Query: 66  VRLNYTSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQ 125
           VRL+Y + + + Y LNLIDTPGHVDF YEVSRSLSACEGSLLVVDA+QGVEAQTLANVYQ
Sbjct: 70  VRLHYQANNGEKYILNLIDTPGHVDFAYEVSRSLSACEGSLLVVDASQGVEAQTLANVYQ 129

Query: 126 AIDNNHEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERIVQ 185
           AIDNNHE++TVLNK DLP+A+PDR+K+QIEE IGI   +A+L+SAKTG GIP +LE IV 
Sbjct: 130 AIDNNHELVTVLNKIDLPAAEPDRIKEQIEEVIGIDASEAVLISAKTGLGIPDVLEAIVN 189

Query: 186 QLPSPTSPEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVER 245
           +LP+P SP G  APLKALL+DSWY++YLGVMVLVRII+G LTKGQ+IR+MGT+AKYQVER
Sbjct: 190 KLPAPKSPGGDKAPLKALLVDSWYDTYLGVMVLVRIIDGVLTKGQTIRMMGTDAKYQVER 249

Query: 246 IGILTPKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVVF 305
           +G+LTPKM+++++L PGEIG + ASIKEV+ TRVGDTIT+D  PT  ALPGFKP QPVVF
Sbjct: 250 VGVLTPKMVNVDSLGPGEIGFITASIKEVADTRVGDTITEDKRPTAQALPGFKPAQPVVF 309

Query: 306 CGLFPVDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERLE 365
           CGLFPVDA  FE+LR A+ KLRLNDASFSFE+E+S ALGFGFRCGFLGLLHLEIIQERLE
Sbjct: 310 CGLFPVDAADFEDLRAAMGKLRLNDASFSFEMESSAALGFGFRCGFLGLLHLEIIQERLE 369

Query: 366 REFSLNLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEYLG 425
           REF L+LI T+PSVVY+++M DGS ++L NP DMP+V KI+E+ EPWI+ TI+TP++YLG
Sbjct: 370 REFDLDLIATAPSVVYKMFMTDGSERELHNPADMPDVVKISEIHEPWIRATILTPDDYLG 429

Query: 426 SILKLCQERRGIQIDMSHLDNRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDYR 485
            ILKLCQ+RRGIQI+++++  RAM+ Y+LPLNEV+FDFYDRLKS+SKGYASFDY + D+R
Sbjct: 430 GILKLCQDRRGIQIELTYVGTRAMLTYDLPLNEVVFDFYDRLKSISKGYASFDYTLTDHR 489

Query: 486 DSDLVKLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGGRI 545
           + +LVK++ILVN E +DALS++VHR+ +EKRGR +CEKLK LIP+ MF+I IQAAIGG +
Sbjct: 490 EGNLVKMSILVNGEPVDALSMMVHRTAAEKRGRDMCEKLKELIPKHMFKIPIQAAIGGNV 549

Query: 546 IARETVKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISILKTDN 605
           IARET+ A RKDVTAKCYGGD TRKRKLL+KQK GKKRMR+FG+V+IPQ AFI+ LK  +
Sbjct: 550 IARETISALRKDVTAKCYGGDATRKRKLLDKQKAGKKRMRQFGKVEIPQEAFIAALKMGD 609

Query: 606 E 606
           E
Sbjct: 610 E 610


>gi|241207201|ref|YP_002978297.1| GTP-binding protein LepA [Rhizobium leguminosarum bv. trifolii
           WSM1325]
 gi|240861091|gb|ACS58758.1| GTP-binding protein LepA [Rhizobium leguminosarum bv. trifolii
           WSM1325]
          Length = 610

 Score =  959 bits (2479), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 444/601 (73%), Positives = 528/601 (87%)

Query: 6   TPLSRIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQT 65
           TPLS IRNFSIVAHIDHGKSTLADR IQ   GL EREMS QVLDNMDIERERGITIKAQT
Sbjct: 10  TPLSHIRNFSIVAHIDHGKSTLADRLIQTTGGLAEREMSEQVLDNMDIERERGITIKAQT 69

Query: 66  VRLNYTSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQ 125
           VRL+Y + + + Y LNLIDTPGHVDF YEVSRSLSACEGSLLVVDA+QGVEAQTLANVYQ
Sbjct: 70  VRLHYQANNGEKYILNLIDTPGHVDFAYEVSRSLSACEGSLLVVDASQGVEAQTLANVYQ 129

Query: 126 AIDNNHEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERIVQ 185
           AIDNNHEI+TVLNK DLP+A+PDR+K+QIEE IGI   +A+L+SAKTG GIP +LE IV 
Sbjct: 130 AIDNNHEIVTVLNKIDLPAAEPDRIKEQIEEVIGIDASEAVLISAKTGLGIPDVLEAIVH 189

Query: 186 QLPSPTSPEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVER 245
           +LP+P SP G  APLKALL+DSWY++YLGVMVLVR+I+G LTKGQ++R+MGT+AKYQVER
Sbjct: 190 RLPAPKSPGGEKAPLKALLVDSWYDAYLGVMVLVRVIDGVLTKGQTVRMMGTDAKYQVER 249

Query: 246 IGILTPKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVVF 305
           +G+LTPKM++I+ L PGEIG + ASIKEV+ TRVGDTIT+D  PT  ALPGFKP QPVVF
Sbjct: 250 VGVLTPKMVNIDRLGPGEIGFITASIKEVADTRVGDTITEDKRPTAQALPGFKPAQPVVF 309

Query: 306 CGLFPVDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERLE 365
           CGLFPVDA  FE+LR A+ KLRLNDASFSFE+E+S ALGFGFRCGFLGLLHLEIIQERLE
Sbjct: 310 CGLFPVDAADFEDLRAAMGKLRLNDASFSFEMESSAALGFGFRCGFLGLLHLEIIQERLE 369

Query: 366 REFSLNLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEYLG 425
           REF L+LI T+PSVVY+++M DG+ ++L NP DMP+V KI+E+ EPWI+ TI+TP++YLG
Sbjct: 370 REFDLDLIATAPSVVYKMFMTDGTERELHNPADMPDVVKISEIHEPWIRATILTPDDYLG 429

Query: 426 SILKLCQERRGIQIDMSHLDNRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDYR 485
           SILKLCQ+RRGIQI+++++  RAM+ Y+LPLNEV+FDFYDRLKS+SKGYASFDY + D+R
Sbjct: 430 SILKLCQDRRGIQIELTYVGTRAMLTYDLPLNEVVFDFYDRLKSISKGYASFDYTLTDHR 489

Query: 486 DSDLVKLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGGRI 545
           + +LVK++ILVN E +DALS++VHR+ +EKRGR +CEKLK LIP+ MF+I IQAAIGG +
Sbjct: 490 EGNLVKMSILVNGEPVDALSMMVHRTAAEKRGRDMCEKLKELIPKHMFKIPIQAAIGGNV 549

Query: 546 IARETVKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISILKTDN 605
           IARET+ A RKDVTAKCYGGD TRKRKLL+KQK GKKRMR+FG+V+IPQ AFI+ LK  +
Sbjct: 550 IARETISALRKDVTAKCYGGDATRKRKLLDKQKAGKKRMRQFGKVEIPQEAFIAALKMGD 609

Query: 606 E 606
           E
Sbjct: 610 E 610


>gi|209551823|ref|YP_002283740.1| GTP-binding protein LepA [Rhizobium leguminosarum bv. trifolii
           WSM2304]
 gi|238057817|sp|B5ZXQ5|LEPA_RHILW RecName: Full=Elongation factor 4; Short=EF-4; AltName:
           Full=Ribosomal back-translocase LepA
 gi|209537579|gb|ACI57514.1| GTP-binding protein LepA [Rhizobium leguminosarum bv. trifolii
           WSM2304]
          Length = 610

 Score =  958 bits (2477), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 444/601 (73%), Positives = 528/601 (87%)

Query: 6   TPLSRIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQT 65
           TPLS IRNFSIVAHIDHGKSTLADR IQ   GL EREMS QVLDNMDIERERGITIKAQT
Sbjct: 10  TPLSHIRNFSIVAHIDHGKSTLADRLIQTTGGLAEREMSEQVLDNMDIERERGITIKAQT 69

Query: 66  VRLNYTSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQ 125
           VRL+Y + + + Y LNLIDTPGHVDF YEVSRSLSACEGSLLVVDA+QGVEAQTLANVYQ
Sbjct: 70  VRLHYQANNGEKYILNLIDTPGHVDFAYEVSRSLSACEGSLLVVDASQGVEAQTLANVYQ 129

Query: 126 AIDNNHEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERIVQ 185
           AIDNNHE++TVLNK DLP+A+PDR+K+QIEE IGI   +A+L+SAKTG GIP +LE IV 
Sbjct: 130 AIDNNHELVTVLNKIDLPAAEPDRIKEQIEEVIGIDASEAVLISAKTGLGIPDVLEAIVN 189

Query: 186 QLPSPTSPEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVER 245
           +LP+P SP G  APLKALL+DSWY++YLGVMVLVRII+G LTKGQ+IR+MGT+AKYQVER
Sbjct: 190 RLPAPKSPGGDKAPLKALLVDSWYDTYLGVMVLVRIIDGVLTKGQTIRMMGTDAKYQVER 249

Query: 246 IGILTPKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVVF 305
           +G+LTPKM+++++L PGEIG + ASIKEV+ TRVGDTIT+D  PT  ALPGFKP QPVVF
Sbjct: 250 VGVLTPKMVNVDSLGPGEIGFITASIKEVADTRVGDTITEDKRPTAQALPGFKPAQPVVF 309

Query: 306 CGLFPVDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERLE 365
           CGLFPVDA  FE+LR A+ KLRLNDASFSFE+E+S ALGFGFRCGFLGLLHLEIIQERLE
Sbjct: 310 CGLFPVDAADFEDLRAAMGKLRLNDASFSFEMESSAALGFGFRCGFLGLLHLEIIQERLE 369

Query: 366 REFSLNLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEYLG 425
           REF L+LI T+PSVVY+++M DGS ++L NP DMP+V KI+E+ EPWI+ TI+TP++YLG
Sbjct: 370 REFDLDLIATAPSVVYKMFMTDGSERELHNPADMPDVVKISEIHEPWIRATILTPDDYLG 429

Query: 426 SILKLCQERRGIQIDMSHLDNRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDYR 485
            ILKLCQ+RRGIQI+++++  RAM+ Y+LPLNEV+FDFYDRLKS+SKGYASFDY + D+R
Sbjct: 430 GILKLCQDRRGIQIELTYVGTRAMLTYDLPLNEVVFDFYDRLKSISKGYASFDYTLTDHR 489

Query: 486 DSDLVKLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGGRI 545
           + +LVK++ILVN E +DALS++VHR+ +EKRGR +CEKLK LIP+ MF+I IQAAIGG +
Sbjct: 490 EGNLVKMSILVNGEPVDALSMMVHRTAAEKRGRDMCEKLKELIPKHMFKIPIQAAIGGNV 549

Query: 546 IARETVKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISILKTDN 605
           IARET+ A RKDVTAKCYGGD TRKRKLL+KQK GKKRMR+FG+V+IPQ AFI+ LK  +
Sbjct: 550 IARETISALRKDVTAKCYGGDATRKRKLLDKQKAGKKRMRQFGKVEIPQEAFIAALKMGD 609

Query: 606 E 606
           E
Sbjct: 610 E 610


>gi|116250022|ref|YP_765860.1| GTP-binding protein LepA [Rhizobium leguminosarum bv. viciae 3841]
 gi|119371382|sp|Q1MMQ8|LEPA_RHIL3 RecName: Full=Elongation factor 4; Short=EF-4; AltName:
           Full=Ribosomal back-translocase LepA
 gi|115254670|emb|CAK05744.1| putative GTP-binding protein [Rhizobium leguminosarum bv. viciae
           3841]
          Length = 610

 Score =  957 bits (2474), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 443/601 (73%), Positives = 527/601 (87%)

Query: 6   TPLSRIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQT 65
           TPLS IRNFSIVAHIDHGKSTLADR IQ   GL EREMS QVLDNMDIERERGITIKAQT
Sbjct: 10  TPLSHIRNFSIVAHIDHGKSTLADRLIQTTGGLAEREMSEQVLDNMDIERERGITIKAQT 69

Query: 66  VRLNYTSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQ 125
           VRL+Y + + + Y LNLIDTPGHVDF YEVSRSLSACEGSLLVVDA+QGVEAQTLANVYQ
Sbjct: 70  VRLHYQANNGEKYILNLIDTPGHVDFAYEVSRSLSACEGSLLVVDASQGVEAQTLANVYQ 129

Query: 126 AIDNNHEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERIVQ 185
           AIDNNHEI+TVLNK DLP+A+PDR+K+QIEE IGI   +A+L+SAKTG GIP +LE IV 
Sbjct: 130 AIDNNHEIVTVLNKIDLPAAEPDRIKEQIEEVIGIDASEAVLISAKTGLGIPDVLEAIVH 189

Query: 186 QLPSPTSPEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVER 245
           +LP+P SP G  APLKALL+DSWY++YLGVMVLVR+I+G LTKGQ++R+MGT+AKYQVER
Sbjct: 190 KLPAPKSPGGDKAPLKALLVDSWYDAYLGVMVLVRVIDGVLTKGQTVRMMGTDAKYQVER 249

Query: 246 IGILTPKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVVF 305
           +G+LTPKM++I+ L PGEIG + ASIKEV+ TRVGDTIT+D  PT  ALPGFKP QPVVF
Sbjct: 250 VGVLTPKMVNIDRLGPGEIGFITASIKEVADTRVGDTITEDKRPTAQALPGFKPAQPVVF 309

Query: 306 CGLFPVDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERLE 365
           CGLFPVDA  FE+LR A+ KLRLNDASFSFE+E+S ALGFGFRCGFLGLLHLEIIQERLE
Sbjct: 310 CGLFPVDAADFEDLRAAMGKLRLNDASFSFEMESSAALGFGFRCGFLGLLHLEIIQERLE 369

Query: 366 REFSLNLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEYLG 425
           REF L+LI T+PSVVY+++M DG+ ++L NP DMP+V KI+E+ EPWI+ TI+TP++YLG
Sbjct: 370 REFDLDLIATAPSVVYKMFMTDGTERELHNPADMPDVVKISEIHEPWIRATILTPDDYLG 429

Query: 426 SILKLCQERRGIQIDMSHLDNRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDYR 485
            ILKLCQ+RRGIQI+++++  RAM+ Y+LPLNEV+FDFYDRLKS+SKGYASFDY + D+R
Sbjct: 430 GILKLCQDRRGIQIELTYVGTRAMLTYDLPLNEVVFDFYDRLKSISKGYASFDYTLTDHR 489

Query: 486 DSDLVKLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGGRI 545
           + +LVK++ILVN E +DALS++VHR+ +EKRGR +CEKLK LIP+ MF+I IQAAIGG +
Sbjct: 490 EGNLVKMSILVNGEPVDALSMMVHRTAAEKRGRDMCEKLKELIPKHMFKIPIQAAIGGNV 549

Query: 546 IARETVKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISILKTDN 605
           IARET+ A RKDVTAKCYGGD TRKRKLL+KQK GKKRMR+FG+V+IPQ AFI+ LK  +
Sbjct: 550 IARETISALRKDVTAKCYGGDATRKRKLLDKQKAGKKRMRQFGKVEIPQEAFIAALKMGD 609

Query: 606 E 606
           E
Sbjct: 610 E 610


>gi|227824107|ref|YP_002828080.1| GTP-binding protein LepA [Sinorhizobium fredii NGR234]
 gi|227343109|gb|ACP27327.1| GTP-binding protein, LepA [Sinorhizobium fredii NGR234]
          Length = 611

 Score =  957 bits (2473), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 444/601 (73%), Positives = 526/601 (87%)

Query: 6   TPLSRIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQT 65
           TPLS IRNFSIVAHIDHGKSTLADR IQ   GL EREMS QVLD+MDIERERGITIKAQT
Sbjct: 11  TPLSHIRNFSIVAHIDHGKSTLADRLIQLTGGLAEREMSEQVLDSMDIERERGITIKAQT 70

Query: 66  VRLNYTSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQ 125
           VRL+Y + D   Y LNLIDTPGHVDF YEVSRSLSACEGSLLVVDA+QGVEAQTLANVYQ
Sbjct: 71  VRLHYKANDGDTYVLNLIDTPGHVDFAYEVSRSLSACEGSLLVVDASQGVEAQTLANVYQ 130

Query: 126 AIDNNHEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERIVQ 185
           AIDNNHE++TVLNK DLP+A+PDR+K+QIEE IGI   DA+L+SAKTG GIP +LE IV 
Sbjct: 131 AIDNNHELVTVLNKIDLPAAEPDRIKEQIEEVIGIDASDAVLISAKTGLGIPDVLEAIVH 190

Query: 186 QLPSPTSPEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVER 245
           +LP+P SP G  APLKALL+DSWY++YLGVMVLVR+I+G LTKGQ+IR+MGT+AKY +ER
Sbjct: 191 RLPAPKSPGGEKAPLKALLVDSWYDTYLGVMVLVRVIDGVLTKGQTIRMMGTDAKYTIER 250

Query: 246 IGILTPKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVVF 305
           +G+LTPKM++++AL PGEIG + ASIKEV+ TRVGDTIT+D  PT  ALPGFKP QPVVF
Sbjct: 251 VGVLTPKMVNMDALGPGEIGFITASIKEVADTRVGDTITEDKRPTDKALPGFKPAQPVVF 310

Query: 306 CGLFPVDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERLE 365
           CGLFPVDA  FE+LR+A+ KLRLNDASFSFE+E+S ALGFGFRCGFLGLLHLEIIQERLE
Sbjct: 311 CGLFPVDAADFEDLRSAMGKLRLNDASFSFEMESSAALGFGFRCGFLGLLHLEIIQERLE 370

Query: 366 REFSLNLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEYLG 425
           REF L+LI T+PSVVY+L+M DGS ++L NP DMP+V KI+E+ EPWI+ TI+TP++YLG
Sbjct: 371 REFDLDLIATAPSVVYKLFMTDGSERELHNPADMPDVVKISEIHEPWIRATILTPDDYLG 430

Query: 426 SILKLCQERRGIQIDMSHLDNRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDYR 485
            ILKLCQ+RRGIQI+++++  RAM+ Y+LPLNEV+FDFYDRLKS+SKGYASFDY + D++
Sbjct: 431 GILKLCQDRRGIQIELTYVGTRAMLTYDLPLNEVVFDFYDRLKSISKGYASFDYQITDHK 490

Query: 486 DSDLVKLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGGRI 545
           + +LVK++ILVN E +DALS++VHR  +EKRGR +CEKLK LIP+ MF+I IQAAIGG +
Sbjct: 491 EGNLVKMSILVNGEPVDALSMMVHRMAAEKRGREMCEKLKELIPKHMFKIPIQAAIGGNV 550

Query: 546 IARETVKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISILKTDN 605
           IARET+ A RKDVTAKCYGGD TRKRKLLEKQK GKKRMR+FG+V+IPQ AFI+ LK  +
Sbjct: 551 IARETISALRKDVTAKCYGGDATRKRKLLEKQKAGKKRMRQFGKVEIPQEAFIAALKMGD 610

Query: 606 E 606
           E
Sbjct: 611 E 611


>gi|86355906|ref|YP_467798.1| GTP-binding protein LepA [Rhizobium etli CFN 42]
 gi|119371381|sp|Q2KDL5|LEPA_RHIEC RecName: Full=Elongation factor 4; Short=EF-4; AltName:
           Full=Ribosomal back-translocase LepA
 gi|86280008|gb|ABC89071.1| GTP-binding elongation factor protein [Rhizobium etli CFN 42]
          Length = 610

 Score =  956 bits (2472), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 446/601 (74%), Positives = 526/601 (87%)

Query: 6   TPLSRIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQT 65
           TPLS IRNFSIVAHIDHGKSTLADR IQ   GL EREMS QVLDNM+IERERGITIKAQT
Sbjct: 10  TPLSHIRNFSIVAHIDHGKSTLADRLIQTTGGLAEREMSEQVLDNMEIERERGITIKAQT 69

Query: 66  VRLNYTSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQ 125
           VRL+Y + + + Y LNLIDTPGHVDF YEVSRSLSACEGSLLVVDA+QGVEAQTLANVYQ
Sbjct: 70  VRLHYQANNGEKYVLNLIDTPGHVDFAYEVSRSLSACEGSLLVVDASQGVEAQTLANVYQ 129

Query: 126 AIDNNHEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERIVQ 185
           AIDNNHE++TVLNK DLP+A+PDR+K+QIEE IGI   +A+L+SAKTG GIP +LE IV 
Sbjct: 130 AIDNNHELVTVLNKIDLPAAEPDRIKEQIEEVIGIDASEAVLISAKTGLGIPDVLEAIVH 189

Query: 186 QLPSPTSPEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVER 245
           +LP+P S  G  APLKALL+DSWY++YLGVMVLVRII+G LTKGQ+IR+MGT+AKYQVER
Sbjct: 190 KLPAPKSAGGEKAPLKALLVDSWYDTYLGVMVLVRIIDGVLTKGQTIRMMGTDAKYQVER 249

Query: 246 IGILTPKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVVF 305
           +G+LTPKM+++++L PGEIG + ASIKEV+ TRVGDTIT+D  PT  ALPGFKP QPVVF
Sbjct: 250 VGVLTPKMVNVDSLGPGEIGFITASIKEVADTRVGDTITEDKRPTAEALPGFKPAQPVVF 309

Query: 306 CGLFPVDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERLE 365
           CGLFPVDA  FE+LR A+ KLRLNDASFSFE+E+S ALGFGFRCGFLGLLHLEIIQERLE
Sbjct: 310 CGLFPVDAADFEDLRAAMGKLRLNDASFSFEMESSAALGFGFRCGFLGLLHLEIIQERLE 369

Query: 366 REFSLNLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEYLG 425
           REF L+LI T+PSVVY+L M DGS ++L NP DMP+V KIAE+REPWI+ TI+TP++YLG
Sbjct: 370 REFDLDLIATAPSVVYQLTMTDGSERELHNPADMPDVVKIAEIREPWIKATIMTPDDYLG 429

Query: 426 SILKLCQERRGIQIDMSHLDNRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDYR 485
            ILKLCQ+RRGIQ +++++  RAM+ YELPLNEV+FDFYDRLKS+SKGYASFDY++  YR
Sbjct: 430 GILKLCQDRRGIQTELTYVGTRAMVTYELPLNEVVFDFYDRLKSISKGYASFDYHLEGYR 489

Query: 486 DSDLVKLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGGRI 545
             +LVK++ILVN E +DALS+LVHR+ +EKRGR +CE+LK LIP+ MF+I IQAAIGG +
Sbjct: 490 AGNLVKMSILVNGEPVDALSMLVHRTAAEKRGRDMCERLKELIPKHMFKIPIQAAIGGNV 549

Query: 546 IARETVKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISILKTDN 605
           IARET+ A RKDVTAKCYGGD TRKRKLL+KQKEGKKRMR+FG+V+IPQ AFI+ LK  +
Sbjct: 550 IARETISALRKDVTAKCYGGDATRKRKLLDKQKEGKKRMRQFGKVEIPQEAFIAALKMGD 609

Query: 606 E 606
           E
Sbjct: 610 E 610


>gi|15964022|ref|NP_384375.1| GTP-binding protein LepA [Sinorhizobium meliloti 1021]
 gi|307301168|ref|ZP_07580930.1| GTP-binding protein LepA [Sinorhizobium meliloti BL225C]
 gi|307321069|ref|ZP_07600474.1| GTP-binding protein LepA [Sinorhizobium meliloti AK83]
 gi|24211926|sp|Q92SU3|LEPA_RHIME RecName: Full=Elongation factor 4; Short=EF-4; AltName:
           Full=Ribosomal back-translocase LepA
 gi|15073198|emb|CAC41706.1| Probable GTP-binding protein membrane [Sinorhizobium meliloti 1021]
 gi|306893241|gb|EFN24022.1| GTP-binding protein LepA [Sinorhizobium meliloti AK83]
 gi|306903624|gb|EFN34211.1| GTP-binding protein LepA [Sinorhizobium meliloti BL225C]
          Length = 608

 Score =  956 bits (2472), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 444/601 (73%), Positives = 524/601 (87%)

Query: 6   TPLSRIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQT 65
           TPLS IRNFSIVAHIDHGKSTLADR IQ   GL EREMS QVLD+MDIERERGITIKAQT
Sbjct: 8   TPLSHIRNFSIVAHIDHGKSTLADRLIQSTGGLAEREMSEQVLDSMDIERERGITIKAQT 67

Query: 66  VRLNYTSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQ 125
           VRL+Y + D + Y LNLIDTPGHVDF YEVSRSLSACEGSLLVVDA+QGVEAQTLANVYQ
Sbjct: 68  VRLHYKANDGETYVLNLIDTPGHVDFAYEVSRSLSACEGSLLVVDASQGVEAQTLANVYQ 127

Query: 126 AIDNNHEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERIVQ 185
           AIDNNHE++TVLNK DLP+A+P+R+K+QIEE IGI   DA+L+SAKTG GIP +LE IV 
Sbjct: 128 AIDNNHELVTVLNKIDLPAAEPERIKEQIEEVIGIDASDAVLISAKTGLGIPDVLEAIVH 187

Query: 186 QLPSPTSPEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVER 245
           +LP+P S  G  APLKALL+DSWY++YLGVMVLVR+I+G L KG +IR+MGT+AKYQVER
Sbjct: 188 KLPAPKSEGGDTAPLKALLVDSWYDAYLGVMVLVRVIDGTLKKGMTIRMMGTDAKYQVER 247

Query: 246 IGILTPKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVVF 305
           +G+LTPKM+ +EAL PGEIG + ASIKEV+ TRVGDTIT+D  PT  ALPGFKP QPVVF
Sbjct: 248 VGVLTPKMVAMEALGPGEIGFITASIKEVADTRVGDTITEDKRPTAKALPGFKPAQPVVF 307

Query: 306 CGLFPVDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERLE 365
           CGLFPVDA  FE+LR+A+ KLRLNDASFSFE+E+S ALGFGFRCGFLGLLHLEIIQERLE
Sbjct: 308 CGLFPVDAADFEDLRSAMGKLRLNDASFSFEMESSAALGFGFRCGFLGLLHLEIIQERLE 367

Query: 366 REFSLNLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEYLG 425
           REF L+LI T+PSVVY+L+M DGS ++L NP DMP+V KIAE+ EPWI+ TI+TP+EYLG
Sbjct: 368 REFDLDLIATAPSVVYKLFMTDGSERELHNPADMPDVVKIAEIHEPWIRATILTPDEYLG 427

Query: 426 SILKLCQERRGIQIDMSHLDNRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDYR 485
            ILKLCQ+RRGIQI+++++  RAM+ Y+LPLNEV+FDFYDRLKS+SKGYASFDY + +++
Sbjct: 428 GILKLCQDRRGIQIELTYVGTRAMLTYDLPLNEVVFDFYDRLKSISKGYASFDYQITEHK 487

Query: 486 DSDLVKLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGGRI 545
           + +LVK++ILVN E +DALS++VHR  +EKRGR +CEKLK LIP+ MF+I IQAAIGG +
Sbjct: 488 EGNLVKMSILVNGEPVDALSMMVHRMAAEKRGREMCEKLKELIPKHMFKIPIQAAIGGNV 547

Query: 546 IARETVKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISILKTDN 605
           IARET+ A RKDVTAKCYGGD TRKRKLLEKQK GKKRMR+FG+V+IPQ AFI+ LK  +
Sbjct: 548 IARETISALRKDVTAKCYGGDATRKRKLLEKQKAGKKRMRQFGKVEIPQEAFIAALKMSD 607

Query: 606 E 606
           E
Sbjct: 608 E 608


>gi|150398655|ref|YP_001329122.1| GTP-binding protein LepA [Sinorhizobium medicae WSM419]
 gi|150030170|gb|ABR62287.1| GTP-binding protein LepA [Sinorhizobium medicae WSM419]
          Length = 611

 Score =  952 bits (2460), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 442/601 (73%), Positives = 524/601 (87%)

Query: 6   TPLSRIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQT 65
           TPLS IRNFSIVAHIDHGKSTLADR IQ   GL EREMS QVLD+MDIERERGITIKAQT
Sbjct: 11  TPLSHIRNFSIVAHIDHGKSTLADRLIQSTGGLAEREMSEQVLDSMDIERERGITIKAQT 70

Query: 66  VRLNYTSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQ 125
           VRL+Y + + + Y LNLIDTPGHVDF YEVSRSLSACEGSLLVVDA+QGVEAQTLANVYQ
Sbjct: 71  VRLHYKANNGETYVLNLIDTPGHVDFAYEVSRSLSACEGSLLVVDASQGVEAQTLANVYQ 130

Query: 126 AIDNNHEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERIVQ 185
           AIDNNHE++TVLNK DLP+A+PDR+K+QIEE IGI   +A+L+SAKTG GIP +LE IV 
Sbjct: 131 AIDNNHELVTVLNKIDLPAAEPDRIKEQIEEVIGIDASEAVLISAKTGLGIPDVLEAIVH 190

Query: 186 QLPSPTSPEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVER 245
           +LP+P S  G  APLKALL+DSWY++YLGVMVLVRII+G L KG +IR+MGT+AKYQVER
Sbjct: 191 KLPAPKSEGGDTAPLKALLVDSWYDTYLGVMVLVRIIDGTLKKGMTIRMMGTDAKYQVER 250

Query: 246 IGILTPKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVVF 305
           +G+LTPKM+ +++L PGEIG + ASIKEV+ TRVGDTIT+D  PT  ALPGFKP QPVVF
Sbjct: 251 VGVLTPKMVAMDSLGPGEIGFITASIKEVADTRVGDTITEDKRPTAKALPGFKPAQPVVF 310

Query: 306 CGLFPVDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERLE 365
           CGLFPVDA  FE+LR+A+ KLRLNDASFSFE+E+S ALGFGFRCGFLGLLHLEIIQERLE
Sbjct: 311 CGLFPVDAADFEDLRSAMGKLRLNDASFSFEMESSAALGFGFRCGFLGLLHLEIIQERLE 370

Query: 366 REFSLNLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEYLG 425
           REF L+LI T+PSVVY+L+M DGS ++L NP DMP+V KIAE+ EPWI+ TI+TP+EYLG
Sbjct: 371 REFDLDLIATAPSVVYKLFMTDGSERELHNPADMPDVVKIAEIHEPWIRATILTPDEYLG 430

Query: 426 SILKLCQERRGIQIDMSHLDNRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDYR 485
            ILKLCQ+RRGIQI+++++  RAM+ Y+LPLNEV+FDFYDRLKS+SKGYASFDY + +++
Sbjct: 431 GILKLCQDRRGIQIELTYVGTRAMLTYDLPLNEVVFDFYDRLKSISKGYASFDYQITEHK 490

Query: 486 DSDLVKLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGGRI 545
           + +LVK++ILVN E +DALS++VHR  +EKRGR +CEKLK LIP+ MF+I IQAAIGG +
Sbjct: 491 EGNLVKMSILVNGEPVDALSMMVHRMAAEKRGREMCEKLKELIPKHMFKIPIQAAIGGNV 550

Query: 546 IARETVKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISILKTDN 605
           IARET+ A RKDVTAKCYGGD TRKRKLLEKQK GKKRMR+FG+V+IPQ AFI+ LK  +
Sbjct: 551 IARETISALRKDVTAKCYGGDATRKRKLLEKQKAGKKRMRQFGKVEIPQEAFIAALKMSD 610

Query: 606 E 606
           E
Sbjct: 611 E 611


>gi|218663326|ref|ZP_03519256.1| GTP-binding protein LepA [Rhizobium etli IE4771]
          Length = 607

 Score =  941 bits (2431), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 435/585 (74%), Positives = 516/585 (88%)

Query: 6   TPLSRIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQT 65
           TPLS IRNFSIVAHIDHGKSTLADR IQ   GL EREMS QVLDNMDIERERGITIKAQT
Sbjct: 7   TPLSHIRNFSIVAHIDHGKSTLADRLIQTTGGLAEREMSEQVLDNMDIERERGITIKAQT 66

Query: 66  VRLNYTSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQ 125
           VRL+Y + + + Y LNLIDTPGHVDF YEVSRSLSACEGSLLVVDA+QGVEAQTLANVYQ
Sbjct: 67  VRLHYQADNGEKYILNLIDTPGHVDFAYEVSRSLSACEGSLLVVDASQGVEAQTLANVYQ 126

Query: 126 AIDNNHEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERIVQ 185
           AIDNNHE++TVLNK DLP+A+PDR+K+QIEE IGI   +A+L+SAKTG GIP +LE IV 
Sbjct: 127 AIDNNHELVTVLNKIDLPAAEPDRIKEQIEEVIGIDASEAVLISAKTGLGIPDVLEAIVH 186

Query: 186 QLPSPTSPEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVER 245
           +LP+P SP G  APLKALL+DSWY++YLGVMVLVRII+G LTKGQ+IR+MGT+AKYQVER
Sbjct: 187 KLPAPKSPGGEKAPLKALLVDSWYDTYLGVMVLVRIIDGVLTKGQTIRMMGTDAKYQVER 246

Query: 246 IGILTPKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVVF 305
           +G+LTPKM+++++L PGEIG + ASIKEV+ TRVGDTIT+D  PT  ALPGFKP QPVVF
Sbjct: 247 VGVLTPKMVNVDSLGPGEIGFITASIKEVADTRVGDTITEDKRPTAQALPGFKPAQPVVF 306

Query: 306 CGLFPVDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERLE 365
           CGLFPVDA  FE+LR A+ KLRLNDASFSFE+E+S ALGFGFRCGFLGLLHLEIIQERLE
Sbjct: 307 CGLFPVDAADFEDLRAAMGKLRLNDASFSFEMESSAALGFGFRCGFLGLLHLEIIQERLE 366

Query: 366 REFSLNLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEYLG 425
           REF L+LI T+PSVVY++YM DG+ ++L NP DMP+V KI+E+ EPWI+ TI+TP++YLG
Sbjct: 367 REFDLDLIATAPSVVYKMYMTDGTERELHNPADMPDVVKISEIHEPWIRATILTPDDYLG 426

Query: 426 SILKLCQERRGIQIDMSHLDNRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDYR 485
            ILKLCQ+RRGIQI+++++  RAM+ Y+LPLNEV+FDFYDRLKS+SKGYASFDY + D+R
Sbjct: 427 GILKLCQDRRGIQIELTYVGTRAMLTYDLPLNEVVFDFYDRLKSISKGYASFDYTLTDHR 486

Query: 486 DSDLVKLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGGRI 545
           + +LVK++ILVN E +DALS++VHR+ +EKRGR +CEKLK LIP+ MF+I IQAAIGG +
Sbjct: 487 EGNLVKMSILVNGEPVDALSMMVHRTAAEKRGRDMCEKLKELIPKHMFKIPIQAAIGGNV 546

Query: 546 IARETVKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRV 590
           IARET+ A RKDVTAKCYGGD TRKRKLL+KQK GKKRMR+FG+V
Sbjct: 547 IARETISALRKDVTAKCYGGDATRKRKLLDKQKAGKKRMRQFGKV 591


>gi|222147113|ref|YP_002548070.1| GTP-binding protein LepA [Agrobacterium vitis S4]
 gi|221734103|gb|ACM35066.1| GTP-binding protein LepA [Agrobacterium vitis S4]
          Length = 625

 Score =  938 bits (2425), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 435/601 (72%), Positives = 521/601 (86%)

Query: 6   TPLSRIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQT 65
           TPL  IRNFSIVAHIDHGKSTLADR IQ+  GL EREMS QVLD+MDIERERGITIKAQT
Sbjct: 25  TPLDHIRNFSIVAHIDHGKSTLADRLIQNTGGLAEREMSEQVLDSMDIERERGITIKAQT 84

Query: 66  VRLNYTSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQ 125
           VRL+Y + + + Y LNLIDTPGHVDF YEVSRSLSACEGSLLVVDA+QGVEAQTLANVYQ
Sbjct: 85  VRLHYKANNGETYVLNLIDTPGHVDFAYEVSRSLSACEGSLLVVDASQGVEAQTLANVYQ 144

Query: 126 AIDNNHEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERIVQ 185
           AIDNNHEI+TVLNK DLP+A+PDR+K+QIEE IGI   +A+L+SAKTG GIP +LE IV 
Sbjct: 145 AIDNNHEIVTVLNKIDLPAAEPDRIKEQIEEVIGIDASEAVLISAKTGLGIPDVLEAIVH 204

Query: 186 QLPSPTSPEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVER 245
           +LP+P S  G   PLKALL+DSWY++YLGVMVLVR+I+G LTKGQ+IR+MGT+AKYQVER
Sbjct: 205 KLPAPKSALGDKGPLKALLVDSWYDTYLGVMVLVRVIDGVLTKGQTIRMMGTDAKYQVER 264

Query: 246 IGILTPKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVVF 305
           +G+LTPKM+ +++L PGEIG    SIKEV+ TRVGDTIT+D  PT + LPGFKP QPVVF
Sbjct: 265 VGVLTPKMVAMDSLGPGEIGFFTGSIKEVADTRVGDTITEDKRPTETMLPGFKPAQPVVF 324

Query: 306 CGLFPVDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERLE 365
           CGLFPVDA  FE+LR A+ KLRLNDASFSFE+E+S ALGFGFRCGFLGLLHLEIIQERLE
Sbjct: 325 CGLFPVDAADFEDLRAAMGKLRLNDASFSFEMESSAALGFGFRCGFLGLLHLEIIQERLE 384

Query: 366 REFSLNLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEYLG 425
           REF L+LI T+PSVVY+L+M DGS ++L NP DMP+V KI+E+ EPWI+ TI+TP++YLG
Sbjct: 385 REFDLDLIATAPSVVYKLFMTDGSERELHNPADMPDVVKISEIHEPWIKATILTPDDYLG 444

Query: 426 SILKLCQERRGIQIDMSHLDNRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDYR 485
            ILKLCQ+RRGIQ +++++  RAM+ YELPLNEV+FDFYDRLKS+SKGYASFDY++  ++
Sbjct: 445 GILKLCQDRRGIQTELTYVGKRAMLTYELPLNEVVFDFYDRLKSISKGYASFDYHLDGHK 504

Query: 486 DSDLVKLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGGRI 545
           + +LVK++ILVN E +DALS++VHR  +EKRGR +CEKLK+LIP+ MF+I IQAAIG  +
Sbjct: 505 EGNLVKMSILVNGEPVDALSMMVHRMAAEKRGRDMCEKLKDLIPKHMFKIPIQAAIGSNV 564

Query: 546 IARETVKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISILKTDN 605
           IARET+ A RKDVTAKCYGGD +RKRKLL+KQK GKKRMR+FG+V+IPQ AFI+ LK  +
Sbjct: 565 IARETISALRKDVTAKCYGGDASRKRKLLDKQKAGKKRMRQFGKVEIPQEAFIAALKMSD 624

Query: 606 E 606
           E
Sbjct: 625 E 625


>gi|294853992|ref|ZP_06794664.1| GTP-binding protein LepA [Brucella sp. NVSL 07-0026]
 gi|294819647|gb|EFG36647.1| GTP-binding protein LepA [Brucella sp. NVSL 07-0026]
          Length = 602

 Score =  931 bits (2407), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 440/601 (73%), Positives = 515/601 (85%), Gaps = 1/601 (0%)

Query: 6   TPLSRIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQT 65
           TPL  IRNFSIVAHIDHGKSTLADR IQ   GL  REM  QVLD+MDIERERGITIKAQT
Sbjct: 3   TPLDHIRNFSIVAHIDHGKSTLADRLIQLTGGLDTREMKDQVLDSMDIERERGITIKAQT 62

Query: 66  VRLNYTSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQ 125
           VRL+Y + + +DY LNLIDTPGHVDF YEVSRSL+ACEGSLLVVDA+QGVEAQTLANVYQ
Sbjct: 63  VRLSYKAKNGEDYVLNLIDTPGHVDFAYEVSRSLAACEGSLLVVDASQGVEAQTLANVYQ 122

Query: 126 AIDNNHEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERIVQ 185
           AIDNNHEI+ VLNK DLP+A+P+RVK+QIEE IGI   DA+ +SAKTG GI  +LE IV 
Sbjct: 123 AIDNNHEIVVVLNKIDLPAAEPERVKQQIEEVIGIDASDAVEISAKTGLGIEDVLEAIVN 182

Query: 186 QLPSPTSPEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVER 245
           +LP+P   +  NAPLKA+L+DSWY+SYLGV+VLVR+I+G L KGQ+IR+MGT AKY VER
Sbjct: 183 KLPAPKEGD-RNAPLKAMLVDSWYDSYLGVIVLVRVIDGVLKKGQTIRMMGTGAKYPVER 241

Query: 246 IGILTPKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVVF 305
            G+ TPKM+ ++ L PGE+G + ASIKEV+ TRVGDTIT+D  PT + L GFKP QPVVF
Sbjct: 242 TGVFTPKMVQVDDLGPGELGFITASIKEVADTRVGDTITEDRRPTENMLSGFKPAQPVVF 301

Query: 306 CGLFPVDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERLE 365
           CGLFPVDA  FE+LR A+ KLRLNDASFSFE+E S ALGFGFRCGFLGLLHLEIIQERLE
Sbjct: 302 CGLFPVDAADFEDLRGAMGKLRLNDASFSFEMETSAALGFGFRCGFLGLLHLEIIQERLE 361

Query: 366 REFSLNLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEYLG 425
           REF+LNLI T+PSVVY L M DG+ ++L NP DMP+V KIA + EPWI+ TI+TP++YLG
Sbjct: 362 REFNLNLITTAPSVVYRLNMTDGTHKELHNPADMPDVVKIASIEEPWIKATIMTPDDYLG 421

Query: 426 SILKLCQERRGIQIDMSHLDNRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDYR 485
           +I+KLCQERRGIQID++++  RAMI Y+LPLNEV+FDFYDRLKS+SKGYASFDYN+ DYR
Sbjct: 422 AIMKLCQERRGIQIDLTYVGPRAMITYDLPLNEVVFDFYDRLKSISKGYASFDYNLSDYR 481

Query: 486 DSDLVKLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGGRI 545
           + DLVK++ILVN E +DALS+LVHRS +EKRGR +CEKLK LIPQ MF+I IQAAIGGRI
Sbjct: 482 EGDLVKMSILVNEEPVDALSMLVHRSAAEKRGRALCEKLKELIPQHMFKIPIQAAIGGRI 541

Query: 546 IARETVKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISILKTDN 605
           +ARET+ A RKDVTAKCYGGD+TRKRKLLEKQKEGKKRMR+FG+V+IPQ AFI  LK  +
Sbjct: 542 VARETISALRKDVTAKCYGGDVTRKRKLLEKQKEGKKRMRQFGKVEIPQEAFIQALKMGD 601

Query: 606 E 606
           +
Sbjct: 602 D 602


>gi|328545341|ref|YP_004305450.1| GTP-binding protein lepA [polymorphum gilvum SL003B-26A1]
 gi|326415083|gb|ADZ72146.1| GTP-binding protein lepA [Polymorphum gilvum SL003B-26A1]
          Length = 601

 Score =  930 bits (2403), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 433/598 (72%), Positives = 513/598 (85%), Gaps = 2/598 (0%)

Query: 7   PLSRIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTV 66
           P+S IRNFSIVAHIDHGKSTLADR IQ    LT+REM+ QVLD+MDIERERGITIKAQTV
Sbjct: 5   PISNIRNFSIVAHIDHGKSTLADRLIQMTGTLTDREMTEQVLDSMDIERERGITIKAQTV 64

Query: 67  RLNYTSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQA 126
           RL Y + D K Y LNLIDTPGHVDF YEVSRSL+ACEGSLLVVDA+QGVEAQTLANVYQA
Sbjct: 65  RLVYNARDGKQYILNLIDTPGHVDFAYEVSRSLAACEGSLLVVDASQGVEAQTLANVYQA 124

Query: 127 IDNNHEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERIVQQ 186
           IDN+HEI+TVLNK DLP+A+PDRVK+QIEE IGI   +A+++SAKTG G+  +LE IV +
Sbjct: 125 IDNDHEIVTVLNKIDLPAAEPDRVKEQIEEVIGIDASEAVMISAKTGLGVDEVLEAIVNK 184

Query: 187 LPSPTSPEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVERI 246
           LP+PT     + PLKA+L+DSWY+ YLGVMVLVRII+G L +GQ IR+MGTNA Y+V+R+
Sbjct: 185 LPAPTGDR--DGPLKAMLVDSWYDPYLGVMVLVRIIDGTLKRGQRIRMMGTNAAYEVDRV 242

Query: 247 GILTPKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVVFC 306
           G++TPK + ++ L PGEIGV+ ASIKEV+ TRVGDTITD+  P   ALPGFKP QPVVFC
Sbjct: 243 GVMTPKFLQVDQLGPGEIGVLTASIKEVADTRVGDTITDERKPCAEALPGFKPAQPVVFC 302

Query: 307 GLFPVDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERLER 366
           GLFPVDA  FE+LR A+ KLRLNDASFSFE+E S ALGFGFRCGFLGLLHLEIIQERL R
Sbjct: 303 GLFPVDAADFEDLRAAVGKLRLNDASFSFEMETSAALGFGFRCGFLGLLHLEIIQERLSR 362

Query: 367 EFSLNLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEYLGS 426
           EF L+LI T+PSVVY++ M DG+ ++L NP DMP+V KI E+REPWI+  I+TP+EYLGS
Sbjct: 363 EFDLDLIATAPSVVYQMTMTDGTERELHNPADMPDVVKIKEIREPWIRANIMTPDEYLGS 422

Query: 427 ILKLCQERRGIQIDMSHLDNRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDYRD 486
           ILKLCQERRG+Q+D++++ +RAM+ Y+LPLNEV+FDFYDRLKS+SKGYASFDY + DYR+
Sbjct: 423 ILKLCQERRGVQVDLAYVGSRAMVTYDLPLNEVVFDFYDRLKSISKGYASFDYTLSDYRE 482

Query: 487 SDLVKLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGGRII 546
            DLVK++ILVN E +DALS+LVHRS +E+RGR +CEKLK LIP+ MF+I IQAAIG R+I
Sbjct: 483 GDLVKMSILVNEEPVDALSVLVHRSQAERRGRAMCEKLKELIPRHMFKIPIQAAIGARVI 542

Query: 547 ARETVKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISILKTD 604
           ARET+ A RKDVTAKCYGGD TRKRKLLEKQKEGKKRMR+FG+V+IPQ AFI  LK D
Sbjct: 543 ARETLAALRKDVTAKCYGGDATRKRKLLEKQKEGKKRMRQFGKVEIPQEAFIKALKMD 600


>gi|23500761|ref|NP_700201.1| GTP-binding protein LepA [Brucella suis 1330]
 gi|148558176|ref|YP_001257949.1| GTP-binding protein LepA [Brucella ovis ATCC 25840]
 gi|161621087|ref|YP_001594973.1| GTP-binding protein LepA [Brucella canis ATCC 23365]
 gi|163845152|ref|YP_001622807.1| GTP-binding protein LepA [Brucella suis ATCC 23445]
 gi|254703355|ref|ZP_05165183.1| GTP-binding protein LepA [Brucella suis bv. 3 str. 686]
 gi|254710736|ref|ZP_05172547.1| GTP-binding protein LepA [Brucella pinnipedialis B2/94]
 gi|256015798|ref|YP_003105807.1| GTP-binding protein LepA [Brucella microti CCM 4915]
 gi|256029118|ref|ZP_05442732.1| GTP-binding protein LepA [Brucella pinnipedialis M292/94/1]
 gi|256058801|ref|ZP_05449017.1| GTP-binding protein LepA [Brucella neotomae 5K33]
 gi|256157311|ref|ZP_05455229.1| GTP-binding protein LepA [Brucella ceti M490/95/1]
 gi|256253712|ref|ZP_05459248.1| GTP-binding protein LepA [Brucella ceti B1/94]
 gi|260167790|ref|ZP_05754601.1| GTP-binding protein LepA [Brucella sp. F5/99]
 gi|260567716|ref|ZP_05838185.1| GTP-binding protein lepA [Brucella suis bv. 4 str. 40]
 gi|261220848|ref|ZP_05935129.1| GTP-binding protein lepA [Brucella ceti B1/94]
 gi|261318304|ref|ZP_05957501.1| GTP-binding protein lepA [Brucella pinnipedialis B2/94]
 gi|261322739|ref|ZP_05961936.1| GTP-binding protein lepA [Brucella neotomae 5K33]
 gi|261753983|ref|ZP_05997692.1| GTP-binding protein lepA [Brucella suis bv. 3 str. 686]
 gi|261757226|ref|ZP_06000935.1| GTP-binding protein lepA [Brucella sp. F5/99]
 gi|265986102|ref|ZP_06098659.1| GTP-binding protein lepA [Brucella pinnipedialis M292/94/1]
 gi|265995796|ref|ZP_06108353.1| GTP-binding protein lepA [Brucella ceti M490/95/1]
 gi|306840222|ref|ZP_07472997.1| GTP-binding protein LepA [Brucella sp. BO2]
 gi|306846240|ref|ZP_07478802.1| GTP-binding protein LepA [Brucella sp. BO1]
 gi|33112376|sp|Q8FV17|LEPA_BRUSU RecName: Full=Elongation factor 4; Short=EF-4; AltName:
           Full=Ribosomal back-translocase LepA
 gi|166223171|sp|A5VVU4|LEPA_BRUO2 RecName: Full=Elongation factor 4; Short=EF-4; AltName:
           Full=Ribosomal back-translocase LepA
 gi|189046430|sp|A9MCW5|LEPA_BRUC2 RecName: Full=Elongation factor 4; Short=EF-4; AltName:
           Full=Ribosomal back-translocase LepA
 gi|189046431|sp|A9WW49|LEPA_BRUSI RecName: Full=Elongation factor 4; Short=EF-4; AltName:
           Full=Ribosomal back-translocase LepA
 gi|23464416|gb|AAN34206.1| GTP-binding protein LepA [Brucella suis 1330]
 gi|148369461|gb|ABQ62333.1| GTP-binding protein LepA [Brucella ovis ATCC 25840]
 gi|161337898|gb|ABX64202.1| GTP-binding protein LepA [Brucella canis ATCC 23365]
 gi|163675875|gb|ABY39985.1| GTP-binding protein LepA [Brucella suis ATCC 23445]
 gi|255998458|gb|ACU50145.1| GTP-binding protein LepA [Brucella microti CCM 4915]
 gi|260154381|gb|EEW89462.1| GTP-binding protein lepA [Brucella suis bv. 4 str. 40]
 gi|260919432|gb|EEX86085.1| GTP-binding protein lepA [Brucella ceti B1/94]
 gi|261297527|gb|EEY01024.1| GTP-binding protein lepA [Brucella pinnipedialis B2/94]
 gi|261298719|gb|EEY02216.1| GTP-binding protein lepA [Brucella neotomae 5K33]
 gi|261737210|gb|EEY25206.1| GTP-binding protein lepA [Brucella sp. F5/99]
 gi|261743736|gb|EEY31662.1| GTP-binding protein lepA [Brucella suis bv. 3 str. 686]
 gi|262550093|gb|EEZ06254.1| GTP-binding protein lepA [Brucella ceti M490/95/1]
 gi|264658299|gb|EEZ28560.1| GTP-binding protein lepA [Brucella pinnipedialis M292/94/1]
 gi|306273491|gb|EFM55352.1| GTP-binding protein LepA [Brucella sp. BO1]
 gi|306289827|gb|EFM61006.1| GTP-binding protein LepA [Brucella sp. BO2]
          Length = 602

 Score =  930 bits (2403), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 439/601 (73%), Positives = 515/601 (85%), Gaps = 1/601 (0%)

Query: 6   TPLSRIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQT 65
           TPL  IRNFSIVAHIDHGKSTLADR IQ   GL  REM  QVLD+MDIERERGITIKAQT
Sbjct: 3   TPLDHIRNFSIVAHIDHGKSTLADRLIQLTGGLDTREMKDQVLDSMDIERERGITIKAQT 62

Query: 66  VRLNYTSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQ 125
           VRL+Y + + +DY LNLIDTPGHVDF YEVSRSL+ACEGSLLVVDA+QGVEAQTLANVYQ
Sbjct: 63  VRLSYKAKNGEDYVLNLIDTPGHVDFAYEVSRSLAACEGSLLVVDASQGVEAQTLANVYQ 122

Query: 126 AIDNNHEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERIVQ 185
           AIDNNHEI+ VLNK DLP+A+P+RVK+QIEE IGI   DA+ +SAKTG GI  +LE IV 
Sbjct: 123 AIDNNHEIVVVLNKIDLPAAEPERVKQQIEEVIGIDASDAVEISAKTGLGIEDVLEAIVN 182

Query: 186 QLPSPTSPEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVER 245
           +LP+P   +  NAPLKA+L+DSWY+SYLGV+VLVR+I+G L KGQ+IR+MGT AKY VER
Sbjct: 183 KLPAPKEGD-RNAPLKAMLVDSWYDSYLGVIVLVRVIDGVLKKGQTIRMMGTGAKYPVER 241

Query: 246 IGILTPKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVVF 305
            G+ TPKM+ ++ L PGE+G + ASIKEV+ TRVGDTIT+D  PT + L GFKP QPVVF
Sbjct: 242 TGVFTPKMVQVDDLGPGELGFITASIKEVADTRVGDTITEDRRPTENMLSGFKPAQPVVF 301

Query: 306 CGLFPVDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERLE 365
           CGLFPVDA  FE+LR A+ KLRLNDASFSFE+E S ALGFGFRCGFLGLLHLEIIQERLE
Sbjct: 302 CGLFPVDAADFEDLRGAMGKLRLNDASFSFEMETSAALGFGFRCGFLGLLHLEIIQERLE 361

Query: 366 REFSLNLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEYLG 425
           REF+L+LI T+PSVVY L M DG+ ++L NP DMP+V KIA + EPWI+ TI+TP++YLG
Sbjct: 362 REFNLDLITTAPSVVYRLNMTDGTHKELHNPADMPDVVKIASIEEPWIKATIMTPDDYLG 421

Query: 426 SILKLCQERRGIQIDMSHLDNRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDYR 485
           +I+KLCQERRGIQID++++  RAMI Y+LPLNEV+FDFYDRLKS+SKGYASFDYN+ DYR
Sbjct: 422 AIMKLCQERRGIQIDLTYVGPRAMITYDLPLNEVVFDFYDRLKSISKGYASFDYNLSDYR 481

Query: 486 DSDLVKLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGGRI 545
           + DLVK++ILVN E +DALS+LVHRS +EKRGR +CEKLK LIPQ MF+I IQAAIGGRI
Sbjct: 482 EGDLVKMSILVNEEPVDALSMLVHRSAAEKRGRALCEKLKELIPQHMFKIPIQAAIGGRI 541

Query: 546 IARETVKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISILKTDN 605
           +ARET+ A RKDVTAKCYGGD+TRKRKLLEKQKEGKKRMR+FG+V+IPQ AFI  LK  +
Sbjct: 542 VARETISALRKDVTAKCYGGDVTRKRKLLEKQKEGKKRMRQFGKVEIPQEAFIQALKMGD 601

Query: 606 E 606
           +
Sbjct: 602 D 602


>gi|254712794|ref|ZP_05174605.1| GTP-binding protein LepA [Brucella ceti M644/93/1]
 gi|254715863|ref|ZP_05177674.1| GTP-binding protein LepA [Brucella ceti M13/05/1]
 gi|261217624|ref|ZP_05931905.1| GTP-binding protein lepA [Brucella ceti M13/05/1]
 gi|261320501|ref|ZP_05959698.1| GTP-binding protein lepA [Brucella ceti M644/93/1]
 gi|260922713|gb|EEX89281.1| GTP-binding protein lepA [Brucella ceti M13/05/1]
 gi|261293191|gb|EEX96687.1| GTP-binding protein lepA [Brucella ceti M644/93/1]
          Length = 602

 Score =  929 bits (2402), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 439/601 (73%), Positives = 515/601 (85%), Gaps = 1/601 (0%)

Query: 6   TPLSRIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQT 65
           TPL  IRNFSIVAHIDHGKSTLADR IQ   GL  REM  QVLD+MDIERERGITIKAQT
Sbjct: 3   TPLDHIRNFSIVAHIDHGKSTLADRLIQLTGGLDTREMKDQVLDSMDIERERGITIKAQT 62

Query: 66  VRLNYTSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQ 125
           VRL+Y + + +DY LNLIDTPGHVDF YEVSRSL+ACEGSLLVVDA+QGVEAQTLANVYQ
Sbjct: 63  VRLSYKAKNGEDYVLNLIDTPGHVDFAYEVSRSLAACEGSLLVVDASQGVEAQTLANVYQ 122

Query: 126 AIDNNHEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERIVQ 185
           AIDNNHEI+ VLNK DLP+A+P+RVK+QIEE IGI   DA+ +SAKTG GI  +LE IV 
Sbjct: 123 AIDNNHEIVVVLNKIDLPAAEPERVKQQIEEVIGIDASDAVEISAKTGLGIEDVLEAIVN 182

Query: 186 QLPSPTSPEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVER 245
           +LP+P   +  NAPLKA+L+DSWY+SYLGV+VLVR+I+G L KGQ+IR+MGT AKY VER
Sbjct: 183 KLPAPKEGD-RNAPLKAMLVDSWYDSYLGVIVLVRVIDGVLKKGQTIRMMGTGAKYPVER 241

Query: 246 IGILTPKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVVF 305
            G+ TPKM+ ++ L PGE+G + ASIKEV+ TRVGDTIT+D  PT + L GFKP QPVVF
Sbjct: 242 TGVFTPKMVQVDDLGPGELGFITASIKEVADTRVGDTITEDRRPTENMLSGFKPAQPVVF 301

Query: 306 CGLFPVDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERLE 365
           CGLFPVDA  FE+LR A+ KLRLNDASFSFE+E S ALGFGFRCGFLGLLHLEIIQERLE
Sbjct: 302 CGLFPVDAADFEDLRGAMGKLRLNDASFSFEMETSAALGFGFRCGFLGLLHLEIIQERLE 361

Query: 366 REFSLNLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEYLG 425
           REF+L+LI T+PSVVY L M DG+ ++L NP DMP+V KIA + EPWI+ TI+TP++YLG
Sbjct: 362 REFNLDLITTAPSVVYRLDMTDGTHKELHNPADMPDVVKIASIEEPWIKATIMTPDDYLG 421

Query: 426 SILKLCQERRGIQIDMSHLDNRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDYR 485
           +I+KLCQERRGIQID++++  RAMI Y+LPLNEV+FDFYDRLKS+SKGYASFDYN+ DYR
Sbjct: 422 AIMKLCQERRGIQIDLTYVGPRAMITYDLPLNEVVFDFYDRLKSISKGYASFDYNLSDYR 481

Query: 486 DSDLVKLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGGRI 545
           + DLVK++ILVN E +DALS+LVHRS +EKRGR +CEKLK LIPQ MF+I IQAAIGGRI
Sbjct: 482 EGDLVKMSILVNEEPVDALSMLVHRSAAEKRGRALCEKLKELIPQHMFKIPIQAAIGGRI 541

Query: 546 IARETVKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISILKTDN 605
           +ARET+ A RKDVTAKCYGGD+TRKRKLLEKQKEGKKRMR+FG+V+IPQ AFI  LK  +
Sbjct: 542 VARETISALRKDVTAKCYGGDVTRKRKLLEKQKEGKKRMRQFGKVEIPQEAFIQALKMGD 601

Query: 606 E 606
           +
Sbjct: 602 D 602


>gi|254700233|ref|ZP_05162061.1| GTP-binding protein LepA [Brucella suis bv. 5 str. 513]
 gi|261750728|ref|ZP_05994437.1| GTP-binding protein lepA [Brucella suis bv. 5 str. 513]
 gi|261740481|gb|EEY28407.1| GTP-binding protein lepA [Brucella suis bv. 5 str. 513]
          Length = 602

 Score =  929 bits (2401), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 439/601 (73%), Positives = 515/601 (85%), Gaps = 1/601 (0%)

Query: 6   TPLSRIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQT 65
           TPL  IRNFSIVAHIDHGKSTLADR IQ   GL  REM  QVLD+MDIERERGITIKAQT
Sbjct: 3   TPLDHIRNFSIVAHIDHGKSTLADRLIQLTGGLDTREMKDQVLDSMDIERERGITIKAQT 62

Query: 66  VRLNYTSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQ 125
           VRL+Y + + +DY LNLIDTPGHVDF YEVSRSL+ACEGSLLVVDA+QGVEAQTLANVYQ
Sbjct: 63  VRLSYKAKNGEDYVLNLIDTPGHVDFAYEVSRSLAACEGSLLVVDASQGVEAQTLANVYQ 122

Query: 126 AIDNNHEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERIVQ 185
           AIDNNHEI+ VLNK DLP+A+P+RVK+QIEE IGI   DA+ +SAKTG GI  +LE IV 
Sbjct: 123 AIDNNHEIVVVLNKIDLPAAEPERVKQQIEEVIGIDASDAVEISAKTGLGIEDVLEAIVN 182

Query: 186 QLPSPTSPEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVER 245
           +LP+P   +  NAPLKA+L+DSWY SYLGV+VLVR+I+G L KGQ+IR+MGT AKY VER
Sbjct: 183 KLPAPKEGD-RNAPLKAMLVDSWYESYLGVIVLVRVIDGVLKKGQTIRMMGTGAKYPVER 241

Query: 246 IGILTPKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVVF 305
            G+ TPKM+ ++ L PGE+G + ASIKEV+ TRVGDTIT+D  PT + L GFKP QPVVF
Sbjct: 242 TGVFTPKMVQVDDLGPGELGFITASIKEVADTRVGDTITEDRRPTENMLSGFKPAQPVVF 301

Query: 306 CGLFPVDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERLE 365
           CGLFPVDA  FE+LR A+ KLRLNDASFSFE+E S ALGFGFRCGFLGLLHLEIIQERLE
Sbjct: 302 CGLFPVDAADFEDLRGAMGKLRLNDASFSFEMETSAALGFGFRCGFLGLLHLEIIQERLE 361

Query: 366 REFSLNLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEYLG 425
           REF+L+LI T+PSVVY L M DG+ ++L NP DMP+V KIA + EPWI+ TI+TP++YLG
Sbjct: 362 REFNLDLITTAPSVVYRLNMTDGTHKELHNPADMPDVVKIASIEEPWIKATIMTPDDYLG 421

Query: 426 SILKLCQERRGIQIDMSHLDNRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDYR 485
           +I+KLCQERRGIQID++++  RAMI Y+LPLNEV+FDFYDRLKS+SKGYASFDYN+ DYR
Sbjct: 422 AIMKLCQERRGIQIDLTYVGPRAMITYDLPLNEVVFDFYDRLKSISKGYASFDYNLSDYR 481

Query: 486 DSDLVKLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGGRI 545
           + DLVK++ILVN E +DALS+LVHRS +EKRGR +CEKLK LIPQ+MF+I IQAAIGGRI
Sbjct: 482 EGDLVKMSILVNEEPVDALSMLVHRSAAEKRGRALCEKLKELIPQRMFKIPIQAAIGGRI 541

Query: 546 IARETVKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISILKTDN 605
           +ARET+ A RKDVTAKCYGGD+TRKRKLLEKQKEGKKRMR+FG+V+IPQ AFI  LK  +
Sbjct: 542 VARETISALRKDVTAKCYGGDVTRKRKLLEKQKEGKKRMRQFGKVEIPQEAFIQALKMGD 601

Query: 606 E 606
           +
Sbjct: 602 D 602


>gi|153008672|ref|YP_001369887.1| GTP-binding protein LepA [Ochrobactrum anthropi ATCC 49188]
 gi|166224503|sp|A6WYK4|LEPA_OCHA4 RecName: Full=Elongation factor 4; Short=EF-4; AltName:
           Full=Ribosomal back-translocase LepA
 gi|151560560|gb|ABS14058.1| GTP-binding protein LepA [Ochrobactrum anthropi ATCC 49188]
          Length = 602

 Score =  929 bits (2401), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 439/601 (73%), Positives = 512/601 (85%), Gaps = 1/601 (0%)

Query: 6   TPLSRIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQT 65
           TPL  IRNFSIVAHIDHGKSTLADR IQ   GL  REM  QVLD+MDIERERGITIKAQT
Sbjct: 3   TPLDHIRNFSIVAHIDHGKSTLADRLIQLTGGLDTREMKDQVLDSMDIERERGITIKAQT 62

Query: 66  VRLNYTSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQ 125
           VRL+Y + + +DY LNLIDTPGHVDF YEVSRSL+ACEGSLLVVDA+QGVEAQTLANVYQ
Sbjct: 63  VRLSYKAKNGEDYVLNLIDTPGHVDFAYEVSRSLAACEGSLLVVDASQGVEAQTLANVYQ 122

Query: 126 AIDNNHEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERIVQ 185
           AIDNNHEI+ VLNK DLP+A+P+RVK+QIEE IGI    A+ +SAKTG GI  +LE IV 
Sbjct: 123 AIDNNHEIVVVLNKIDLPAAEPERVKQQIEEVIGIDAAQAVHISAKTGIGIEDVLEAIVT 182

Query: 186 QLPSPTSPEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVER 245
           QLP+P   +  NAPLKA+L+DSWY+SYLGV+VLVRII+G L KGQ+IR+MGT AKY VER
Sbjct: 183 QLPAPKEGD-RNAPLKAMLVDSWYDSYLGVIVLVRIIDGVLKKGQTIRMMGTGAKYPVER 241

Query: 246 IGILTPKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVVF 305
            G+ TPKM+ ++ L PGE+G + ASIKEV+ TRVGDTIT+D  PT   L GFKP QPVVF
Sbjct: 242 TGVFTPKMVQVDELGPGELGFITASIKEVADTRVGDTITEDRRPTNKMLSGFKPAQPVVF 301

Query: 306 CGLFPVDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERLE 365
           CGLFPVDA  FE+LR A+ KLRLNDASFSFE+E S ALGFGFRCGFLGLLHLEIIQERLE
Sbjct: 302 CGLFPVDAADFEDLRAAMGKLRLNDASFSFEMETSAALGFGFRCGFLGLLHLEIIQERLE 361

Query: 366 REFSLNLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEYLG 425
           REF+L+LI T+PSVVY L M DGS ++L NP DMP+V KI  + EPWI+ TI+TP++YLG
Sbjct: 362 REFNLDLITTAPSVVYRLNMQDGSQKELHNPADMPDVVKINAIEEPWIRATIMTPDDYLG 421

Query: 426 SILKLCQERRGIQIDMSHLDNRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDYR 485
           +I+KLCQERRG+QID++++  RAMI Y+LPLNEV+FDFYDRLKS+SKGYASFDYN+ DYR
Sbjct: 422 AIMKLCQERRGLQIDLTYVGPRAMITYDLPLNEVVFDFYDRLKSISKGYASFDYNLSDYR 481

Query: 486 DSDLVKLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGGRI 545
           + DLVK++ILVN E +DALS+LVHRS +EKRGR +CEKLK LIPQ MF+I IQAAIGGRI
Sbjct: 482 EGDLVKMSILVNEEPVDALSMLVHRSAAEKRGRALCEKLKELIPQHMFKIPIQAAIGGRI 541

Query: 546 IARETVKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISILKTDN 605
           +ARET+ A RKDVTAKCYGGD+TRKRKLLEKQKEGKKRMR+FG+V+IPQ AFI  LK  +
Sbjct: 542 VARETISALRKDVTAKCYGGDVTRKRKLLEKQKEGKKRMRQFGKVEIPQEAFIQALKMGD 601

Query: 606 E 606
           +
Sbjct: 602 D 602


>gi|239832665|ref|ZP_04680994.1| GTP-binding protein LepA [Ochrobactrum intermedium LMG 3301]
 gi|239824932|gb|EEQ96500.1| GTP-binding protein LepA [Ochrobactrum intermedium LMG 3301]
          Length = 602

 Score =  929 bits (2400), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 438/601 (72%), Positives = 512/601 (85%), Gaps = 1/601 (0%)

Query: 6   TPLSRIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQT 65
           TPL  IRNFSIVAHIDHGKSTLADR IQ   GL  REM  QVLD+MDIERERGITIKAQT
Sbjct: 3   TPLDHIRNFSIVAHIDHGKSTLADRLIQLTGGLDTREMKDQVLDSMDIERERGITIKAQT 62

Query: 66  VRLNYTSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQ 125
           VRL+Y + + +DY LNLIDTPGHVDF YEVSRSL+ACEGSLLVVDA+QGVEAQTLANVYQ
Sbjct: 63  VRLSYKAKNGEDYVLNLIDTPGHVDFAYEVSRSLAACEGSLLVVDASQGVEAQTLANVYQ 122

Query: 126 AIDNNHEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERIVQ 185
           AIDNNHEI+ VLNK DLP+A+P+RVK+QIEE IGI    A+ +SAKTG GI  +LE IV 
Sbjct: 123 AIDNNHEIVVVLNKIDLPAAEPERVKQQIEEVIGIDAAQAVHISAKTGLGIEDVLEAIVT 182

Query: 186 QLPSPTSPEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVER 245
           QLP+P   +  NAPLKA+L+DSWY+SYLGV+VLVRII+G L KGQ+IR+MGT AKY VER
Sbjct: 183 QLPAPKEGD-RNAPLKAMLVDSWYDSYLGVIVLVRIIDGVLKKGQTIRMMGTGAKYPVER 241

Query: 246 IGILTPKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVVF 305
            G+ TPKM+ ++ L PGE+G + ASIKEV+ TRVGDTIT+D  PT   L GFKP QPVVF
Sbjct: 242 TGVFTPKMVQVDELGPGELGFITASIKEVADTRVGDTITEDRRPTEKMLSGFKPAQPVVF 301

Query: 306 CGLFPVDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERLE 365
           CGLFPVDA  FE+LR A+ KLRLNDASFSFE+E S ALGFGFRCGFLGLLHLEIIQERLE
Sbjct: 302 CGLFPVDAADFEDLRAAMGKLRLNDASFSFEMETSAALGFGFRCGFLGLLHLEIIQERLE 361

Query: 366 REFSLNLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEYLG 425
           REF+L+LI T+PSVVY L M DGS ++L NP DMP++ KI  + EPWI+ TI+TP++YLG
Sbjct: 362 REFNLDLITTAPSVVYRLNMQDGSQKELHNPADMPDIVKINAIEEPWIKATIMTPDDYLG 421

Query: 426 SILKLCQERRGIQIDMSHLDNRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDYR 485
           +I+KLCQERRGIQID++++  RAMI Y+LPLNEV+FDFYDRLKS+SKGYASFDYN+ DYR
Sbjct: 422 AIMKLCQERRGIQIDLTYVGPRAMITYDLPLNEVVFDFYDRLKSISKGYASFDYNLSDYR 481

Query: 486 DSDLVKLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGGRI 545
           + DLVK++ILVN E +DALS+LVHR+ +EKRGR +CEKLK LIPQ MF+I IQAAIGGRI
Sbjct: 482 EGDLVKMSILVNEEPVDALSMLVHRTAAEKRGRALCEKLKELIPQHMFKIPIQAAIGGRI 541

Query: 546 IARETVKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISILKTDN 605
           +ARET+ A RKDVTAKCYGGD+TRKRKLLEKQKEGKKRMR+FG+V+IPQ AFI  LK  +
Sbjct: 542 VARETISALRKDVTAKCYGGDVTRKRKLLEKQKEGKKRMRQFGKVEIPQEAFIQALKMGD 601

Query: 606 E 606
           +
Sbjct: 602 D 602


>gi|17988604|ref|NP_541237.1| GTP-binding protein LepA [Brucella melitensis bv. 1 str. 16M]
 gi|225686793|ref|YP_002734765.1| GTP-binding protein LepA [Brucella melitensis ATCC 23457]
 gi|256043907|ref|ZP_05446826.1| GTP-binding protein LepA [Brucella melitensis bv. 1 str. Rev.1]
 gi|256262072|ref|ZP_05464604.1| GTP-binding protein lepA [Brucella melitensis bv. 2 str. 63/9]
 gi|260565083|ref|ZP_05835568.1| GTP-binding protein lepA [Brucella melitensis bv. 1 str. 16M]
 gi|265990329|ref|ZP_06102886.1| GTP-binding protein lepA [Brucella melitensis bv. 1 str. Rev.1]
 gi|24211916|sp|Q8YDB8|LEPA_BRUME RecName: Full=Elongation factor 4; Short=EF-4; AltName:
           Full=Ribosomal back-translocase LepA
 gi|254808381|sp|C0RMH8|LEPA_BRUMB RecName: Full=Elongation factor 4; Short=EF-4; AltName:
           Full=Ribosomal back-translocase LepA
 gi|17984405|gb|AAL53501.1| gtp-binding protein lepa [Brucella melitensis bv. 1 str. 16M]
 gi|225642898|gb|ACO02811.1| GTP-binding protein LepA [Brucella melitensis ATCC 23457]
 gi|260152726|gb|EEW87819.1| GTP-binding protein lepA [Brucella melitensis bv. 1 str. 16M]
 gi|263000998|gb|EEZ13688.1| GTP-binding protein lepA [Brucella melitensis bv. 1 str. Rev.1]
 gi|263091762|gb|EEZ16093.1| GTP-binding protein lepA [Brucella melitensis bv. 2 str. 63/9]
 gi|326411201|gb|ADZ68265.1| GTP-binding protein LepA [Brucella melitensis M28]
 gi|326554492|gb|ADZ89131.1| GTP-binding protein LepA [Brucella melitensis M5-90]
          Length = 602

 Score =  927 bits (2396), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 438/601 (72%), Positives = 514/601 (85%), Gaps = 1/601 (0%)

Query: 6   TPLSRIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQT 65
           TPL  IRNFSIVAHIDHGKSTLADR IQ   GL  REM  QVLD+MDIERERGITIKAQT
Sbjct: 3   TPLDHIRNFSIVAHIDHGKSTLADRLIQLTGGLDTREMKDQVLDSMDIERERGITIKAQT 62

Query: 66  VRLNYTSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQ 125
           VRL+Y + + +DY LNLIDTPGHVDF YEVSRSL+ACEGSLLVVDA+QGVEAQTLANVYQ
Sbjct: 63  VRLSYKAKNGEDYVLNLIDTPGHVDFAYEVSRSLAACEGSLLVVDASQGVEAQTLANVYQ 122

Query: 126 AIDNNHEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERIVQ 185
           AIDNNHEI+ VLNK DLP+A+P+RVK+QIEE IGI   DA+ +SAKTG GI  +LE IV 
Sbjct: 123 AIDNNHEIVVVLNKIDLPAAEPERVKQQIEEVIGIDASDAVEISAKTGLGIEDVLEAIVN 182

Query: 186 QLPSPTSPEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVER 245
           +LP+P   +  NAPLKA+L+DSWY+SYLGV+VLVR+I+G L KGQ+IR+MGT AKY VER
Sbjct: 183 KLPAPKEGD-RNAPLKAMLVDSWYDSYLGVIVLVRVIDGVLKKGQTIRMMGTGAKYPVER 241

Query: 246 IGILTPKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVVF 305
            G+ TPKM+ ++ L PGE+G + ASIKEV+ TRVGDTIT+D  PT + L GFKP QPVVF
Sbjct: 242 TGVFTPKMVQVDDLGPGELGFITASIKEVADTRVGDTITEDRRPTENMLSGFKPAQPVVF 301

Query: 306 CGLFPVDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERLE 365
           CGLFPVDA  FE+LR A+ KLRLNDASFSFE+E S ALGFGFRCGFLGLLHLEIIQERLE
Sbjct: 302 CGLFPVDAADFEDLRGAMGKLRLNDASFSFEMETSAALGFGFRCGFLGLLHLEIIQERLE 361

Query: 366 REFSLNLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEYLG 425
           REF+L+LI T+PSVVY L M DG+ ++L NP DMP+V KIA + EPWI+ TI+TP++YLG
Sbjct: 362 REFNLDLITTAPSVVYRLNMTDGTHKELHNPADMPDVVKIASIEEPWIKATIMTPDDYLG 421

Query: 426 SILKLCQERRGIQIDMSHLDNRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDYR 485
           +I+KLCQERRGIQID++++  RAMI Y+LPLNEV+FDFYDRLKS+SKGYASFDYN+ DYR
Sbjct: 422 AIMKLCQERRGIQIDLTYVGPRAMITYDLPLNEVVFDFYDRLKSISKGYASFDYNLSDYR 481

Query: 486 DSDLVKLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGGRI 545
           + DLVK++ILVN E +DALS+LVHRS +EKRGR +CEKLK LIPQ MF+I IQAAIGGRI
Sbjct: 482 EGDLVKMSILVNEEPVDALSMLVHRSAAEKRGRALCEKLKELIPQHMFKIPIQAAIGGRI 541

Query: 546 IARETVKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISILKTDN 605
           +ARET+ A RKDVTAKCYGGD+TRKRKLLEKQKE KKRMR+FG+V+IPQ AFI  LK  +
Sbjct: 542 VARETISALRKDVTAKCYGGDVTRKRKLLEKQKESKKRMRQFGKVEIPQEAFIQALKMGD 601

Query: 606 E 606
           +
Sbjct: 602 D 602


>gi|62317867|ref|YP_223720.1| GTP-binding protein LepA [Brucella abortus bv. 1 str. 9-941]
 gi|83269845|ref|YP_419136.1| GTP-binding protein LepA [Brucella melitensis biovar Abortus 2308]
 gi|189023117|ref|YP_001932858.1| GTP-binding protein LepA [Brucella abortus S19]
 gi|237817409|ref|ZP_04596401.1| GTP-binding protein LepA [Brucella abortus str. 2308 A]
 gi|254699157|ref|ZP_05160985.1| GTP-binding protein LepA [Brucella abortus bv. 2 str. 86/8/59]
 gi|254732601|ref|ZP_05191179.1| GTP-binding protein LepA [Brucella abortus bv. 4 str. 292]
 gi|260545102|ref|ZP_05820923.1| GTP-binding protein lepA [Brucella abortus NCTC 8038]
 gi|260760413|ref|ZP_05872761.1| GTP-binding protein lepA [Brucella abortus bv. 4 str. 292]
 gi|260763653|ref|ZP_05875985.1| GTP-binding protein lepA [Brucella abortus bv. 2 str. 86/8/59]
 gi|75495354|sp|Q576S5|LEPA_BRUAB RecName: Full=Elongation factor 4; Short=EF-4; AltName:
           Full=Ribosomal back-translocase LepA
 gi|119371334|sp|Q2YJP8|LEPA_BRUA2 RecName: Full=Elongation factor 4; Short=EF-4; AltName:
           Full=Ribosomal back-translocase LepA
 gi|238691507|sp|B2SC25|LEPA_BRUA1 RecName: Full=Elongation factor 4; Short=EF-4; AltName:
           Full=Ribosomal back-translocase LepA
 gi|62198060|gb|AAX76359.1| LepA, GTP-binding protein LepA [Brucella abortus bv. 1 str. 9-941]
 gi|82940119|emb|CAJ13167.1| Elongation factor G, C-terminal:Elongation factor,
           GTP-binding:ATP/GTP-binding site motif A (P-loop):Ras
           GTPase superfamily:E [Brucella melitensis biovar Abortus
           2308]
 gi|189021691|gb|ACD74412.1| GTP-binding protein LepA [Brucella abortus S19]
 gi|237788222|gb|EEP62438.1| GTP-binding protein LepA [Brucella abortus str. 2308 A]
 gi|260098373|gb|EEW82247.1| GTP-binding protein lepA [Brucella abortus NCTC 8038]
 gi|260670731|gb|EEX57671.1| GTP-binding protein lepA [Brucella abortus bv. 4 str. 292]
 gi|260674074|gb|EEX60895.1| GTP-binding protein lepA [Brucella abortus bv. 2 str. 86/8/59]
          Length = 602

 Score =  927 bits (2396), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 438/601 (72%), Positives = 514/601 (85%), Gaps = 1/601 (0%)

Query: 6   TPLSRIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQT 65
           TPL  IRNFSIVAHIDHGKSTLADR IQ   GL  REM  QVLD+MDIERERGITIKAQT
Sbjct: 3   TPLDHIRNFSIVAHIDHGKSTLADRLIQLTGGLDTREMKDQVLDSMDIERERGITIKAQT 62

Query: 66  VRLNYTSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQ 125
           VRL+Y + + +DY LNLIDTPGHVDF YEVSRSL+ACEGSLLVVDA+QGVEAQTLANVYQ
Sbjct: 63  VRLSYKAKNGEDYVLNLIDTPGHVDFAYEVSRSLAACEGSLLVVDASQGVEAQTLANVYQ 122

Query: 126 AIDNNHEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERIVQ 185
           AIDNNHEI+ VLNK DLP+A+P+RVK+QIEE IGI   DA+ +SAKTG GI  +LE IV 
Sbjct: 123 AIDNNHEIVVVLNKIDLPAAEPERVKQQIEEVIGIDASDAVEISAKTGLGIEDVLEAIVN 182

Query: 186 QLPSPTSPEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVER 245
           +LP+P   +  NAPLKA+L+DSWY+SYLGV+VLVR+I+G L KGQ+IR+MGT AKY VER
Sbjct: 183 KLPAPKEGD-RNAPLKAMLVDSWYDSYLGVIVLVRVIDGVLKKGQTIRMMGTGAKYPVER 241

Query: 246 IGILTPKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVVF 305
            G+ TPKM+ ++ L PGE+G + ASIKEV+ TRVGDTIT+D  PT + L GFKP QPVVF
Sbjct: 242 TGVFTPKMVQVDDLGPGELGFITASIKEVADTRVGDTITEDRRPTENILSGFKPAQPVVF 301

Query: 306 CGLFPVDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERLE 365
           CGLFPVDA  FE+LR A+ KLRLNDASFSFE+E S ALGFGFRCGFLGLLHLEIIQERLE
Sbjct: 302 CGLFPVDAADFEDLRGAMGKLRLNDASFSFEMETSAALGFGFRCGFLGLLHLEIIQERLE 361

Query: 366 REFSLNLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEYLG 425
           REF+L+LI T+PSVVY L M DG+ ++L NP DMP+V KIA + EPWI+ TI+TP++YLG
Sbjct: 362 REFNLDLITTAPSVVYRLNMTDGTHKELHNPADMPDVVKIASIEEPWIKATIMTPDDYLG 421

Query: 426 SILKLCQERRGIQIDMSHLDNRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDYR 485
           +I+KLCQERRGIQID++++  RAMI Y+LPLNEV+FDFYDRLKS+SKGYASFDYN+ DYR
Sbjct: 422 AIMKLCQERRGIQIDLTYVGPRAMITYDLPLNEVVFDFYDRLKSISKGYASFDYNLSDYR 481

Query: 486 DSDLVKLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGGRI 545
           + DLVK++ILVN E +DALS+LVHRS +EKRGR +CEKLK LIPQ MF+I IQAAIGGRI
Sbjct: 482 EGDLVKMSILVNEEPVDALSMLVHRSAAEKRGRALCEKLKELIPQHMFKIPIQAAIGGRI 541

Query: 546 IARETVKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISILKTDN 605
           +ARET+ A RKDVTAKCYGGD+TRKRKLLEKQKE KKRMR+FG+V+IPQ AFI  LK  +
Sbjct: 542 VARETISALRKDVTAKCYGGDVTRKRKLLEKQKESKKRMRQFGKVEIPQEAFIQALKMGD 601

Query: 606 E 606
           +
Sbjct: 602 D 602


>gi|254690647|ref|ZP_05153901.1| GTP-binding protein LepA [Brucella abortus bv. 6 str. 870]
 gi|256255828|ref|ZP_05461364.1| GTP-binding protein LepA [Brucella abortus bv. 9 str. C68]
 gi|260756218|ref|ZP_05868566.1| GTP-binding protein lepA [Brucella abortus bv. 6 str. 870]
 gi|260882042|ref|ZP_05893656.1| GTP-binding protein lepA [Brucella abortus bv. 9 str. C68]
 gi|297249198|ref|ZP_06932899.1| GTP-binding protein LepA [Brucella abortus bv. 5 str. B3196]
 gi|260676326|gb|EEX63147.1| GTP-binding protein lepA [Brucella abortus bv. 6 str. 870]
 gi|260871570|gb|EEX78639.1| GTP-binding protein lepA [Brucella abortus bv. 9 str. C68]
 gi|297173067|gb|EFH32431.1| GTP-binding protein LepA [Brucella abortus bv. 5 str. B3196]
          Length = 602

 Score =  927 bits (2396), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 438/601 (72%), Positives = 514/601 (85%), Gaps = 1/601 (0%)

Query: 6   TPLSRIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQT 65
           TPL  IRNFSIVAHIDHGKSTLADR IQ   GL  REM  QVLD+MDIERERGITIKAQT
Sbjct: 3   TPLDHIRNFSIVAHIDHGKSTLADRLIQLTGGLDTREMKDQVLDSMDIERERGITIKAQT 62

Query: 66  VRLNYTSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQ 125
           VRL+Y + + +DY LNLIDTPGHVDF YEVSRSL+ACEGSLLVVDA+QGVEAQTLANVYQ
Sbjct: 63  VRLSYKAKNGEDYVLNLIDTPGHVDFAYEVSRSLAACEGSLLVVDASQGVEAQTLANVYQ 122

Query: 126 AIDNNHEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERIVQ 185
           AIDNNHEI+ VLNK DLP+A+P+RVK+QIEE IGI   DA+ +SAKTG GI  +LE IV 
Sbjct: 123 AIDNNHEIVVVLNKIDLPAAEPERVKQQIEEVIGIDASDAVEISAKTGLGIEDVLEAIVN 182

Query: 186 QLPSPTSPEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVER 245
           +LP+P   +  NAPLKA+L+DSWY+SYLGV+VLVR+I+G L KGQ+IR+MGT AKY VER
Sbjct: 183 KLPAPKDGD-RNAPLKAMLVDSWYDSYLGVIVLVRVIDGVLKKGQTIRMMGTGAKYPVER 241

Query: 246 IGILTPKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVVF 305
            G+ TPKM+ ++ L PGE+G + ASIKEV+ TRVGDTIT+D  PT + L GFKP QPVVF
Sbjct: 242 TGVFTPKMVQVDDLGPGELGFITASIKEVADTRVGDTITEDRRPTENILSGFKPAQPVVF 301

Query: 306 CGLFPVDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERLE 365
           CGLFPVDA  FE+LR A+ KLRLNDASFSFE+E S ALGFGFRCGFLGLLHLEIIQERLE
Sbjct: 302 CGLFPVDAADFEDLRGAMGKLRLNDASFSFEMETSAALGFGFRCGFLGLLHLEIIQERLE 361

Query: 366 REFSLNLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEYLG 425
           REF+L+LI T+PSVVY L M DG+ ++L NP DMP+V KIA + EPWI+ TI+TP++YLG
Sbjct: 362 REFNLDLITTAPSVVYRLNMTDGTHKELHNPADMPDVVKIASIEEPWIKATIMTPDDYLG 421

Query: 426 SILKLCQERRGIQIDMSHLDNRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDYR 485
           +I+KLCQERRGIQID++++  RAMI Y+LPLNEV+FDFYDRLKS+SKGYASFDYN+ DYR
Sbjct: 422 AIMKLCQERRGIQIDLTYVGPRAMITYDLPLNEVVFDFYDRLKSISKGYASFDYNLSDYR 481

Query: 486 DSDLVKLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGGRI 545
           + DLVK++ILVN E +DALS+LVHRS +EKRGR +CEKLK LIPQ MF+I IQAAIGGRI
Sbjct: 482 EGDLVKMSILVNEEPVDALSMLVHRSAAEKRGRALCEKLKELIPQHMFKIPIQAAIGGRI 541

Query: 546 IARETVKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISILKTDN 605
           +ARET+ A RKDVTAKCYGGD+TRKRKLLEKQKE KKRMR+FG+V+IPQ AFI  LK  +
Sbjct: 542 VARETISALRKDVTAKCYGGDVTRKRKLLEKQKESKKRMRQFGKVEIPQEAFIQALKMGD 601

Query: 606 E 606
           +
Sbjct: 602 D 602


>gi|254719848|ref|ZP_05181659.1| GTP-binding protein LepA [Brucella sp. 83/13]
 gi|265984864|ref|ZP_06097599.1| GTP-binding protein lepA [Brucella sp. 83/13]
 gi|306837549|ref|ZP_07470421.1| GTP-binding protein LepA [Brucella sp. NF 2653]
 gi|264663456|gb|EEZ33717.1| GTP-binding protein lepA [Brucella sp. 83/13]
 gi|306407333|gb|EFM63540.1| GTP-binding protein LepA [Brucella sp. NF 2653]
          Length = 602

 Score =  926 bits (2392), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 437/601 (72%), Positives = 514/601 (85%), Gaps = 1/601 (0%)

Query: 6   TPLSRIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQT 65
           TPL  IRNFSIVAHIDHGKSTLADR IQ   GL  REM  QVLD+MDIERERGITIKAQT
Sbjct: 3   TPLDHIRNFSIVAHIDHGKSTLADRLIQLTGGLDTREMKDQVLDSMDIERERGITIKAQT 62

Query: 66  VRLNYTSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQ 125
           VRL+Y + + +DY LNLIDTPGHVDF YEVSRSL+ACEGSLLVVDA+QGVEAQTLANVYQ
Sbjct: 63  VRLSYKAKNGEDYVLNLIDTPGHVDFAYEVSRSLAACEGSLLVVDASQGVEAQTLANVYQ 122

Query: 126 AIDNNHEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERIVQ 185
           AIDNNHEI+ VLNK DLP+A+P+RVK+QIEE IGI   DA+ +SAKTG GI  +LE IV 
Sbjct: 123 AIDNNHEIVVVLNKIDLPAAEPERVKQQIEEVIGIDASDAVEISAKTGLGIEDVLEAIVN 182

Query: 186 QLPSPTSPEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVER 245
           +LP+P   +  NAPLKA+L+DSWY+SYLGV+VLVR+I+G L KGQ+IR+MGT AKY VER
Sbjct: 183 KLPAPKEGD-RNAPLKAMLVDSWYDSYLGVIVLVRVIDGVLKKGQTIRMMGTGAKYPVER 241

Query: 246 IGILTPKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVVF 305
            G+ TPKM+ ++ L PGE+G + ASIKEV+ TRVGDTIT+D  PT + L GFKP QPVVF
Sbjct: 242 TGVFTPKMVQVDDLGPGELGFITASIKEVADTRVGDTITEDRRPTENMLSGFKPAQPVVF 301

Query: 306 CGLFPVDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERLE 365
           CGLFPVDA  FE+LR A+ KLRLNDASFSFE+E S ALGFG RCGFLGLLHLEIIQERLE
Sbjct: 302 CGLFPVDAADFEDLRGAMGKLRLNDASFSFEMETSAALGFGSRCGFLGLLHLEIIQERLE 361

Query: 366 REFSLNLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEYLG 425
           REF+L+LI T+PSVVY L M DG+ ++L NP DMP+V KIA + EPWI+ TI+TP++YLG
Sbjct: 362 REFNLDLITTAPSVVYRLNMTDGTHKELHNPADMPDVVKIASIEEPWIKATIMTPDDYLG 421

Query: 426 SILKLCQERRGIQIDMSHLDNRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDYR 485
           +I+KLCQERRGIQ+D++++  RAMI Y+LPLNEV+FDFYDRLKS+SKGYASFDYN+ DYR
Sbjct: 422 AIMKLCQERRGIQVDLTYVGPRAMITYDLPLNEVVFDFYDRLKSISKGYASFDYNLSDYR 481

Query: 486 DSDLVKLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGGRI 545
           + DLVK++ILVN E +DALS+LVHRS +EKRGR +CEKLK LIPQ MF+I IQAAIGGRI
Sbjct: 482 EGDLVKMSILVNEEPVDALSMLVHRSAAEKRGRALCEKLKELIPQHMFKIPIQAAIGGRI 541

Query: 546 IARETVKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISILKTDN 605
           +ARET+ A RKDVTAKCYGGD+TRKRKLLEKQKEGKKRMR+FG+V+IPQ AFI  LK  +
Sbjct: 542 VARETISALRKDVTAKCYGGDVTRKRKLLEKQKEGKKRMRQFGKVEIPQEAFIQALKMGD 601

Query: 606 E 606
           +
Sbjct: 602 D 602


>gi|256111029|ref|ZP_05452091.1| GTP-binding protein LepA [Brucella melitensis bv. 3 str. Ether]
 gi|265992564|ref|ZP_06105121.1| GTP-binding protein lepA [Brucella melitensis bv. 3 str. Ether]
 gi|262763434|gb|EEZ09466.1| GTP-binding protein lepA [Brucella melitensis bv. 3 str. Ether]
          Length = 602

 Score =  924 bits (2388), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 437/601 (72%), Positives = 513/601 (85%), Gaps = 1/601 (0%)

Query: 6   TPLSRIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQT 65
           TPL  IRNFSIVAHIDHGKSTLADR IQ   GL  REM  QVLD+MDIERERGITIKAQT
Sbjct: 3   TPLDHIRNFSIVAHIDHGKSTLADRLIQLTGGLDTREMKDQVLDSMDIERERGITIKAQT 62

Query: 66  VRLNYTSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQ 125
           VRL+Y + + +DY LNLIDTPGHVDF YEVSRSL+ACEGSLLVVDA+QGVEAQTLANVYQ
Sbjct: 63  VRLSYKAKNGEDYVLNLIDTPGHVDFAYEVSRSLAACEGSLLVVDASQGVEAQTLANVYQ 122

Query: 126 AIDNNHEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERIVQ 185
           AI NNHEI+ VLNK DLP+A+P+RVK+QIEE IGI   DA+ +SAKTG GI  +LE IV 
Sbjct: 123 AIGNNHEIVVVLNKIDLPAAEPERVKQQIEEVIGIDASDAVEISAKTGLGIEDVLEAIVN 182

Query: 186 QLPSPTSPEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVER 245
           +LP+P   +  NAPLKA+L+DSWY+SYLGV+VLVR+I+G L KGQ+IR+MGT AKY VER
Sbjct: 183 KLPAPKEGD-RNAPLKAMLVDSWYDSYLGVIVLVRVIDGVLKKGQTIRMMGTGAKYPVER 241

Query: 246 IGILTPKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVVF 305
            G+ TPKM+ ++ L PGE+G + ASIKEV+ TRVGDTIT+D  PT + L GFKP QPVVF
Sbjct: 242 TGVFTPKMVQVDDLGPGELGFITASIKEVADTRVGDTITEDRRPTENMLSGFKPAQPVVF 301

Query: 306 CGLFPVDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERLE 365
           CGLFPVDA  FE+LR A+ KLRLNDASFSFE+E S ALGFGFRCGFLGLLHLEIIQERLE
Sbjct: 302 CGLFPVDAADFEDLRGAMGKLRLNDASFSFEMETSAALGFGFRCGFLGLLHLEIIQERLE 361

Query: 366 REFSLNLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEYLG 425
           REF+L+LI T+PSVVY L M DG+ ++L NP DMP+V KIA + EPWI+ TI+TP++YLG
Sbjct: 362 REFNLDLITTAPSVVYRLNMTDGTHKELHNPADMPDVVKIASIEEPWIKATIMTPDDYLG 421

Query: 426 SILKLCQERRGIQIDMSHLDNRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDYR 485
           +I+KLCQERRGIQID++++  RAMI Y+LPLNEV+FDFYDRLKS+SKGYASFDYN+ DYR
Sbjct: 422 AIMKLCQERRGIQIDLTYVGPRAMITYDLPLNEVVFDFYDRLKSISKGYASFDYNLSDYR 481

Query: 486 DSDLVKLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGGRI 545
           + DLVK++ILVN E +DALS+LVHRS +EKRGR +CEKLK LIPQ MF+I IQAAIGGRI
Sbjct: 482 EGDLVKMSILVNEEPVDALSMLVHRSAAEKRGRALCEKLKELIPQHMFKIPIQAAIGGRI 541

Query: 546 IARETVKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISILKTDN 605
           +ARET+ A RKDVTAKCYGGD+TRKRKLLEKQKE KKRMR+FG+V+IPQ AFI  LK  +
Sbjct: 542 VARETISALRKDVTAKCYGGDVTRKRKLLEKQKESKKRMRQFGKVEIPQEAFIQALKMGD 601

Query: 606 E 606
           +
Sbjct: 602 D 602


>gi|254696049|ref|ZP_05157877.1| GTP-binding protein LepA [Brucella abortus bv. 3 str. Tulya]
 gi|261216480|ref|ZP_05930761.1| GTP-binding protein lepA [Brucella abortus bv. 3 str. Tulya]
 gi|260918087|gb|EEX84948.1| GTP-binding protein lepA [Brucella abortus bv. 3 str. Tulya]
          Length = 602

 Score =  924 bits (2388), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 436/601 (72%), Positives = 513/601 (85%), Gaps = 1/601 (0%)

Query: 6   TPLSRIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQT 65
           TPL  IRNFSIVAHIDHGKSTLADR IQ   GL  REM  QVLD+MDIERERGITIKAQT
Sbjct: 3   TPLDHIRNFSIVAHIDHGKSTLADRLIQLTGGLDTREMKDQVLDSMDIERERGITIKAQT 62

Query: 66  VRLNYTSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQ 125
           VRL+Y + + +DY LNLIDTPGHVDF YEVSRSL+ACEGSLLVVDA+QGVEAQTLANVYQ
Sbjct: 63  VRLSYKAKNGEDYVLNLIDTPGHVDFAYEVSRSLAACEGSLLVVDASQGVEAQTLANVYQ 122

Query: 126 AIDNNHEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERIVQ 185
           AIDNNHEI+ VLNK DLP+A+P+RVK+QIEE IGI   DA+ +SAKTG GI  +LE IV 
Sbjct: 123 AIDNNHEIVVVLNKIDLPAAEPERVKQQIEEVIGIDASDAVEISAKTGLGIEDVLEAIVN 182

Query: 186 QLPSPTSPEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVER 245
           +LP+P   +  NAPLKA+L+DSWY+SYLGV+VLVR+I+G L KGQ+IR+MGT AKY VER
Sbjct: 183 KLPAPKEGD-RNAPLKAMLVDSWYDSYLGVIVLVRVIDGVLKKGQTIRMMGTGAKYPVER 241

Query: 246 IGILTPKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVVF 305
            G+ TPKM+ ++ L PGE+G + ASIKEV+ TRVGDTIT+D  PT + L GFKP QPVVF
Sbjct: 242 TGVFTPKMVQVDDLGPGELGFITASIKEVADTRVGDTITEDRRPTENILSGFKPAQPVVF 301

Query: 306 CGLFPVDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERLE 365
           CGLFPVDA  FE+LR A+ KLRLNDASFSFE+E S ALGFGFRCGFLGLLHLEIIQERLE
Sbjct: 302 CGLFPVDAADFEDLRGAMGKLRLNDASFSFEMETSAALGFGFRCGFLGLLHLEIIQERLE 361

Query: 366 REFSLNLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEYLG 425
           REF+L+LI T+PSVVY L M DG+ ++L NP DMP+V KIA + EPWI+ TI+TP++YLG
Sbjct: 362 REFNLDLITTAPSVVYRLNMTDGTHKELHNPADMPDVVKIASIEEPWIKATIMTPDDYLG 421

Query: 426 SILKLCQERRGIQIDMSHLDNRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDYR 485
           +I+KLCQERRGIQID++++  RAMI Y+LPLNEV+FDFYDRLKS+S+GYASFDYN+ DYR
Sbjct: 422 AIMKLCQERRGIQIDLTYVGPRAMITYDLPLNEVVFDFYDRLKSISEGYASFDYNLSDYR 481

Query: 486 DSDLVKLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGGRI 545
           + DLVK++ILVN E +D LS+LVHRS +EKRGR +CEKLK LIPQ MF+I IQAAIGGRI
Sbjct: 482 EGDLVKMSILVNEEPVDVLSMLVHRSAAEKRGRALCEKLKELIPQHMFKIPIQAAIGGRI 541

Query: 546 IARETVKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISILKTDN 605
           +ARET+ A RKDVTAKCYGGD+TRKRKLLEKQKE KKRMR+FG+V+IPQ AFI  LK  +
Sbjct: 542 VARETISALRKDVTAKCYGGDVTRKRKLLEKQKESKKRMRQFGKVEIPQEAFIQALKMGD 601

Query: 606 E 606
           +
Sbjct: 602 D 602


>gi|49474893|ref|YP_032934.1| GTP-binding protein LepA [Bartonella henselae str. Houston-1]
 gi|60389986|sp|Q6G550|LEPA_BARHE RecName: Full=Elongation factor 4; Short=EF-4; AltName:
           Full=Ribosomal back-translocase LepA
 gi|49237698|emb|CAF26887.1| GTP-binding protein lepA [Bartonella henselae str. Houston-1]
          Length = 601

 Score =  919 bits (2375), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 428/595 (71%), Positives = 514/595 (86%), Gaps = 1/595 (0%)

Query: 11  IRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVRLNY 70
           IRNFSIVAHIDHGKSTLADR IQ   GL  REM  QVLD+MDIERERGITIKAQTVRL+Y
Sbjct: 8   IRNFSIVAHIDHGKSTLADRLIQMTGGLETREMKEQVLDSMDIERERGITIKAQTVRLHY 67

Query: 71  TSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQAIDNN 130
            + + + Y LNLIDTPGHVDF YEVSRSL+ACEGSLLVVDA+QGVEAQTLANVYQAIDN+
Sbjct: 68  KAKNGETYILNLIDTPGHVDFAYEVSRSLAACEGSLLVVDASQGVEAQTLANVYQAIDNS 127

Query: 131 HEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERIVQQLPSP 190
           HE++ VLNK DLP+A+P+RVK+QIE+ IGI T +A+ +SAKTG G+  +LE IV QLPSP
Sbjct: 128 HELVVVLNKVDLPAAEPERVKEQIEDVIGIDTSEAVEISAKTGLGVSDVLEAIVTQLPSP 187

Query: 191 TSPEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVERIGILT 250
            + +  N PLKA+L+DSWY++YLGV+VLVR+I+G L KGQ IR+MGT AKY VER+G+ T
Sbjct: 188 RTGD-VNKPLKAMLVDSWYDAYLGVIVLVRVIDGILKKGQIIRMMGTGAKYPVERVGVFT 246

Query: 251 PKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVVFCGLFP 310
           PKMI ++ L PGEIG + ASIKEV+ TRVGDTIT++  P   ALPGFKP QPVVFCGLFP
Sbjct: 247 PKMIQVDELGPGEIGFITASIKEVADTRVGDTITEERCPCEEALPGFKPAQPVVFCGLFP 306

Query: 311 VDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERLEREFSL 370
           +DA  F++LR A+ KLRLNDASFSFE+E S ALGFGFRCGFLGLLHLEIIQERLEREF+L
Sbjct: 307 IDAADFDDLRAAMGKLRLNDASFSFEVETSAALGFGFRCGFLGLLHLEIIQERLEREFNL 366

Query: 371 NLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEYLGSILKL 430
           +LI T+PSVVY + MHDGS+++L NP DMP++ KI+ + EPWI+ TI+TP+ YLGS+L+L
Sbjct: 367 DLIATAPSVVYRMNMHDGSVKELHNPADMPDIVKISSIEEPWIRATIMTPDNYLGSVLEL 426

Query: 431 CQERRGIQIDMSHLDNRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDYRDSDLV 490
           CQERRGIQ+ +S++  RAM+ Y+LPLNEV+FDFYDRLKS+SKGYASFDY + DY + DLV
Sbjct: 427 CQERRGIQVSLSYVGTRAMVTYDLPLNEVVFDFYDRLKSISKGYASFDYQMRDYTEGDLV 486

Query: 491 KLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGGRIIARET 550
           K++ILVN E+IDALS+LVHR+++EKRGR +CEKLK+LIPQ MFQI IQAAIGG+IIARET
Sbjct: 487 KMSILVNGESIDALSMLVHRTIAEKRGRSLCEKLKDLIPQHMFQIPIQAAIGGKIIARET 546

Query: 551 VKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISILKTDN 605
           ++A RKDVTAKCYGGD+TRKRKLLEKQKEGKKRMR+FG+V+IPQSAFI  LK + 
Sbjct: 547 IRALRKDVTAKCYGGDVTRKRKLLEKQKEGKKRMRQFGKVEIPQSAFIQALKMNK 601


>gi|319780571|ref|YP_004140047.1| GTP-binding protein LepA [Mesorhizobium ciceri biovar biserrulae
           WSM1271]
 gi|317166459|gb|ADV09997.1| GTP-binding protein LepA [Mesorhizobium ciceri biovar biserrulae
           WSM1271]
          Length = 601

 Score =  917 bits (2371), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 428/597 (71%), Positives = 508/597 (85%), Gaps = 1/597 (0%)

Query: 6   TPLSRIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQT 65
           TPL  IRNFSIVAHIDHGKSTLADR IQ   GL  R+M  QVLD+MDIERERGITIKAQT
Sbjct: 3   TPLDHIRNFSIVAHIDHGKSTLADRLIQLTGGLELRDMKEQVLDSMDIERERGITIKAQT 62

Query: 66  VRLNYTSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQ 125
           VRL Y + + +DY LNLIDTPGHVDF YEVSRSL+ACEGSLLVVDA+QGVEAQTLANVYQ
Sbjct: 63  VRLKYRANNGEDYILNLIDTPGHVDFAYEVSRSLAACEGSLLVVDASQGVEAQTLANVYQ 122

Query: 126 AIDNNHEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERIVQ 185
           AIDNNHEI+ VLNK DLP+A+P+R+++Q+EE IGI   +A+L+SAKTG GIP +LE IV 
Sbjct: 123 AIDNNHEIVVVLNKVDLPAAEPERIREQVEEVIGIDASNAVLISAKTGLGIPDVLEAIVH 182

Query: 186 QLPSPTSPEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVER 245
           QLP P   + A APLKA+L+DSWY++YLGV+VLVR+I+G L KGQ+IR+MGT AKY VER
Sbjct: 183 QLPPPREGD-ATAPLKAMLVDSWYDAYLGVIVLVRVIDGVLKKGQTIRMMGTGAKYLVER 241

Query: 246 IGILTPKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVVF 305
            G+ TP  I++E L PGE G    SIKEV+ TRVGDTIT+D   T  ALPGFKP QPVVF
Sbjct: 242 TGVFTPARINVEELGPGEFGFFTGSIKEVADTRVGDTITEDKRATAKALPGFKPAQPVVF 301

Query: 306 CGLFPVDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERLE 365
           CGLFPVDA  FE+LR A+ KLRLNDASFSFE+E S ALGFG+RCGFLGLLHLEIIQERLE
Sbjct: 302 CGLFPVDAADFEDLRAAVGKLRLNDASFSFEMETSAALGFGYRCGFLGLLHLEIIQERLE 361

Query: 366 REFSLNLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEYLG 425
           REF+L+LI T+PSVVY L + DGSM++L NP DMP+V KI+ + EPWI+ TI+TP++YLG
Sbjct: 362 REFNLDLIATAPSVVYRLALTDGSMKELHNPADMPDVVKISAIEEPWIRATILTPDDYLG 421

Query: 426 SILKLCQERRGIQIDMSHLDNRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDYR 485
            ILKLCQ+RRGIQ D+S++  RAM++Y+LPLNEV+FDFYDRLKS+SKGYASFDY++ DYR
Sbjct: 422 GILKLCQDRRGIQADLSYVGKRAMLIYDLPLNEVVFDFYDRLKSISKGYASFDYHLTDYR 481

Query: 486 DSDLVKLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGGRI 545
           + DLVK++ILVN E +DALS+LVHR+ +EKRGR +CEKLK LIP  +F+I IQAAIGG++
Sbjct: 482 EGDLVKMSILVNEEPVDALSMLVHRTAAEKRGRQMCEKLKELIPNHLFKIPIQAAIGGKV 541

Query: 546 IARETVKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISILK 602
           IARET+ A RKDVTAKCYGGD++RKRKLL+KQKEGKKRMR+FG+VDIPQ AFI  LK
Sbjct: 542 IARETISALRKDVTAKCYGGDVSRKRKLLDKQKEGKKRMRQFGKVDIPQEAFIQALK 598


>gi|298292276|ref|YP_003694215.1| GTP-binding protein LepA [Starkeya novella DSM 506]
 gi|296928787|gb|ADH89596.1| GTP-binding protein LepA [Starkeya novella DSM 506]
          Length = 601

 Score =  917 bits (2369), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 425/599 (70%), Positives = 516/599 (86%), Gaps = 2/599 (0%)

Query: 7   PLSRIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTV 66
           P++ IRNFSIVAHIDHGKSTLADR IQ   GL+EREM+ QVLD+MDIERERGITIKAQTV
Sbjct: 5   PVANIRNFSIVAHIDHGKSTLADRLIQQTGGLSEREMTEQVLDSMDIERERGITIKAQTV 64

Query: 67  RLNYTSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQA 126
           RL+YT+ D K+Y LNLIDTPGHVDF YEV+RSL+A EGSLLVVDA+QGVEAQTLANVYQA
Sbjct: 65  RLSYTAKDGKEYVLNLIDTPGHVDFAYEVNRSLAAVEGSLLVVDASQGVEAQTLANVYQA 124

Query: 127 IDNNHEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERIVQQ 186
           IDNNHEI+ VLNK DLP+A+PD+VK+QIE+ IG+   D++L+SAKTG GIP +LE IV +
Sbjct: 125 IDNNHEIVPVLNKVDLPAAEPDKVKEQIEDVIGLDASDSVLISAKTGLGIPDVLEAIVTR 184

Query: 187 LPSPTSPEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVERI 246
           LP P       APLKALL+DSWY+ YLGV+VLVRI++G L KGQ I+++G+NA Y V+R+
Sbjct: 185 LPPPKGDR--EAPLKALLVDSWYDVYLGVVVLVRIVDGVLKKGQRIKMIGSNAVYDVDRV 242

Query: 247 GILTPKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVVFC 306
           G+ TPKM+ +  L PGEIG +  SIKEV+ TRVGDTIT++  PT  ALPGFKP QPVVFC
Sbjct: 243 GVFTPKMVAMTELGPGEIGFLTGSIKEVADTRVGDTITEEKRPTAEALPGFKPAQPVVFC 302

Query: 307 GLFPVDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERLER 366
           GLFPVDA  FE+LR A+ KLRLNDASFSFE+E S ALGFGFRCGFLGLLHLEIIQERLER
Sbjct: 303 GLFPVDAADFEDLRAAMGKLRLNDASFSFEMETSAALGFGFRCGFLGLLHLEIIQERLER 362

Query: 367 EFSLNLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEYLGS 426
           EF+L+LI T+PSV+Y++ M+DG++  L NP DMP+V KI E+REPWI+ TI+TP++YLG+
Sbjct: 363 EFNLDLIATAPSVIYQIEMNDGTVLDLHNPADMPDVVKIKEIREPWIRATILTPDDYLGA 422

Query: 427 ILKLCQERRGIQIDMSHLDNRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDYRD 486
           +LKLCQ+RRG QI+++++ +RAM+ Y+LPLNEV+FDFYDRLKS+SKGYASFDY + DYR 
Sbjct: 423 VLKLCQDRRGNQIELTYVGSRAMVTYDLPLNEVVFDFYDRLKSISKGYASFDYQITDYRP 482

Query: 487 SDLVKLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGGRII 546
            DLVK++ILVN E +DALS+LVHR+ +E RGR +CEKLK+LIPQ +FQI IQAAIG +II
Sbjct: 483 GDLVKMSILVNAEPVDALSMLVHRTRAEYRGRAMCEKLKDLIPQHLFQIPIQAAIGAKII 542

Query: 547 ARETVKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISILKTDN 605
           ARET++A RKDVTAKCYGGDITRKRKLLEKQKEGKK+MR+FG+V+IPQ AFI+ LK D+
Sbjct: 543 ARETIRALRKDVTAKCYGGDITRKRKLLEKQKEGKKKMRQFGKVEIPQEAFIAALKVDD 601


>gi|240849744|ref|YP_002971132.1| GTP-binding protein LepA [Bartonella grahamii as4aup]
 gi|240266867|gb|ACS50455.1| GTP-binding protein LepA [Bartonella grahamii as4aup]
          Length = 601

 Score =  916 bits (2368), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 426/594 (71%), Positives = 515/594 (86%), Gaps = 1/594 (0%)

Query: 11  IRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVRLNY 70
           IRNFSIVAHIDHGKSTLADR IQ   GL  REM  QVLD+MDIERERGITIKAQTVRL+Y
Sbjct: 8   IRNFSIVAHIDHGKSTLADRLIQITGGLDTREMKEQVLDSMDIERERGITIKAQTVRLHY 67

Query: 71  TSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQAIDNN 130
            + + + Y LNL+DTPGHVDF YEVSRSL+ACEGSLLVVDA+QGVEAQTLANVYQAIDN+
Sbjct: 68  KAKNGETYILNLMDTPGHVDFAYEVSRSLAACEGSLLVVDASQGVEAQTLANVYQAIDNS 127

Query: 131 HEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERIVQQLPSP 190
           HE++ VLNK DLP+A+P+RVK+QIE+ IGI T  A+ +SAKTG G+P +LE IV QLP P
Sbjct: 128 HELVVVLNKVDLPAAEPERVKEQIEDVIGIDTSQAVEISAKTGLGVPDVLEAIVTQLPPP 187

Query: 191 TSPEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVERIGILT 250
            + + AN PLKA+L+DSWY++YLGV+VLVR+I+G L KGQ+IR+MGT AKY VER+G+ T
Sbjct: 188 HTGDVAN-PLKAMLVDSWYDAYLGVIVLVRVIDGILKKGQTIRMMGTGAKYPVERVGVFT 246

Query: 251 PKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVVFCGLFP 310
           PKM+ ++ L PGEIG + ASIKEV+ TRVGDTIT++  P  +ALPGFKP QPVVFCGLFP
Sbjct: 247 PKMVQVDELGPGEIGFITASIKEVADTRVGDTITEERRPCENALPGFKPAQPVVFCGLFP 306

Query: 311 VDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERLEREFSL 370
           +DA  F++LR A+ KLRLNDASFSFE+E S ALGFGFRCGFLGLLHLEIIQERLEREF+L
Sbjct: 307 IDAADFDDLRAAMGKLRLNDASFSFEMETSAALGFGFRCGFLGLLHLEIIQERLEREFNL 366

Query: 371 NLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEYLGSILKL 430
           +LI T+PSVVY + M+DGS+++L NP DMP+V KI+ + EPWI+ TI+TP+ YLGSIL+L
Sbjct: 367 DLIATAPSVVYRMNMNDGSVKELHNPADMPDVVKISSIEEPWIRATIMTPDNYLGSILEL 426

Query: 431 CQERRGIQIDMSHLDNRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDYRDSDLV 490
           CQERRGIQ  +S++  RAM+ Y+LPLNEV+FDFYDRLKS+SKGYASFDY + DY + DLV
Sbjct: 427 CQERRGIQAGLSYVGTRAMVTYDLPLNEVVFDFYDRLKSISKGYASFDYQMADYAEGDLV 486

Query: 491 KLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGGRIIARET 550
           K++ILVN E+IDALS+LVHR+++EKRGR +CEKLK+LIPQ MFQI +QAAIGG++IARET
Sbjct: 487 KMSILVNGESIDALSMLVHRTIAEKRGRSMCEKLKDLIPQHMFQIPVQAAIGGKVIARET 546

Query: 551 VKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISILKTD 604
           ++A RKDVTAKCYGGD+TRKRKLLEKQKEGKKRMR+FG+V+IPQSAFI  LK +
Sbjct: 547 IRALRKDVTAKCYGGDVTRKRKLLEKQKEGKKRMRQFGKVEIPQSAFIQALKMN 600


>gi|13473815|ref|NP_105383.1| GTP-binding protein LepA [Mesorhizobium loti MAFF303099]
 gi|24211931|sp|Q98DV1|LEPA_RHILO RecName: Full=Elongation factor 4; Short=EF-4; AltName:
           Full=Ribosomal back-translocase LepA
 gi|14024566|dbj|BAB51169.1| GTP-binding protein; LepA [Mesorhizobium loti MAFF303099]
          Length = 601

 Score =  916 bits (2368), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 427/597 (71%), Positives = 508/597 (85%), Gaps = 1/597 (0%)

Query: 6   TPLSRIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQT 65
           TPL  IRNFSIVAHIDHGKSTLADR IQ   GL  R+M  QVLD+MDIERERGITIKAQT
Sbjct: 3   TPLDHIRNFSIVAHIDHGKSTLADRLIQSTGGLELRDMKEQVLDSMDIERERGITIKAQT 62

Query: 66  VRLNYTSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQ 125
           VRL Y + + +DY LNLIDTPGHVDF YEVSRSL+ACEGSLLVVDA+QGVEAQTLANVYQ
Sbjct: 63  VRLKYRANNGEDYILNLIDTPGHVDFAYEVSRSLAACEGSLLVVDASQGVEAQTLANVYQ 122

Query: 126 AIDNNHEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERIVQ 185
           AIDNNHEI+ VLNK DLP+A+P+R+++Q+EE IGI    A+L+SAKTG GIP +LE IV 
Sbjct: 123 AIDNNHEIVVVLNKVDLPAAEPERIREQVEEVIGIDASGAVLISAKTGLGIPDVLEAIVH 182

Query: 186 QLPSPTSPEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVER 245
           QLP P   + A APLKA+L+DSWY++YLGV+VLVRII+G L KGQ+IR+MGT AKY VER
Sbjct: 183 QLPPPREGD-ATAPLKAMLVDSWYDAYLGVIVLVRIIDGVLKKGQTIRMMGTGAKYLVER 241

Query: 246 IGILTPKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVVF 305
            G+ TP  I+++ L PGE G    SIKEV+ TRVGDTIT+D  PT  ALPGFKP QPVVF
Sbjct: 242 TGVFTPARINVDELGPGEFGFFTGSIKEVADTRVGDTITEDKRPTAQALPGFKPAQPVVF 301

Query: 306 CGLFPVDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERLE 365
           CGLFPVDA  FE+LR A+ KLRLNDASFS+E+E S ALGFG+RCGFLGLLHLEIIQERLE
Sbjct: 302 CGLFPVDAADFEDLRAAVGKLRLNDASFSYEMETSAALGFGYRCGFLGLLHLEIIQERLE 361

Query: 366 REFSLNLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEYLG 425
           REF+L+LI T+PSVVY L ++DGS+++L NP DMP+V KI+ + EPWI+ TI+TP++YLG
Sbjct: 362 REFNLDLIATAPSVVYRLLLNDGSVKELHNPADMPDVVKISAIEEPWIRATILTPDDYLG 421

Query: 426 SILKLCQERRGIQIDMSHLDNRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDYR 485
            ILKLCQ+RRGIQ D+S++  RAM+ Y+LPLNEV+FDFYDRLKS+SKGYASFDY++ DYR
Sbjct: 422 GILKLCQDRRGIQADLSYVGKRAMLTYDLPLNEVVFDFYDRLKSISKGYASFDYHLTDYR 481

Query: 486 DSDLVKLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGGRI 545
           + DLVK++ILVN E +DALS+LVHR+ +EKRGR +CEKLK LIP  +F+I IQAAIGG++
Sbjct: 482 EGDLVKMSILVNEEPVDALSMLVHRTAAEKRGRQMCEKLKELIPHHLFKIPIQAAIGGKV 541

Query: 546 IARETVKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISILK 602
           IARET+ A RKDVTAKCYGGD++RKRKLL+KQKEGKKRMR+FG+VDIPQ AFI  LK
Sbjct: 542 IARETISALRKDVTAKCYGGDVSRKRKLLDKQKEGKKRMRQFGKVDIPQEAFIQALK 598


>gi|304393073|ref|ZP_07375002.1| GTP-binding protein LepA [Ahrensia sp. R2A130]
 gi|303294838|gb|EFL89209.1| GTP-binding protein LepA [Ahrensia sp. R2A130]
          Length = 600

 Score =  915 bits (2365), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 426/597 (71%), Positives = 523/597 (87%), Gaps = 1/597 (0%)

Query: 6   TPLSRIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQT 65
           T LS+IRNFSIVAHIDHGKST+ADR IQ C GLT REMS QVLDNMDIERERGITIKAQT
Sbjct: 2   TELSKIRNFSIVAHIDHGKSTVADRLIQMCGGLTNREMSEQVLDNMDIERERGITIKAQT 61

Query: 66  VRLNYTSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQ 125
           VRL+YT+ D ++Y LNLIDTPGHVDF YEVSRSLSACEGSLLVVDA+QGVEAQTLANVYQ
Sbjct: 62  VRLHYTAKDGEEYVLNLIDTPGHVDFAYEVSRSLSACEGSLLVVDASQGVEAQTLANVYQ 121

Query: 126 AIDNNHEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERIVQ 185
           AIDN+HEI+TVLNK DLP+A+P+RVK+QIEE IGI   DA+ +SAKTG+G+  +LE IV 
Sbjct: 122 AIDNDHEIVTVLNKIDLPAAEPERVKEQIEEVIGIDATDAVEISAKTGQGMEDVLEAIVT 181

Query: 186 QLPSPTSPEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVER 245
           +LP+P+  +  NAPLKALL+DSWY++YLGV+VLVR+I+G+L KGQ+IR+MGT+AK+ V+R
Sbjct: 182 RLPAPSIGD-RNAPLKALLVDSWYDAYLGVIVLVRVIDGELRKGQTIRMMGTDAKHPVDR 240

Query: 246 IGILTPKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVVF 305
           +G+++PK+ +I+ L PGEIG + ASIKEV+ TRVGDTIT+D   T +ALPGFKP QPVVF
Sbjct: 241 VGVISPKLTEIDHLGPGEIGFITASIKEVADTRVGDTITEDKRQTGNALPGFKPAQPVVF 300

Query: 306 CGLFPVDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERLE 365
           CGLFPVDA  FE+LR+A+ KLRLNDASFS+E+E+S ALGFGFRCGFLGLLHLEI+QERLE
Sbjct: 301 CGLFPVDAADFEDLRSAVGKLRLNDASFSYEMESSAALGFGFRCGFLGLLHLEIVQERLE 360

Query: 366 REFSLNLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEYLG 425
           REF+L+LI T+PSVVY+++M D ++  L NP DMP+V +I E+ EPWI+ TI+TP+EYLG
Sbjct: 361 REFNLDLIATAPSVVYDMHMRDETVLNLHNPADMPDVMQIMEIHEPWIKATILTPDEYLG 420

Query: 426 SILKLCQERRGIQIDMSHLDNRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDYR 485
           +ILKLCQ+RRGIQ ++++   RAMI YELPLNEV+FDFYDRLKS+S+GYASFDY + +YR
Sbjct: 421 AILKLCQDRRGIQTNLTYAGPRAMIEYELPLNEVVFDFYDRLKSISRGYASFDYQMKEYR 480

Query: 486 DSDLVKLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGGRI 545
           + DLVKL++LVN E +DALS+LVHRSV+  RGR +CEKLK+LIP+ +F+I IQAAIGG +
Sbjct: 481 EGDLVKLSVLVNGEPVDALSMLVHRSVAATRGRVMCEKLKDLIPKHLFKIPIQAAIGGNV 540

Query: 546 IARETVKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISILK 602
           IARET+ A RKDVTAKCYGGD +RKRKLL+KQK GKK+MR+FG+V+IPQ+AFI  LK
Sbjct: 541 IARETISAMRKDVTAKCYGGDASRKRKLLDKQKAGKKKMRQFGKVEIPQTAFIEALK 597


>gi|163867371|ref|YP_001608565.1| GTP-binding protein LepA [Bartonella tribocorum CIP 105476]
 gi|161017012|emb|CAK00570.1| GTP-binding protein LepA [Bartonella tribocorum CIP 105476]
          Length = 613

 Score =  915 bits (2365), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 429/595 (72%), Positives = 513/595 (86%), Gaps = 1/595 (0%)

Query: 11  IRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVRLNY 70
           IRNFSIVAHIDHGKSTLADR IQ   GL  REM  QVLD+MDIERERGITIKAQTVRL+Y
Sbjct: 20  IRNFSIVAHIDHGKSTLADRLIQMTGGLDTREMKEQVLDSMDIERERGITIKAQTVRLHY 79

Query: 71  TSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQAIDNN 130
            + + + Y LNL+DTPGHVDF YEVSRSL+ACEGSLLVVDA+QGVEAQTLANVYQAIDN+
Sbjct: 80  KAKNGETYILNLMDTPGHVDFAYEVSRSLAACEGSLLVVDASQGVEAQTLANVYQAIDNS 139

Query: 131 HEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERIVQQLPSP 190
           HE++ VLNK DLP+A+P+RVK+QIE+ IGI T  A+ +SAKTG GIP +LE IV QLP P
Sbjct: 140 HELVVVLNKIDLPAAEPERVKEQIEDVIGIDTSQAVEISAKTGLGIPDVLEAIVTQLPPP 199

Query: 191 TSPEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVERIGILT 250
              +  N PLKA+L+DSWY++YLGV+VLVR+I+G L KGQ+IR+MGT AKY VER+G+ T
Sbjct: 200 RIGDVTN-PLKAMLVDSWYDAYLGVIVLVRVIDGILKKGQTIRMMGTGAKYPVERVGVFT 258

Query: 251 PKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVVFCGLFP 310
           PKM+ ++ L PGEIG + ASIKEV+ TRVGDTIT++  P  +ALPGFKP QPVVFCGLFP
Sbjct: 259 PKMVQVDELGPGEIGFITASIKEVADTRVGDTITEERRPCENALPGFKPAQPVVFCGLFP 318

Query: 311 VDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERLEREFSL 370
           +DA  F++LR A+ KLRLNDASFSFE+E S ALGFGFRCGFLGLLHLEIIQERLEREF+L
Sbjct: 319 IDAADFDDLRAAMGKLRLNDASFSFEMETSAALGFGFRCGFLGLLHLEIIQERLEREFNL 378

Query: 371 NLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEYLGSILKL 430
           +LI T+PSVVY + M+DGS+++L NP DMP+V KI+ + EPWI+ TI+TP+ YLGSIL+L
Sbjct: 379 DLIATAPSVVYRMNMNDGSVKELHNPADMPDVVKISSIEEPWIRATIMTPDNYLGSILEL 438

Query: 431 CQERRGIQIDMSHLDNRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDYRDSDLV 490
           CQERRGIQ+ +S++  RAM+ Y+LPLNEV+FDFYDRLKS+SKGYASFDY + DY + DLV
Sbjct: 439 CQERRGIQVGLSYVGTRAMVTYDLPLNEVVFDFYDRLKSISKGYASFDYQMTDYAEGDLV 498

Query: 491 KLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGGRIIARET 550
           K++ILVN E IDALS+LVHR+++EKRGR +CEKLK+LIPQ MFQI IQAAIGG+IIARET
Sbjct: 499 KMSILVNGEPIDALSMLVHRTIAEKRGRSMCEKLKDLIPQHMFQIPIQAAIGGKIIARET 558

Query: 551 VKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISILKTDN 605
           ++A RKDVTAKCYGGDITRKRKLLEKQKEGKKRMR+FG+V+IPQSAFI  LK + 
Sbjct: 559 IRALRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRQFGKVEIPQSAFIQALKMNK 613


>gi|319403558|emb|CBI77140.1| GTP-binding protein LepA [Bartonella rochalimae ATCC BAA-1498]
          Length = 601

 Score =  911 bits (2354), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 427/592 (72%), Positives = 507/592 (85%), Gaps = 1/592 (0%)

Query: 11  IRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVRLNY 70
           IRNFSIVAHIDHGKSTLADR IQ   GL  REM  QVLD+MDIERERGITIKAQTVRLNY
Sbjct: 8   IRNFSIVAHIDHGKSTLADRLIQMTGGLETREMKEQVLDSMDIERERGITIKAQTVRLNY 67

Query: 71  TSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQAIDNN 130
            + + + Y LNLIDTPGHVDF YEVSRSL+ACEGSLLVVDA+QGVEAQTLANVYQAIDN+
Sbjct: 68  KAKNGETYILNLIDTPGHVDFAYEVSRSLAACEGSLLVVDASQGVEAQTLANVYQAIDNS 127

Query: 131 HEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERIVQQLPSP 190
           HE++ VLNK DLP+A+P+RVK+QIE+ IGI T  A+ +SAKTG GI  +LE I+ QLP P
Sbjct: 128 HELVVVLNKIDLPAAEPERVKEQIEDVIGIDTSRAVEISAKTGLGISDVLEEIITQLPPP 187

Query: 191 TSPEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVERIGILT 250
            +    + PLK +L+DSWY++YLGV+VLVR+I+G L KGQ+IR+MGT AKY VER+G+ T
Sbjct: 188 HTGNTTD-PLKVMLVDSWYDAYLGVIVLVRVIDGVLKKGQTIRMMGTGAKYPVERVGVFT 246

Query: 251 PKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVVFCGLFP 310
           PKMI ++ L PGEIG + ASIKEV+ TRVGDTIT+D  P    LPGFKP QPVVFCG+FP
Sbjct: 247 PKMISVDELGPGEIGFITASIKEVADTRVGDTITEDRRPCEDVLPGFKPAQPVVFCGIFP 306

Query: 311 VDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERLEREFSL 370
           VDA  FENLRTA+ KLRLNDASFSFE+E S ALGFGFRCGFLGLLHLEIIQERLEREF+L
Sbjct: 307 VDAADFENLRTAMGKLRLNDASFSFEMETSAALGFGFRCGFLGLLHLEIIQERLEREFNL 366

Query: 371 NLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEYLGSILKL 430
           +LI T+PSV+Y + M+DGS+++L NP DMP++ K+  + EPWI+ TI+TP+ YLG+IL+L
Sbjct: 367 DLIATAPSVIYRMNMNDGSVKELHNPADMPDIVKVISIEEPWIRATIMTPDNYLGAILEL 426

Query: 431 CQERRGIQIDMSHLDNRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDYRDSDLV 490
           CQERRG+Q  +S++  R+M+ Y+LPLNEVIFDFYDRLKS+SKGYASFDY V DY + DLV
Sbjct: 427 CQERRGLQTGLSYVGTRSMVTYDLPLNEVIFDFYDRLKSISKGYASFDYQVTDYSEGDLV 486

Query: 491 KLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGGRIIARET 550
           K++ILVN E+IDALS+LVHRS++EKRGR +CEKLK+LIPQ MFQI IQAAIGG+IIARET
Sbjct: 487 KMSILVNGESIDALSMLVHRSIAEKRGRSMCEKLKDLIPQHMFQIPIQAAIGGKIIARET 546

Query: 551 VKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISILK 602
           ++A RKDVTAKCYGGDITRKRKLLEKQK GKKRMR+FG+V+IPQSAFI  LK
Sbjct: 547 IRALRKDVTAKCYGGDITRKRKLLEKQKAGKKRMRQFGKVEIPQSAFIEALK 598


>gi|220925274|ref|YP_002500576.1| GTP-binding protein LepA [Methylobacterium nodulans ORS 2060]
 gi|254808739|sp|B8IMT0|LEPA_METNO RecName: Full=Elongation factor 4; Short=EF-4; AltName:
           Full=Ribosomal back-translocase LepA
 gi|219949881|gb|ACL60273.1| GTP-binding protein LepA [Methylobacterium nodulans ORS 2060]
          Length = 601

 Score =  910 bits (2353), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 426/599 (71%), Positives = 512/599 (85%), Gaps = 2/599 (0%)

Query: 7   PLSRIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTV 66
           P+  IRNFSIVAHIDHGKSTLADR IQ    L+ REM+ QVLD+MDIERERGITIKAQTV
Sbjct: 5   PIDTIRNFSIVAHIDHGKSTLADRLIQLTGALSAREMTEQVLDSMDIERERGITIKAQTV 64

Query: 67  RLNYTSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQA 126
           RL+YT+ D + Y LNL+DTPGHVDFTYEVSRSL+ACEGSLLVVDA+QGVEAQTLANVYQA
Sbjct: 65  RLDYTAQDGRTYILNLMDTPGHVDFTYEVSRSLAACEGSLLVVDASQGVEAQTLANVYQA 124

Query: 127 IDNNHEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERIVQQ 186
           ID NHEI+ VLNK DLP+A+PDRVK+QIEE IGI   +A+ +SAKTG  I  +LE IV +
Sbjct: 125 IDANHEIVPVLNKIDLPAAEPDRVKQQIEEVIGIDASEAVPISAKTGLNIEAVLEAIVAK 184

Query: 187 LPSPTSPEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVERI 246
           LP P     A  PLKALL+DSWY+ YLGV+VLVRI++G L KG +IR+MG +A Y V+RI
Sbjct: 185 LPPPKGDRAA--PLKALLVDSWYDVYLGVVVLVRIVDGVLKKGMTIRMMGADAVYGVDRI 242

Query: 247 GILTPKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVVFC 306
           G+  PKM D+  L PGE+G + ASIKEV+ TRVGDTIT+D  PT S LPGFKP+QPVVFC
Sbjct: 243 GVFRPKMQDVAELGPGEVGFLTASIKEVADTRVGDTITEDRRPTDSPLPGFKPVQPVVFC 302

Query: 307 GLFPVDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERLER 366
           GLFPVDA +FENLR A+ KLRLNDASFS+E+E S ALGFGFRCGFLGLLHLEIIQERLER
Sbjct: 303 GLFPVDAAEFENLRAAMGKLRLNDASFSYEMETSAALGFGFRCGFLGLLHLEIIQERLER 362

Query: 367 EFSLNLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEYLGS 426
           EF+L+LI T+PSVVY L M DG+M++L NP DMP+V KI  + EPWI+ TI+TP++YLGS
Sbjct: 363 EFNLDLISTAPSVVYRLNMSDGTMRELHNPADMPDVMKIDTIEEPWIRATILTPDDYLGS 422

Query: 427 ILKLCQERRGIQIDMSHLDNRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDYRD 486
           +LKLCQ+RRG QID++++  RAM+VY+LPLNEV+FDFYDRLKS+SKGYASFDY++ DYR+
Sbjct: 423 VLKLCQDRRGTQIDLNYVGKRAMVVYDLPLNEVVFDFYDRLKSISKGYASFDYHISDYRE 482

Query: 487 SDLVKLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGGRII 546
            DLVK++ILVN+E +DALS+LVHR+ +E RGR +CEKLK+LIP+ +FQI +QAAIGG+II
Sbjct: 483 GDLVKMSILVNSEPVDALSMLVHRTRAESRGRAMCEKLKDLIPRHLFQIPVQAAIGGKII 542

Query: 547 ARETVKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISILKTDN 605
           ARET++A  KDVTAKCYGGDI+RKRKLL+KQKEGKKRMR+FG+V+IPQ AFI+ LK D+
Sbjct: 543 ARETIRALSKDVTAKCYGGDISRKRKLLDKQKEGKKRMRQFGKVEIPQEAFIAALKMDS 601


>gi|163757691|ref|ZP_02164780.1| GTP-binding elongation factor protein [Hoeflea phototrophica
           DFL-43]
 gi|162285193|gb|EDQ35475.1| GTP-binding elongation factor protein [Hoeflea phototrophica
           DFL-43]
          Length = 602

 Score =  910 bits (2351), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 425/597 (71%), Positives = 507/597 (84%), Gaps = 1/597 (0%)

Query: 6   TPLSRIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQT 65
           TPLS IRNFSIVAHIDHGKSTLADR IQ C GL EREMS QVLD+MDIE+ERGITIKAQT
Sbjct: 4   TPLSHIRNFSIVAHIDHGKSTLADRLIQTCGGLAEREMSQQVLDSMDIEKERGITIKAQT 63

Query: 66  VRLNYTSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQ 125
           VRL+Y + D + Y LNLIDTPGHVDF YEVSRSL ACEGSLLVVDA+QGVEAQTLANVY 
Sbjct: 64  VRLHYKAKDGEMYVLNLIDTPGHVDFAYEVSRSLRACEGSLLVVDASQGVEAQTLANVYA 123

Query: 126 AIDNNHEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERIVQ 185
           A+D +HEI+ VLNK DLP+A+PDR+K+QIEE IG+   DA+++SAKTG GIP +LE IV 
Sbjct: 124 ALDADHEIVPVLNKIDLPAAEPDRIKEQIEEVIGLDASDAVMISAKTGIGIPEVLEAIVT 183

Query: 186 QLPSPTSPEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVER 245
           +LP+P      +A LKA+L+DSWY++YLGV+VLVR+I+G++ KGQ IRLMGT A+Y VER
Sbjct: 184 RLPAPKGGTTKDA-LKAMLVDSWYDTYLGVIVLVRVIDGEMKKGQQIRLMGTGARYTVER 242

Query: 246 IGILTPKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVVF 305
           IGI+TPK++  + L PGEIG + ASIKEV+ TRVGDTIT++  PT  ALPGFKP QPVVF
Sbjct: 243 IGIITPKLVATDTLGPGEIGFITASIKEVADTRVGDTITEEKHPTAEALPGFKPAQPVVF 302

Query: 306 CGLFPVDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERLE 365
           CGLFPVDA  FE+LR A+ KLRLNDASFSFE+E S ALGFGFRCGFLGLLHLEIIQERLE
Sbjct: 303 CGLFPVDAADFEDLRAAMGKLRLNDASFSFEMETSAALGFGFRCGFLGLLHLEIIQERLE 362

Query: 366 REFSLNLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEYLG 425
           REF+L+LI T+PSVVY + M +G + +L NP DMP+V KIA + EPWI+ TI+TP++YLG
Sbjct: 363 REFNLDLIATAPSVVYRMNMTNGDVIELHNPADMPDVVKIASIEEPWIKATILTPDDYLG 422

Query: 426 SILKLCQERRGIQIDMSHLDNRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDYR 485
            ILKLCQERRGIQ D+S++  RAM+ Y+LPLNEV+FDFYDRLKS++KGYASFDY +  + 
Sbjct: 423 PILKLCQERRGIQTDLSYVGKRAMVTYQLPLNEVVFDFYDRLKSITKGYASFDYQITGHE 482

Query: 486 DSDLVKLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGGRI 545
             DLV+++ILVN E +DALS+LVHRS +EKRGR +CEKLK+LIP+ MF+I IQAAIGGR+
Sbjct: 483 AGDLVRMSILVNEEPVDALSMLVHRSAAEKRGRVMCEKLKDLIPRHMFKIPIQAAIGGRV 542

Query: 546 IARETVKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISILK 602
           +ARET+ A RKDVTAKCYGGD TRKRKLL+KQK GKKRMR+FG+V+IPQ AFI  LK
Sbjct: 543 VARETISAMRKDVTAKCYGGDATRKRKLLDKQKAGKKRMRQFGKVEIPQEAFIEALK 599


>gi|118589640|ref|ZP_01547045.1| GTP-binding protein LepA [Stappia aggregata IAM 12614]
 gi|118437726|gb|EAV44362.1| GTP-binding protein LepA [Stappia aggregata IAM 12614]
          Length = 601

 Score =  909 bits (2349), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 426/599 (71%), Positives = 509/599 (84%), Gaps = 4/599 (0%)

Query: 8   LSRIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVR 67
           LS IRNFSIVAHIDHGKSTLADR IQ    LT+REM+ QVLD+MDIERERGITIKAQTVR
Sbjct: 6   LSNIRNFSIVAHIDHGKSTLADRLIQMTGTLTDREMTEQVLDSMDIERERGITIKAQTVR 65

Query: 68  LNYTSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQAI 127
           L Y + D + Y LNLIDTPGHVDF YEVSRSL+ACEGSLLVVDA+QGVEAQTLANVYQAI
Sbjct: 66  LIYNAKDGEQYTLNLIDTPGHVDFAYEVSRSLAACEGSLLVVDASQGVEAQTLANVYQAI 125

Query: 128 DNNHEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERIVQQL 187
           DN+HEI+TVLNK DLP+A+PDR+K+QIE+ IGI   +A ++SAKTG G+  +LE IV++L
Sbjct: 126 DNDHEIVTVLNKIDLPAAEPDRIKEQIEDVIGIDASEACMISAKTGLGVDDVLEAIVKKL 185

Query: 188 PSPTSPEG-ANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVERI 246
           P P   EG  +A LKA+L+DSWY++YLGVMVLVR+I+G L +GQ I++MGT A Y V+R+
Sbjct: 186 PPP---EGDPDATLKAMLVDSWYDTYLGVMVLVRVIDGSLKRGQKIKMMGTGAAYDVDRV 242

Query: 247 GILTPKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVVFC 306
           G++TPK + ++ L+ GEIGV+  SIKEV+ TRVGDTIT +  P T ALPGFKP QPVVFC
Sbjct: 243 GVMTPKFLQVDELHAGEIGVITGSIKEVADTRVGDTITLEKKPCTQALPGFKPAQPVVFC 302

Query: 307 GLFPVDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERLER 366
           GLFPVDA  FE+LR A+ KLRLNDASFSFE+E S ALGFGFRCGFLGLLHLEIIQERL R
Sbjct: 303 GLFPVDANDFEDLRAAMGKLRLNDASFSFEMETSAALGFGFRCGFLGLLHLEIIQERLYR 362

Query: 367 EFSLNLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEYLGS 426
           EF L+LI T+PSVVY++ + DGS  +L NP DMP+V KI+E+REPWI+ TI+TP+EYLG 
Sbjct: 363 EFDLDLIATAPSVVYQMSLTDGSDVELHNPADMPDVVKISEIREPWIRATIMTPDEYLGG 422

Query: 427 ILKLCQERRGIQIDMSHLDNRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDYRD 486
           ILKLCQERRG+QID+S++ +RAM+ Y+LPLNEV+FDFYDRLKS+SKGYASFDY + DYR 
Sbjct: 423 ILKLCQERRGLQIDLSYVGSRAMVTYDLPLNEVVFDFYDRLKSISKGYASFDYQISDYRA 482

Query: 487 SDLVKLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGGRII 546
            DLV+++ILVN E +DALS+LVHRS +E+RGR +CEKLK LIP+ MF+I IQAAIGGR+I
Sbjct: 483 GDLVRMSILVNEEPVDALSVLVHRSQAERRGRAMCEKLKELIPRHMFKIPIQAAIGGRVI 542

Query: 547 ARETVKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISILKTDN 605
           ARET+ A RKDVTAKCYGGD TRKRKLLEKQK GKK+MR+FG+V+IPQ AFI  LK D 
Sbjct: 543 ARETISALRKDVTAKCYGGDATRKRKLLEKQKAGKKKMRQFGKVEIPQEAFIQALKMDE 601


>gi|110636399|ref|YP_676607.1| GTP-binding protein LepA [Mesorhizobium sp. BNC1]
 gi|119371365|sp|Q11AY3|LEPA_MESSB RecName: Full=Elongation factor 4; Short=EF-4; AltName:
           Full=Ribosomal back-translocase LepA
 gi|110287383|gb|ABG65442.1| GTP-binding protein LepA [Chelativorans sp. BNC1]
          Length = 605

 Score =  909 bits (2348), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 425/597 (71%), Positives = 508/597 (85%), Gaps = 1/597 (0%)

Query: 6   TPLSRIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQT 65
           TP+  IRNF+IVAHIDHGKSTLADR IQ    L EREM  QVLD+MDIERERGITIKA T
Sbjct: 7   TPIKNIRNFAIVAHIDHGKSTLADRLIQMTGSLEEREMKEQVLDSMDIERERGITIKANT 66

Query: 66  VRLNYTSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQ 125
           VRL Y + D + Y LNLIDTPGHVDF YEVSRSL+ACE SLLVVDA+QGVEAQTLANVYQ
Sbjct: 67  VRLEYDARDGEHYVLNLIDTPGHVDFAYEVSRSLAACESSLLVVDASQGVEAQTLANVYQ 126

Query: 126 AIDNNHEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERIVQ 185
           AIDNNHEI+ VLNK DLP+A+P+RVK QIE+ IG+   DA+ +SAKTG G+  +LE IV 
Sbjct: 127 AIDNNHEIVPVLNKVDLPAAEPERVKAQIEDVIGLDASDAIPISAKTGVGVDEVLEAIVM 186

Query: 186 QLPSPTSPEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVER 245
           +LP P   + A+APLKALL+DSWY++YLGV+VLVRII+G L KGQ++R+MGT A+Y V+R
Sbjct: 187 RLPPPHEGD-ASAPLKALLVDSWYDAYLGVIVLVRIIDGVLKKGQTVRMMGTGARYPVDR 245

Query: 246 IGILTPKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVVF 305
           +G++TPKM+ +E+L PGEIG + ASIKEV+ TRVGDTIT+D   T +ALPGFKP QPVVF
Sbjct: 246 VGVMTPKMVMVESLGPGEIGFITASIKEVADTRVGDTITEDKRATAAALPGFKPAQPVVF 305

Query: 306 CGLFPVDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERLE 365
           CGLFPVDA  FE+LR A+ KLRLNDASFS+E+E S ALGFGFRCGFLGLLHLEIIQERL 
Sbjct: 306 CGLFPVDAADFEDLRAAVGKLRLNDASFSYEMETSAALGFGFRCGFLGLLHLEIIQERLT 365

Query: 366 REFSLNLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEYLG 425
           REF L+LI T+PSVVY + + DG   +L NP DMP+  KIAE+ EPWI+ TI+TP+E+LG
Sbjct: 366 REFDLDLIATAPSVVYRMNLTDGKTVELHNPADMPDPVKIAEIEEPWIRATILTPDEHLG 425

Query: 426 SILKLCQERRGIQIDMSHLDNRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDYR 485
            ILKLCQ+RRG+Q D+S+  +RAM+VY+LPLNEV+FDFYDRLKS+S+GYASFDY++ DYR
Sbjct: 426 GILKLCQDRRGVQADLSYAGSRAMLVYDLPLNEVVFDFYDRLKSISRGYASFDYHLTDYR 485

Query: 486 DSDLVKLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGGRI 545
           + DLVK++ILVN+E +DALS+LVHRS +E+RGR +CEKLK LIPQ MF+I IQAAIGGRI
Sbjct: 486 EGDLVKMSILVNDEPVDALSMLVHRSQAERRGRAMCEKLKELIPQHMFKIPIQAAIGGRI 545

Query: 546 IARETVKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISILK 602
           IARET+ A RKDVTAKCYGGD+TRKRKLLEKQKEGKK+MR+FG+V+IPQ AFI  LK
Sbjct: 546 IARETISALRKDVTAKCYGGDVTRKRKLLEKQKEGKKKMRQFGKVEIPQEAFIQALK 602


>gi|319406471|emb|CBI80112.1| GTP-binding protein LepA [Bartonella sp. 1-1C]
          Length = 601

 Score =  908 bits (2347), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 426/592 (71%), Positives = 507/592 (85%), Gaps = 1/592 (0%)

Query: 11  IRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVRLNY 70
           IRNFSIVAHIDHGKSTLADR IQ   GL  REM  QVLD+MDIERERGITIKAQTVRL+Y
Sbjct: 8   IRNFSIVAHIDHGKSTLADRLIQMTGGLETREMKEQVLDSMDIERERGITIKAQTVRLHY 67

Query: 71  TSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQAIDNN 130
            + + + Y LNLIDTPGHVDF YEVSRSL+ACEGSLLVVDA+QGVEAQTLANVYQAIDN+
Sbjct: 68  KAKNGETYILNLIDTPGHVDFAYEVSRSLAACEGSLLVVDASQGVEAQTLANVYQAIDNS 127

Query: 131 HEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERIVQQLPSP 190
           HE++ VLNK DLP+A+P+RVK+QIE+ IGI T  A+ +SAKTG GI  +LE I+ QLP P
Sbjct: 128 HELVVVLNKIDLPAAEPERVKEQIEDVIGIDTSRAVEISAKTGLGISDVLEEIITQLPPP 187

Query: 191 TSPEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVERIGILT 250
            +    + PLK +L+DSWY++YLGV+VLVR+I+G L KGQ+IR+MGT AKY VER+G+ T
Sbjct: 188 HTGNITD-PLKVMLVDSWYDAYLGVIVLVRVIDGVLKKGQTIRMMGTGAKYPVERVGVFT 246

Query: 251 PKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVVFCGLFP 310
           PKMI ++ L PGEIG + ASIKEV+ TRVGDTIT+D  P    LPGFKP QPVVFCG+FP
Sbjct: 247 PKMISVDELGPGEIGFITASIKEVADTRVGDTITEDRRPCKDVLPGFKPAQPVVFCGIFP 306

Query: 311 VDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERLEREFSL 370
           VDA  FENLRTA+ KLRLNDASFSFE+E S ALGFGFRCGFLGLLHLEIIQERLEREF+L
Sbjct: 307 VDAADFENLRTAMGKLRLNDASFSFEMETSAALGFGFRCGFLGLLHLEIIQERLEREFNL 366

Query: 371 NLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEYLGSILKL 430
           +LI T+PSV+Y + M+DGS+++L NP DMP++ K+  + EPWI+ TI+TP+ YLG+IL+L
Sbjct: 367 DLIATAPSVIYRMNMNDGSVKELHNPADMPDIVKVISIEEPWIRATIMTPDNYLGAILEL 426

Query: 431 CQERRGIQIDMSHLDNRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDYRDSDLV 490
           CQERRG+Q  +S++  R+M+ Y+LPLNEVIFDFYDRLKS+SKGYASFDY V DY + DLV
Sbjct: 427 CQERRGLQTGLSYVGTRSMVTYDLPLNEVIFDFYDRLKSISKGYASFDYQVTDYSEGDLV 486

Query: 491 KLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGGRIIARET 550
           K++ILVN E+IDALS+LVHRS++EKRGR +CEKLK+LIPQ MFQI IQAAIGG+IIARET
Sbjct: 487 KMSILVNGESIDALSMLVHRSIAEKRGRSMCEKLKDLIPQHMFQIPIQAAIGGKIIARET 546

Query: 551 VKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISILK 602
           ++A RKDVTAKCYGGDITRKRKLLEKQK GKKRMR+FG+V+IPQSAFI  LK
Sbjct: 547 IRALRKDVTAKCYGGDITRKRKLLEKQKAGKKRMRQFGKVEIPQSAFIEALK 598


>gi|260467413|ref|ZP_05813584.1| GTP-binding protein LepA [Mesorhizobium opportunistum WSM2075]
 gi|259028809|gb|EEW30114.1| GTP-binding protein LepA [Mesorhizobium opportunistum WSM2075]
          Length = 601

 Score =  908 bits (2347), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 425/597 (71%), Positives = 507/597 (84%), Gaps = 1/597 (0%)

Query: 6   TPLSRIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQT 65
           TPL  IRNFSIVAHIDHGKSTLADR IQ   GL  R+M  QVLD+MDIERERGITIKAQT
Sbjct: 3   TPLDHIRNFSIVAHIDHGKSTLADRLIQSTGGLELRDMKEQVLDSMDIERERGITIKAQT 62

Query: 66  VRLNYTSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQ 125
           VRL Y + + +DY LNLIDTPGHVDF YEVSRSL+ACEGSLLVVDA+QGVEAQTLANVYQ
Sbjct: 63  VRLKYRALNGEDYILNLIDTPGHVDFAYEVSRSLAACEGSLLVVDASQGVEAQTLANVYQ 122

Query: 126 AIDNNHEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERIVQ 185
           AIDNNHEI+ VLNK DLP+A+P+R+++Q+EE IGI   +A+L+SAKTG GIP +LE IV 
Sbjct: 123 AIDNNHEIVVVLNKVDLPAAEPERIREQVEEVIGIDASNAVLISAKTGLGIPDVLEAIVH 182

Query: 186 QLPSPTSPEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVER 245
           QLP P   + A+APLKA+L+DSWY++YLGV+VLVRII+G L KGQ+IR+MGT AKY VER
Sbjct: 183 QLPPPREGD-ASAPLKAMLVDSWYDAYLGVIVLVRIIDGVLKKGQTIRMMGTGAKYLVER 241

Query: 246 IGILTPKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVVF 305
            G+ TP  I+++ L PGE G    SIKEV+ TRVGDTIT+D   T  ALPGFKP QPVVF
Sbjct: 242 TGVFTPARINVDELGPGEFGFFTGSIKEVADTRVGDTITEDKRQTAHALPGFKPAQPVVF 301

Query: 306 CGLFPVDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERLE 365
           CGLFPVDA  FE+LR A+ KLRLNDASFS+E+E S ALGFG+RCGFLGLLHLEIIQERLE
Sbjct: 302 CGLFPVDAADFEDLRAAVGKLRLNDASFSYEMETSAALGFGYRCGFLGLLHLEIIQERLE 361

Query: 366 REFSLNLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEYLG 425
           REF+L+LI T+PSVVY L ++DGSM++L NP DMP+V KI+ + EPWI+ TI+TP++YLG
Sbjct: 362 REFNLDLIATAPSVVYRLLLNDGSMKELHNPADMPDVVKISAIEEPWIRATILTPDDYLG 421

Query: 426 SILKLCQERRGIQIDMSHLDNRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDYR 485
            ILKLCQ+RRGIQ D+S++  RAM+ Y+LPLNEV+FDFYDRLKS+SKGYASFDY++ DYR
Sbjct: 422 GILKLCQDRRGIQADLSYVGKRAMLTYDLPLNEVVFDFYDRLKSISKGYASFDYHLTDYR 481

Query: 486 DSDLVKLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGGRI 545
           + DLVK++ILVN E +DALS+LVHR+ +EKRGR + EKLK LIP  +F+I IQAAIGG++
Sbjct: 482 EGDLVKMSILVNEEPVDALSMLVHRTAAEKRGRQMVEKLKELIPHHLFKIPIQAAIGGKV 541

Query: 546 IARETVKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISILK 602
           IARET+ A RKDVTAK YGGD++RKRKLL+KQKEGKKRMR+FG+VDIPQ AFI  LK
Sbjct: 542 IARETISALRKDVTAKSYGGDVSRKRKLLDKQKEGKKRMRQFGKVDIPQEAFIQALK 598


>gi|90418853|ref|ZP_01226764.1| GTP-binding elongation factor [Aurantimonas manganoxydans SI85-9A1]
 gi|90336933|gb|EAS50638.1| GTP-binding elongation factor [Aurantimonas manganoxydans SI85-9A1]
          Length = 603

 Score =  908 bits (2346), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 421/600 (70%), Positives = 515/600 (85%), Gaps = 1/600 (0%)

Query: 6   TPLSRIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQT 65
           TPL  IRNFSIVAHIDHGKSTLADR IQ   GL  R+M +QVLD+MDIERERGITIKAQT
Sbjct: 5   TPLDHIRNFSIVAHIDHGKSTLADRLIQSTGGLELRDMKAQVLDSMDIERERGITIKAQT 64

Query: 66  VRLNYTSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQ 125
           VRL+YT+ + + Y LNLIDTPGHVDF YEVSRSL+ACEG+LLVVDA QGVEAQTLANVY 
Sbjct: 65  VRLHYTAKNGETYVLNLIDTPGHVDFAYEVSRSLAACEGALLVVDAAQGVEAQTLANVYL 124

Query: 126 AIDNNHEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERIVQ 185
           A+D N EI+ VLNK DLP+A+PD+VK+QIEE IG+   DA+++SAK+G GI  +LE IV 
Sbjct: 125 ALDANLEIVPVLNKIDLPAAEPDKVKEQIEEVIGLDASDAVMISAKSGLGIEDVLEAIVH 184

Query: 186 QLPSPTSPEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVER 245
           +LP+PT  +   APLKA+L+DSWY++YLGV+VLVRII+G+L KGQ+IR+MGT+A+Y V+R
Sbjct: 185 RLPAPTEGD-RKAPLKAMLVDSWYDAYLGVIVLVRIIDGELKKGQTIRMMGTDARYPVDR 243

Query: 246 IGILTPKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVVF 305
           +G+ TP M+ +EAL PGE+G + ASIKEV+ TRVGDTITDD   TTS LPGFKP QPVVF
Sbjct: 244 VGVFTPAMVQVEALGPGELGFITASIKEVADTRVGDTITDDKRQTTSMLPGFKPAQPVVF 303

Query: 306 CGLFPVDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERLE 365
           CGLFPVDA+ F+ LR A+ KLRLNDASFS+E+E+S ALGFGFRCGFLGLLHLEI+QERL 
Sbjct: 304 CGLFPVDASDFDELRAAMGKLRLNDASFSYEMESSAALGFGFRCGFLGLLHLEIVQERLS 363

Query: 366 REFSLNLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEYLG 425
           REF L+LI T+PSVVY++ + DGS  +L NP DMP+V K+AE+ EPWI+ TI+TP++YLG
Sbjct: 364 REFDLDLIATAPSVVYDIKLTDGSTIQLHNPADMPDVMKVAEIHEPWIKATILTPDDYLG 423

Query: 426 SILKLCQERRGIQIDMSHLDNRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDYR 485
           +IL+LCQERRG Q D+S++  RAM+ YELPLNEV+FDFYDRLKS+SKGYASFDY++ DYR
Sbjct: 424 NILQLCQERRGNQTDLSYVGKRAMVSYELPLNEVVFDFYDRLKSISKGYASFDYHMADYR 483

Query: 486 DSDLVKLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGGRI 545
           + DLVK++I+VN E +DALS+LVHR+ +E+RGRG+CEKLK LIP  +F+I IQAAIGG++
Sbjct: 484 EGDLVKMSIMVNGEPVDALSMLVHRNQAERRGRGMCEKLKELIPNHLFKIPIQAAIGGKV 543

Query: 546 IARETVKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISILKTDN 605
           IARET+ A RKDVTAKCYGGD +RKRKLL+KQKEGKKRMR+FG+VDIPQ AFI+ LK D+
Sbjct: 544 IARETISALRKDVTAKCYGGDASRKRKLLDKQKEGKKRMRQFGKVDIPQEAFIAALKMDS 603


>gi|49473747|ref|YP_031789.1| GTP-binding protein LepA [Bartonella quintana str. Toulouse]
 gi|60389984|sp|Q6G1F5|LEPA_BARQU RecName: Full=Elongation factor 4; Short=EF-4; AltName:
           Full=Ribosomal back-translocase LepA
 gi|49239250|emb|CAF25571.1| GTP-binding protein lepA [Bartonella quintana str. Toulouse]
          Length = 601

 Score =  907 bits (2345), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 422/592 (71%), Positives = 511/592 (86%), Gaps = 1/592 (0%)

Query: 11  IRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVRLNY 70
           IRNFSIVAHIDHGKSTLADR IQ   GL  REM  QVLD+MDIERERGITIKAQTVRL+Y
Sbjct: 8   IRNFSIVAHIDHGKSTLADRLIQMTGGLETREMKEQVLDSMDIERERGITIKAQTVRLHY 67

Query: 71  TSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQAIDNN 130
            + + + Y LNLIDTPGHVDF YEVSRSL+ACEGSLLVVDA+QGVEAQTLANVYQAIDN+
Sbjct: 68  KAKNGETYILNLIDTPGHVDFAYEVSRSLAACEGSLLVVDASQGVEAQTLANVYQAIDNS 127

Query: 131 HEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERIVQQLPSP 190
           HE++ VLNK DLP+A+P+RVK+QIE+ IGI T +A+ +SAKTG G+P +LE IV+QLP P
Sbjct: 128 HELVVVLNKVDLPAAEPERVKEQIEDVIGIDTSEAVEISAKTGFGVPDVLEAIVRQLPPP 187

Query: 191 TSPEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVERIGILT 250
              +  N PLK +L+DSWY++YLGV+VLVR+I+G L KGQ IR+MGT  KY VER+G+ T
Sbjct: 188 HIGDVKN-PLKVMLVDSWYDAYLGVIVLVRVIDGILKKGQIIRMMGTGVKYLVERVGVFT 246

Query: 251 PKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVVFCGLFP 310
           PKM+ ++ L PGEIG + ASIKEV+ TRVGDTIT++  P  +ALPGFKP QPVVFCG+FP
Sbjct: 247 PKMVQVDTLGPGEIGFITASIKEVADTRVGDTITEERRPCENALPGFKPAQPVVFCGIFP 306

Query: 311 VDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERLEREFSL 370
           +DA  F+ LR A+ KLRLNDASFSFE+E S ALGFGFRCGFLGLLHLEIIQERLEREF+L
Sbjct: 307 IDAADFDGLRAAMGKLRLNDASFSFEMETSAALGFGFRCGFLGLLHLEIIQERLEREFNL 366

Query: 371 NLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEYLGSILKL 430
           +LI T+PSVVY + M++GS+++L NP DMP++ K++ + EPWI+ TI+TP++YLG+IL+L
Sbjct: 367 DLIATAPSVVYRMNMNNGSVKELHNPADMPDLVKVSSIEEPWIRATIMTPDDYLGAILEL 426

Query: 431 CQERRGIQIDMSHLDNRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDYRDSDLV 490
           CQERRGIQ+ +S++  RAM+ Y LPLNEV+FDFYDRLKS+SKGYASFDY + DY + DLV
Sbjct: 427 CQERRGIQVGLSYVGTRAMVTYNLPLNEVVFDFYDRLKSISKGYASFDYQMTDYSEGDLV 486

Query: 491 KLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGGRIIARET 550
           K++ILVN E+IDALS+LVHR+V+EKRGR +CEKLK+LIPQ MFQI IQAAIGG+IIARET
Sbjct: 487 KMSILVNGESIDALSMLVHRTVAEKRGRSMCEKLKDLIPQHMFQIPIQAAIGGKIIARET 546

Query: 551 VKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISILK 602
           ++A RKDVTAKCYGGD+TRKRKLLEKQKEGKKRMR+FG+V+IPQSAFI  LK
Sbjct: 547 IRALRKDVTAKCYGGDVTRKRKLLEKQKEGKKRMRQFGKVEIPQSAFIEALK 598


>gi|299132635|ref|ZP_07025830.1| GTP-binding protein LepA [Afipia sp. 1NLS2]
 gi|298592772|gb|EFI52972.1| GTP-binding protein LepA [Afipia sp. 1NLS2]
          Length = 601

 Score =  906 bits (2342), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 426/600 (71%), Positives = 504/600 (84%), Gaps = 2/600 (0%)

Query: 6   TPLSRIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQT 65
           TP+S IRNFSIVAHIDHGKSTLADR IQ   GL EREM  QVLD+MDIERERGITIKAQT
Sbjct: 4   TPISNIRNFSIVAHIDHGKSTLADRLIQTTGGLAEREMKEQVLDSMDIERERGITIKAQT 63

Query: 66  VRLNYTSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQ 125
           VRL+Y + D KDY  NL+DTPGHVDF YEVSR L+ACEG+LLVVDA+QGVEAQTLANVYQ
Sbjct: 64  VRLHYKAKDGKDYIFNLMDTPGHVDFAYEVSRCLAACEGALLVVDASQGVEAQTLANVYQ 123

Query: 126 AIDNNHEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERIVQ 185
           AIDNN EI+ VLNK DLP+A+P++VK+QIE+ IGI   DA++VSAKTG GIP +LE IV 
Sbjct: 124 AIDNNLEIVPVLNKVDLPAAEPEQVKQQIEDVIGIDASDAIMVSAKTGIGIPDVLEAIVT 183

Query: 186 QLPSPTSPEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVER 245
           +LP P      +A LKALL+DSWY+ YLGV+VL+R+++G + KG  IR+MGT A Y VER
Sbjct: 184 RLPPPKGDR--DATLKALLVDSWYDVYLGVVVLIRVVDGVMKKGDRIRMMGTGAAYDVER 241

Query: 246 IGILTPKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVVF 305
           +G  TPKM  ++ L PGE+G + A+IKEV+ TRVGDTITDD  P T  LPGFKP  PVVF
Sbjct: 242 VGFFTPKMTQVDELGPGEVGFITAAIKEVADTRVGDTITDDRKPVTEMLPGFKPAIPVVF 301

Query: 306 CGLFPVDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERLE 365
           CGLFPVDA  FE LR A+ KLRLNDASFSFE+E S ALGFGFRCGFLGLLHLEIIQERL 
Sbjct: 302 CGLFPVDADDFETLRAAMGKLRLNDASFSFEMETSAALGFGFRCGFLGLLHLEIIQERLS 361

Query: 366 REFSLNLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEYLG 425
           REF+LNLI T+PSV+Y++++ DG   ++ NPIDMP+V KIAE+ EPWI+ TI+TP+EYLG
Sbjct: 362 REFNLNLIATAPSVIYKMHLTDGQEIEIHNPIDMPDVVKIAEIEEPWIEATIMTPDEYLG 421

Query: 426 SILKLCQERRGIQIDMSHLDNRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDYR 485
           S+LKLCQERRG Q +++++ +RAM  YELPLNEV+FDFYDRLKSVSKGYASFDY++ DY+
Sbjct: 422 SVLKLCQERRGTQKELTYVGSRAMAKYELPLNEVVFDFYDRLKSVSKGYASFDYHLTDYK 481

Query: 486 DSDLVKLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGGRI 545
            +DLVK+ ILVNNE +DALS+LVHRS +E RGR + EK+K LIP  MFQI IQAAIGG++
Sbjct: 482 AADLVKMQILVNNEPVDALSMLVHRSRAEGRGRAMVEKMKELIPPHMFQIPIQAAIGGKV 541

Query: 546 IARETVKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISILKTDN 605
           IARETV+A RKDVTAKCYGGDITRKRKLLEKQKEGKK+MR+FG+VDIPQ AFI+ LK D+
Sbjct: 542 IARETVRALRKDVTAKCYGGDITRKRKLLEKQKEGKKKMRQFGKVDIPQEAFIAALKVDS 601


>gi|170738573|ref|YP_001767228.1| GTP-binding protein LepA [Methylobacterium sp. 4-46]
 gi|226732765|sp|B0UFE0|LEPA_METS4 RecName: Full=Elongation factor 4; Short=EF-4; AltName:
           Full=Ribosomal back-translocase LepA
 gi|168192847|gb|ACA14794.1| GTP-binding protein LepA [Methylobacterium sp. 4-46]
          Length = 601

 Score =  906 bits (2342), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 423/599 (70%), Positives = 510/599 (85%), Gaps = 2/599 (0%)

Query: 7   PLSRIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTV 66
           P+  IRNFSIVAHIDHGKSTLADR IQ    L+ REM+ QVLD+MDIERERGITIKAQTV
Sbjct: 5   PIDTIRNFSIVAHIDHGKSTLADRLIQLTGALSAREMTEQVLDSMDIERERGITIKAQTV 64

Query: 67  RLNYTSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQA 126
           RL+Y + D ++Y LNL+DTPGHVDFTYEVSRSL+ACEGSLLVVDA+QGVEAQTLANVYQA
Sbjct: 65  RLDYKAQDGREYVLNLMDTPGHVDFTYEVSRSLAACEGSLLVVDASQGVEAQTLANVYQA 124

Query: 127 IDNNHEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERIVQQ 186
           ID NHEI+ VLNK DLP+A+PDRVK+QIEE IGI   +A+ +SAKTG  I  +LE IV +
Sbjct: 125 IDANHEIVPVLNKIDLPAAEPDRVKEQIEEVIGIDASEAVPISAKTGLNIEAVLEAIVAK 184

Query: 187 LPSPTSPEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVERI 246
           LP P       APLKALL+DSWY+ YLGV+VLVRI++G L KG +IR+MG +A Y V+R+
Sbjct: 185 LPPPKG--DCEAPLKALLVDSWYDVYLGVVVLVRIVDGVLRKGMTIRMMGADAVYGVDRV 242

Query: 247 GILTPKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVVFC 306
           G+  PKM D+  L PGE+G + ASIKEV+ TRVGDTIT+D  PT  ALPGFKP+QPVVFC
Sbjct: 243 GVFRPKMQDVAELGPGEVGFLTASIKEVADTRVGDTITEDRRPTDQALPGFKPVQPVVFC 302

Query: 307 GLFPVDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERLER 366
           GLFPVDA +FENLR A+ KLRLNDASFS+E+E S ALGFGFRCGFLGLLHLEIIQERLER
Sbjct: 303 GLFPVDAAEFENLRAAMGKLRLNDASFSYEMETSAALGFGFRCGFLGLLHLEIIQERLER 362

Query: 367 EFSLNLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEYLGS 426
           EF+L+LI T+PSVVY L M DG+M++L NP DMP+V KI  + EPWI+ TI+TP++YLG 
Sbjct: 363 EFNLDLISTAPSVVYRLNMADGTMRELHNPADMPDVMKIDTIEEPWIRATILTPDDYLGG 422

Query: 427 ILKLCQERRGIQIDMSHLDNRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDYRD 486
           +LKLCQ+RRG QID++++  RAM+VY+LPLNEV+FDFYDRLKS+SKGYASFDY++ DYR+
Sbjct: 423 VLKLCQDRRGAQIDLNYVGKRAMVVYDLPLNEVVFDFYDRLKSISKGYASFDYHISDYRE 482

Query: 487 SDLVKLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGGRII 546
            DLVK++ILVN E +DALS+LVHR+ +E RGR +CEKLK+LIP+ +FQI +QAAIGG+II
Sbjct: 483 GDLVKMSILVNAEPVDALSMLVHRTRAESRGRAMCEKLKDLIPRHLFQIPVQAAIGGKII 542

Query: 547 ARETVKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISILKTDN 605
           ARET++A  KDVTAKCYGGDI+RKRKLL+KQKEGKKRMR+FG+V+IPQ AFI+ LK D+
Sbjct: 543 ARETIRALSKDVTAKCYGGDISRKRKLLDKQKEGKKRMRQFGKVEIPQEAFIAALKMDS 601


>gi|121602278|ref|YP_989572.1| GTP-binding protein LepA [Bartonella bacilliformis KC583]
 gi|120614455|gb|ABM45056.1| GTP-binding protein LepA [Bartonella bacilliformis KC583]
          Length = 613

 Score =  906 bits (2341), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 423/595 (71%), Positives = 507/595 (85%), Gaps = 1/595 (0%)

Query: 11  IRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVRLNY 70
           IRNFSIVAHIDHGKSTLADR IQ   GL  REM  QVLD+MDIERERGITIKAQTVRL Y
Sbjct: 20  IRNFSIVAHIDHGKSTLADRLIQMTGGLETREMKDQVLDSMDIERERGITIKAQTVRLRY 79

Query: 71  TSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQAIDNN 130
            + + + Y LNLIDTPGHVDF YEVSRSL+ACEGSLLVVDA+QGVEAQTLANVYQAIDNN
Sbjct: 80  KAKNGETYILNLIDTPGHVDFAYEVSRSLAACEGSLLVVDASQGVEAQTLANVYQAIDNN 139

Query: 131 HEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERIVQQLPSP 190
           HE++ VLNK DLP+A+P+RVKKQIE+ IGI   +A+ +SAKTG G+  +LE IV QLP P
Sbjct: 140 HELVVVLNKVDLPAAEPERVKKQIEDVIGIDASEAVEISAKTGLGVIDVLEAIVMQLPPP 199

Query: 191 TSPEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVERIGILT 250
           +  +    PLKA+L+DSWY++YLGV+VLVR+I+G L KGQ IR+MGT AKY VER+G+ T
Sbjct: 200 SIGD-VTKPLKAMLVDSWYDAYLGVIVLVRVIDGVLKKGQIIRMMGTGAKYPVERVGVFT 258

Query: 251 PKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVVFCGLFP 310
           PKM+ ++ L PGEIG + ASI+EV+ TRVGDTIT++       LPGFKP+QPVVFCGLFP
Sbjct: 259 PKMVQVDELGPGEIGFITASIREVADTRVGDTITEERRACEEILPGFKPVQPVVFCGLFP 318

Query: 311 VDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERLEREFSL 370
           VDA  FE+LR A+ KLRLNDASFSFE+E S ALGFGFRCGFLGLLHLEIIQERLEREF+L
Sbjct: 319 VDAAHFEDLRIAMGKLRLNDASFSFEMETSAALGFGFRCGFLGLLHLEIIQERLEREFNL 378

Query: 371 NLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEYLGSILKL 430
           +LI T+PSVVY + M++GS+++L NP DMP++ KI+ + EPWI+ TI+TP++YLGS+L L
Sbjct: 379 DLIATAPSVVYRMNMNNGSVKELHNPADMPDIVKISSIEEPWIRATIMTPDDYLGSVLAL 438

Query: 431 CQERRGIQIDMSHLDNRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDYRDSDLV 490
           CQERRG+Q+ +S++  RAM+ Y+LPLNEV+FDFYDRLKS+SKGYASFDY + DY + DLV
Sbjct: 439 CQERRGLQVSLSYVGTRAMVTYDLPLNEVVFDFYDRLKSLSKGYASFDYQMTDYAEGDLV 498

Query: 491 KLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGGRIIARET 550
           K++ILVN E IDALS+LVHRS++EKRGR +CEKLK+LIPQ +FQI IQAAIGG+IIARET
Sbjct: 499 KMSILVNGEPIDALSMLVHRSIAEKRGRSMCEKLKDLIPQHIFQIPIQAAIGGKIIARET 558

Query: 551 VKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISILKTDN 605
           ++A RKDVTAKCYGGD+TRKRKLLEKQKEGKKRMR+FG+V IPQSAFI  LK D 
Sbjct: 559 IRALRKDVTAKCYGGDVTRKRKLLEKQKEGKKRMRQFGKVTIPQSAFIQALKMDK 613


>gi|319404986|emb|CBI78589.1| GTP-binding protein LepA [Bartonella sp. AR 15-3]
          Length = 601

 Score =  906 bits (2341), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 425/592 (71%), Positives = 505/592 (85%), Gaps = 1/592 (0%)

Query: 11  IRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVRLNY 70
           IRNFSIVAHIDHGKSTLADR IQ   GL  REM  QVLD+MDIERERGITIKAQTVRL Y
Sbjct: 8   IRNFSIVAHIDHGKSTLADRLIQMTGGLETREMKEQVLDSMDIERERGITIKAQTVRLCY 67

Query: 71  TSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQAIDNN 130
            + + + Y LNLIDTPGHVDF YEVSRSL+ACEGSLLVVDA+QGVEAQTLANVYQAIDN+
Sbjct: 68  KAQNGETYILNLIDTPGHVDFAYEVSRSLAACEGSLLVVDASQGVEAQTLANVYQAIDNS 127

Query: 131 HEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERIVQQLPSP 190
           HE++ VLNK DLP+A+P+RVK+QIE+ IGI T  A+ +SAKTG GI  +LE I+ QLP P
Sbjct: 128 HELVVVLNKVDLPAAEPERVKEQIEDVIGIDTSRAVEISAKTGLGISDVLEEIITQLPPP 187

Query: 191 TSPEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVERIGILT 250
            +    + PLK +L+DSWY++YLGV+VLVR+I+G L KGQ+IR+MGT AKY VER+G+ T
Sbjct: 188 HTGNVID-PLKVMLVDSWYDAYLGVIVLVRVIDGVLKKGQTIRMMGTGAKYPVERVGVFT 246

Query: 251 PKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVVFCGLFP 310
           PKM+ ++ L PGEIG + ASIKEV+ TRVGDTIT+D  P    LPGFKP QPVVFCG+FP
Sbjct: 247 PKMVSVDELGPGEIGFITASIKEVADTRVGDTITEDRRPCEEVLPGFKPAQPVVFCGIFP 306

Query: 311 VDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERLEREFSL 370
           VDA  FENLRTA+ KLRLNDASFSFE+E S ALGFGFRCGFLGLLHLEIIQERLEREF+L
Sbjct: 307 VDAADFENLRTAMGKLRLNDASFSFEMETSAALGFGFRCGFLGLLHLEIIQERLEREFNL 366

Query: 371 NLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEYLGSILKL 430
           +LI T+PSV+Y + M DGS+++L NP DMP++ K+  + EPWI+ TI+TP+ YLG+IL+L
Sbjct: 367 DLIATAPSVIYRMNMTDGSVKELHNPADMPDIIKVISIEEPWIRATIMTPDNYLGAILEL 426

Query: 431 CQERRGIQIDMSHLDNRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDYRDSDLV 490
           CQERRG+Q  +S++  R+M+ Y+LPLNEVIFDFYDRLKS+SKGYASFDY V DY + DLV
Sbjct: 427 CQERRGVQTGLSYVGTRSMVTYDLPLNEVIFDFYDRLKSISKGYASFDYQVTDYSEGDLV 486

Query: 491 KLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGGRIIARET 550
           K++ILVN E+IDALS+LVHRS++EKRGR +CEKLK+LIPQ MFQI IQAAIGG+IIARET
Sbjct: 487 KMSILVNGESIDALSMLVHRSIAEKRGRSMCEKLKDLIPQHMFQIPIQAAIGGKIIARET 546

Query: 551 VKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISILK 602
           ++A RKDVTAKCYGGDITRKRKLLEKQK GKKRMR+FG+V+IPQSAFI  LK
Sbjct: 547 IRALRKDVTAKCYGGDITRKRKLLEKQKAGKKRMRQFGKVEIPQSAFIQALK 598


>gi|254474263|ref|ZP_05087653.1| GTP-binding protein LepA [Pseudovibrio sp. JE062]
 gi|211956637|gb|EEA91847.1| GTP-binding protein LepA [Pseudovibrio sp. JE062]
          Length = 601

 Score =  904 bits (2336), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 423/599 (70%), Positives = 512/599 (85%), Gaps = 4/599 (0%)

Query: 8   LSRIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVR 67
           LS IRNFSIVAHIDHGKSTLADR IQ    LTEREM+ QVLD+MDIE+ERGITIKAQTVR
Sbjct: 6   LSNIRNFSIVAHIDHGKSTLADRLIQSTGTLTEREMTEQVLDSMDIEKERGITIKAQTVR 65

Query: 68  LNYTSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQAI 127
           L Y + D ++Y LNLIDTPGHVDF YEVSRSL+A EGSLLVVDA+QGVEAQTLANVYQAI
Sbjct: 66  LIYKAEDGEEYTLNLIDTPGHVDFAYEVSRSLAAVEGSLLVVDASQGVEAQTLANVYQAI 125

Query: 128 DNNHEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERIVQQL 187
           DN+H+I+TVLNK DLP+A+PDR+K+QIE+ IG+ T +++++SAKTG GIP +LE IV+QL
Sbjct: 126 DNDHDIVTVLNKVDLPAAEPDRIKEQIEDVIGLDTSESVMISAKTGLGIPDVLEAIVKQL 185

Query: 188 PSPT-SPEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVERI 246
           P+P  +P+G   PLKA+L+DSWY++YLGVMVLVRII+G+L KG +I++MGT A Y V+R+
Sbjct: 186 PAPVGNPDG---PLKAMLVDSWYDTYLGVMVLVRIIDGELKKGDTIKMMGTGAVYPVDRV 242

Query: 247 GILTPKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVVFC 306
           G++TP  +  + L PGEIGV+ ASIKEV+ TRVGDTIT D    T ALPGFKP QPVVFC
Sbjct: 243 GVMTPAFVATDRLGPGEIGVLTASIKEVADTRVGDTITHDKKGCTEALPGFKPAQPVVFC 302

Query: 307 GLFPVDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERLER 366
           GLFPVDA  FE+LR+A+ KLRLNDASFS+E+E S ALGFGFRCGFLGLLHLEIIQERL R
Sbjct: 303 GLFPVDANDFEDLRSAMGKLRLNDASFSYEMETSAALGFGFRCGFLGLLHLEIIQERLSR 362

Query: 367 EFSLNLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEYLGS 426
           EF+L LI T+PSVVYE+ M DGS  ++ NP DMP+V KI E+REPWI+  I+TP+EYLG 
Sbjct: 363 EFNLELIATAPSVVYEMEMTDGSQFEMHNPADMPDVVKIKEIREPWIRANIMTPDEYLGP 422

Query: 427 ILKLCQERRGIQIDMSHLDNRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDYRD 486
           ILKLCQ+RRGIQ+D+S++ +RAM+ Y+LPLNEV+FDFYDRLKS+SKGYASFDY + +YR 
Sbjct: 423 ILKLCQDRRGIQVDLSYVGSRAMVTYDLPLNEVVFDFYDRLKSISKGYASFDYTISEYRA 482

Query: 487 SDLVKLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGGRII 546
            DLVK++ILVN E +DALS+LVHRS +E+RGR +CE LK LIP+ MF+I IQAAIGGR+I
Sbjct: 483 GDLVKMSILVNEEPVDALSVLVHRSQAERRGRAMCEVLKELIPRHMFKIPIQAAIGGRVI 542

Query: 547 ARETVKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISILKTDN 605
           ARET+ A RKDVTAKCYGGD +RKRKLL+KQK GKK+MR+FG+V+IPQ AFI  LK D+
Sbjct: 543 ARETLSALRKDVTAKCYGGDASRKRKLLDKQKAGKKKMRQFGKVEIPQEAFIQALKMDD 601


>gi|323137207|ref|ZP_08072286.1| GTP-binding protein LepA [Methylocystis sp. ATCC 49242]
 gi|322397565|gb|EFY00088.1| GTP-binding protein LepA [Methylocystis sp. ATCC 49242]
          Length = 622

 Score =  904 bits (2336), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 426/606 (70%), Positives = 506/606 (83%), Gaps = 7/606 (1%)

Query: 5   PTPLS-----RIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGI 59
           PTP+S      IRNFSIVAHIDHGKSTLADR IQ    L  REM  QVLD+MDIERERGI
Sbjct: 19  PTPMSTHKIDNIRNFSIVAHIDHGKSTLADRLIQETGTLAAREMVEQVLDSMDIERERGI 78

Query: 60  TIKAQTVRLNYTSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQT 119
           TIKAQTVRLNY + D +DY LNL+DTPGHVDF YEVSRSL ACEGSLLVVDA+QGVEAQT
Sbjct: 79  TIKAQTVRLNYRAKDGQDYVLNLMDTPGHVDFAYEVSRSLKACEGSLLVVDASQGVEAQT 138

Query: 120 LANVYQAIDNNHEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLL 179
           LANVYQAID  HEI+ VLNK DLP+A+PDR+K+QIEE IG+   DA+L+SAKTG GIP +
Sbjct: 139 LANVYQAIDAGHEIVPVLNKIDLPAAEPDRIKEQIEEVIGLDASDAVLISAKTGIGIPDV 198

Query: 180 LERIVQQLPSPTSPEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNA 239
           LE IV +LP PT  E    PLKALL+DSWY++YLGV+VLVRI +G L KGQ I++MG  A
Sbjct: 199 LEAIVTRLPPPTGDE--KVPLKALLVDSWYDAYLGVVVLVRIFDGTLKKGQKIQMMGAGA 256

Query: 240 KYQVERIGILTPKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKP 299
            Y+V++IG+  PKM D+  L PGE+G + A IK+V+ TRVGDTITD+  PT  ALPGFKP
Sbjct: 257 HYEVDKIGVFRPKMQDVAQLGPGEVGFITAQIKQVADTRVGDTITDERRPTAEALPGFKP 316

Query: 300 IQPVVFCGLFPVDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEI 359
            QPVVFCGLFPVDA  FE+LR AI KLRLNDASFS+E+E S ALGFGFRCGFLGLLHLEI
Sbjct: 317 AQPVVFCGLFPVDAADFEDLRAAIGKLRLNDASFSYEMETSAALGFGFRCGFLGLLHLEI 376

Query: 360 IQERLEREFSLNLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIIT 419
           IQERL+REF+L+LI T+PSVVY++ + +G   +L NP DMP+V KI E++EPWI+ TI+T
Sbjct: 377 IQERLQREFNLDLIATAPSVVYKITLTNGDEIELHNPADMPDVVKIDEIKEPWIRATILT 436

Query: 420 PNEYLGSILKLCQERRGIQIDMSHLDNRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDY 479
           P++YLGS+LKLCQ+RRG+Q+D++++  RAM VY+LPLNEV+FDFYDRLKS+SKGYASFDY
Sbjct: 437 PDDYLGSVLKLCQDRRGVQVDLNYVGKRAMAVYDLPLNEVVFDFYDRLKSISKGYASFDY 496

Query: 480 NVIDYRDSDLVKLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQA 539
            + DYR  DLVK++ILVN E +DALS+LVHR+ +E RGR +CEKLK LIP  MFQ+ IQA
Sbjct: 497 QLTDYRAGDLVKMSILVNAEPVDALSMLVHRTRAEGRGRAMCEKLKELIPPHMFQVPIQA 556

Query: 540 AIGGRIIARETVKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFIS 599
           AIGG+IIARETV+A RKDVTAKCYGGD TRKRKLLEKQKEGKK+MR+FGRV+IPQ AFI+
Sbjct: 557 AIGGKIIARETVRAFRKDVTAKCYGGDATRKRKLLEKQKEGKKKMRQFGRVEIPQEAFIA 616

Query: 600 ILKTDN 605
            LK ++
Sbjct: 617 ALKMED 622


>gi|92116059|ref|YP_575788.1| GTP-binding protein LepA [Nitrobacter hamburgensis X14]
 gi|119371372|sp|Q1QR19|LEPA_NITHX RecName: Full=Elongation factor 4; Short=EF-4; AltName:
           Full=Ribosomal back-translocase LepA
 gi|91798953|gb|ABE61328.1| GTP-binding protein LepA [Nitrobacter hamburgensis X14]
          Length = 610

 Score =  902 bits (2332), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 426/606 (70%), Positives = 508/606 (83%), Gaps = 4/606 (0%)

Query: 2   QKKPTPLSRIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSS--QVLDNMDIERERGI 59
           ++  TP++ IRNFSIVAHIDHGKSTLADR IQ   GL++REM+   QVLD+MDIERERGI
Sbjct: 7   KRGTTPIANIRNFSIVAHIDHGKSTLADRLIQMTGGLSDREMAGKEQVLDSMDIERERGI 66

Query: 60  TIKAQTVRLNYTSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQT 119
           TIKAQTVRLNY + D KDY  NL+DTPGHVDF YEVSRSL+ACEGSLLVVDA+QGVEAQT
Sbjct: 67  TIKAQTVRLNYHAKDGKDYIFNLMDTPGHVDFAYEVSRSLAACEGSLLVVDASQGVEAQT 126

Query: 120 LANVYQAIDNNHEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLL 179
           LANVYQA+DNNHEI+ VLNK DLP+A+PD+VK+QIE+ IGI   DA+++SAKTG G+P +
Sbjct: 127 LANVYQALDNNHEIVPVLNKVDLPAAEPDKVKQQIEDVIGIDASDAVMISAKTGLGVPDV 186

Query: 180 LERIVQQLPSPTSPEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNA 239
           LE IV +LP P      +A LKALL+DSWY+ YLGV+VLVRI++G + K   IR+MGTNA
Sbjct: 187 LEAIVTRLPPPQGDR--DATLKALLVDSWYDVYLGVVVLVRIVDGVMKKNSRIRMMGTNA 244

Query: 240 KYQVERIGILTPKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKP 299
            Y VER+G  TPKM  ++ L PGEIG + A+IKEV+ TRVGDTITDD  P T  LPGFKP
Sbjct: 245 AYDVERVGFFTPKMQQVDELGPGEIGFITAAIKEVADTRVGDTITDDRKPITEMLPGFKP 304

Query: 300 IQPVVFCGLFPVDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEI 359
             PVVFCGLFPVDA  FE LRTA+ KLRLNDASFSFE+E S ALGFGFRCGFLGLLHLEI
Sbjct: 305 AIPVVFCGLFPVDADDFETLRTAMGKLRLNDASFSFEMETSAALGFGFRCGFLGLLHLEI 364

Query: 360 IQERLEREFSLNLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIIT 419
           IQERL REF LNLI T+PSV+Y++ + DG   ++ NPIDMP+V KIAE+ EPWI+ TI+T
Sbjct: 365 IQERLSREFDLNLIATAPSVIYKMKLTDGGEIEIHNPIDMPDVVKIAEIAEPWIEATILT 424

Query: 420 PNEYLGSILKLCQERRGIQIDMSHLDNRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDY 479
           P++YLGS+LKLCQERRG Q +++++ +RAM+ Y+LPLNEV+FDFYDRLKSVSKGYASFDY
Sbjct: 425 PDDYLGSVLKLCQERRGSQKELTYVGSRAMVRYDLPLNEVVFDFYDRLKSVSKGYASFDY 484

Query: 480 NVIDYRDSDLVKLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQA 539
           ++ DY+ +DLVK+ ILVN E +DALS+LVHR+ +E RGR + EK+K LIP  MFQI IQA
Sbjct: 485 HLTDYKVADLVKMQILVNGEPVDALSMLVHRTRAEGRGRAMVEKMKELIPPHMFQIPIQA 544

Query: 540 AIGGRIIARETVKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFIS 599
           AIGG++IARETV+A RKDVTAKCYGGDITRKRKLLEKQKEGKK+MR+FG+VDIPQ AFI+
Sbjct: 545 AIGGKVIARETVRALRKDVTAKCYGGDITRKRKLLEKQKEGKKKMRQFGKVDIPQEAFIA 604

Query: 600 ILKTDN 605
            LK D 
Sbjct: 605 ALKVDG 610


>gi|319407937|emb|CBI81591.1| GTP-binding protein LepA [Bartonella schoenbuchensis R1]
          Length = 601

 Score =  902 bits (2331), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 422/595 (70%), Positives = 504/595 (84%), Gaps = 1/595 (0%)

Query: 11  IRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVRLNY 70
           IRNFSIVAHIDHGKSTLADR IQ   GL  REM  QVLD+MDIERERGITIKAQTVRL+Y
Sbjct: 8   IRNFSIVAHIDHGKSTLADRLIQMTGGLETREMKDQVLDSMDIERERGITIKAQTVRLHY 67

Query: 71  TSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQAIDNN 130
            + +   Y LNLIDTPGHVDF YEVSRSL+ACEGSLLVVDA+QGVEAQTLANVYQAIDNN
Sbjct: 68  KAKNGDTYILNLIDTPGHVDFAYEVSRSLAACEGSLLVVDASQGVEAQTLANVYQAIDNN 127

Query: 131 HEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERIVQQLPSP 190
           HE++ VLNK DLP+A+P+R+K+QIE+ +GI    AL +SAKTG G+  +LE IV  LP P
Sbjct: 128 HELVVVLNKVDLPAAEPERIKEQIEDVVGIDASGALEISAKTGLGVVDVLEAIVMHLPPP 187

Query: 191 TSPEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVERIGILT 250
              +    PLKA+L+DSWY+ YLGV+VLVR+I+G L KGQ+IR+MGT AKY VER+G+ T
Sbjct: 188 HVGD-VTKPLKAMLVDSWYDVYLGVVVLVRVIDGVLKKGQTIRMMGTGAKYPVERVGVFT 246

Query: 251 PKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVVFCGLFP 310
           PKMI ++ L PGEIG + ASIKEV+ TRVGDTIT++  P    LPGFKP QPVVFCGLFP
Sbjct: 247 PKMIQVDELGPGEIGFITASIKEVADTRVGDTITEERRPCEDMLPGFKPAQPVVFCGLFP 306

Query: 311 VDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERLEREFSL 370
           +DA  FE+LR A+ KLRLNDASFSFE+E S ALGFGFRCGFLGLLHLEIIQERLEREF+L
Sbjct: 307 IDAAHFEDLRAAMGKLRLNDASFSFEMETSAALGFGFRCGFLGLLHLEIIQERLEREFNL 366

Query: 371 NLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEYLGSILKL 430
           +LI T+PSVVY ++M +GS+++L NP DMP+  KI  + EPWI+ TI+TP+ YLG+IL+L
Sbjct: 367 DLIATAPSVVYRMHMTNGSVEELHNPADMPDSIKIVSIEEPWIRATIMTPDNYLGAILEL 426

Query: 431 CQERRGIQIDMSHLDNRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDYRDSDLV 490
           CQERRG+Q+ +S++  RA++ Y+LPLNEV+FDFYDRLKS+SKGYASFDY +IDY + DLV
Sbjct: 427 CQERRGVQVGLSYVGTRAIVTYDLPLNEVVFDFYDRLKSISKGYASFDYQMIDYSEGDLV 486

Query: 491 KLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGGRIIARET 550
           K++ILVN E IDALS+LVHR+++EKRGR +CEKLK+LIPQ MFQI IQAAIGG+IIARET
Sbjct: 487 KMSILVNGEPIDALSMLVHRTIAEKRGRSMCEKLKDLIPQHMFQIPIQAAIGGKIIARET 546

Query: 551 VKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISILKTDN 605
           ++A RKDVTAKCYGGDITRKRKLLEKQKEGKKRMR+FG+V+IPQSAFI  LK + 
Sbjct: 547 IRALRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRQFGKVEIPQSAFIQALKMNK 601


>gi|170749497|ref|YP_001755757.1| GTP-binding protein LepA [Methylobacterium radiotolerans JCM 2831]
 gi|170656019|gb|ACB25074.1| GTP-binding protein LepA [Methylobacterium radiotolerans JCM 2831]
          Length = 600

 Score =  902 bits (2331), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 422/600 (70%), Positives = 508/600 (84%), Gaps = 2/600 (0%)

Query: 6   TPLSRIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQT 65
            P+  IRNFSIVAHIDHGKSTLADR IQ    +  R+MS Q+LD+MDIE+ERGITIKAQT
Sbjct: 3   APIDTIRNFSIVAHIDHGKSTLADRLIQATGTVALRDMSEQMLDSMDIEKERGITIKAQT 62

Query: 66  VRLNYTSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQ 125
           VRL Y + D KDY LNL+DTPGHVDF YEVSRSL+ACEGSLLVVDA+QGVEAQTLANVYQ
Sbjct: 63  VRLEYKAQDGKDYVLNLMDTPGHVDFAYEVSRSLAACEGSLLVVDASQGVEAQTLANVYQ 122

Query: 126 AIDNNHEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERIVQ 185
           A+D NHEI+ VLNK DLP+A+PDRVK+QIEE IG+   DA+ +SAKTG  I  +LE IV 
Sbjct: 123 ALDANHEIVPVLNKVDLPAAEPDRVKEQIEEVIGLDASDAVPISAKTGLNIEAVLEAIVT 182

Query: 186 QLPSPTSPEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVER 245
           +LP P      +APLKALL+DSWY++YLGV+VLVRII+G L KG +IR+MG +A Y V+R
Sbjct: 183 RLPPPKG--NRDAPLKALLVDSWYDAYLGVVVLVRIIDGTLKKGMTIRMMGADAVYGVDR 240

Query: 246 IGILTPKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVVF 305
           IG+  PKM DI+AL PGE+G    SIKEV+ TRVGDTIT+D   TT  LPGFK +Q VVF
Sbjct: 241 IGVFRPKMADIDALGPGEVGFFTGSIKEVADTRVGDTITEDKRQTTEMLPGFKEVQAVVF 300

Query: 306 CGLFPVDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERLE 365
           CGLFPVDA +FENLR+A+ KLRLNDASFS+E+E+S ALGFGFRCGFLGLLHLEIIQERLE
Sbjct: 301 CGLFPVDAAEFENLRSAMGKLRLNDASFSYEMESSAALGFGFRCGFLGLLHLEIIQERLE 360

Query: 366 REFSLNLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEYLG 425
           REF+L+LI T+PSVVY L M DG +++L NP DMP+V KI  + EPWI+ TI+TP+EYLG
Sbjct: 361 REFNLDLISTAPSVVYRLKMRDGEIKELHNPADMPDVMKIETVEEPWIRATILTPDEYLG 420

Query: 426 SILKLCQERRGIQIDMSHLDNRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDYR 485
            +LKLCQ+RRG+QID++++  RAM+VY+LPLNEV+FDFYDRLKS+SKGYASFDY+V DYR
Sbjct: 421 GVLKLCQDRRGVQIDLNYVGKRAMVVYDLPLNEVVFDFYDRLKSISKGYASFDYHVSDYR 480

Query: 486 DSDLVKLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGGRI 545
           + DLVK++ILVN E +DALS+LVHR+ +E RGR +CEKLK+LIP+ +FQI +QAAIGG+I
Sbjct: 481 EGDLVKMSILVNAEPVDALSMLVHRTRAESRGRAMCEKLKDLIPRHLFQIPVQAAIGGKI 540

Query: 546 IARETVKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISILKTDN 605
           IARET+KA  KDVTAKCYGGDI+RKRKLL+KQKEGKK+MR+FGRV+IPQ AFI+ LK D+
Sbjct: 541 IARETIKALSKDVTAKCYGGDISRKRKLLDKQKEGKKKMRQFGRVEIPQEAFIAALKMDD 600


>gi|114705632|ref|ZP_01438535.1| GTP-binding protein LepA [Fulvimarina pelagi HTCC2506]
 gi|114538478|gb|EAU41599.1| GTP-binding protein LepA [Fulvimarina pelagi HTCC2506]
          Length = 603

 Score =  901 bits (2328), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 420/600 (70%), Positives = 510/600 (85%), Gaps = 1/600 (0%)

Query: 6   TPLSRIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQT 65
           TPLSRIRNFSIVAHIDHGKSTLADR IQ+  GL  R+M  QVLDNMDIERERGITIKAQT
Sbjct: 5   TPLSRIRNFSIVAHIDHGKSTLADRLIQNTGGLEIRDMKEQVLDNMDIERERGITIKAQT 64

Query: 66  VRLNYTSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQ 125
           VRL+YT++D + Y LNLIDTPGHVDF YEVSRSL+AC+G+LLVVDA QGVEAQTLANVY 
Sbjct: 65  VRLHYTASDGETYVLNLIDTPGHVDFAYEVSRSLAACDGALLVVDAAQGVEAQTLANVYL 124

Query: 126 AIDNNHEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERIVQ 185
           A+DN+ EI+ VLNK DLP+A+PD+VK+QIE+ IG+   DA+++SAK+G GI  +LE IV+
Sbjct: 125 ALDNDLEIVPVLNKIDLPAAEPDKVKEQIEDVIGLDASDAVMISAKSGLGIEDVLEAIVK 184

Query: 186 QLPSPTSPEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVER 245
           +LP P+  +  +APLKA+L+DSWY+ YLGV+VLVRII+G+L KGQ IR+MGT+AKY V+R
Sbjct: 185 RLPPPSEGD-RSAPLKAMLVDSWYDVYLGVVVLVRIIDGELKKGQQIRMMGTDAKYPVDR 243

Query: 246 IGILTPKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVVF 305
           +G+ TPKM+ ++AL PGE+G + ASIKEV+ TRVGDTITD+  PT   LPGFKP QPVVF
Sbjct: 244 VGVFTPKMVLVDALGPGELGFITASIKEVADTRVGDTITDEKRPTDKMLPGFKPAQPVVF 303

Query: 306 CGLFPVDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERLE 365
           CGLFPVDA  F++LR A+ KLRLNDASFS+E+E+S ALGFGFRCGFLGLLHLEI+QERL 
Sbjct: 304 CGLFPVDAADFDDLRAAMGKLRLNDASFSYEMESSAALGFGFRCGFLGLLHLEIVQERLS 363

Query: 366 REFSLNLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEYLG 425
           REF L+LI T+PSVVY++ M +G+  +L NP DMP+V KI  + EPWI   I+TP++YLG
Sbjct: 364 REFDLDLIATAPSVVYDVTMTNGNTTQLHNPADMPDVVKIDHIAEPWITANILTPDDYLG 423

Query: 426 SILKLCQERRGIQIDMSHLDNRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDYR 485
            IL+LCQERRGIQ  +S++  RAM+ YELPLNEV+FDFYDRLKS+SKGYASFDY + DYR
Sbjct: 424 PILQLCQERRGIQTGLSYVGKRAMVSYELPLNEVVFDFYDRLKSISKGYASFDYQMADYR 483

Query: 486 DSDLVKLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGGRI 545
           + DLVK++ILVN E +DALS+LVHR+ +EKRGR +CEKLK LIP  +F+I IQAAIGG++
Sbjct: 484 EGDLVKMSILVNAEPVDALSMLVHRTQAEKRGRAMCEKLKELIPNHLFKIPIQAAIGGKV 543

Query: 546 IARETVKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISILKTDN 605
           IARET+ A RKDVTAKCYGGD TRKRKLLEKQKEGKKRMR+FG+V+IPQ AFI+ LK D 
Sbjct: 544 IARETISALRKDVTAKCYGGDATRKRKLLEKQKEGKKRMRQFGKVEIPQEAFIAALKMDG 603


>gi|307943079|ref|ZP_07658424.1| GTP-binding protein LepA [Roseibium sp. TrichSKD4]
 gi|307773875|gb|EFO33091.1| GTP-binding protein LepA [Roseibium sp. TrichSKD4]
          Length = 601

 Score =  900 bits (2327), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 421/599 (70%), Positives = 504/599 (84%), Gaps = 2/599 (0%)

Query: 7   PLSRIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTV 66
           P+S IRNFSIVAHIDHGKSTLADR IQ    LT+REMS QVLD+MDIE+ERGITIKAQTV
Sbjct: 5   PISNIRNFSIVAHIDHGKSTLADRLIQMTGTLTDREMSDQVLDSMDIEKERGITIKAQTV 64

Query: 67  RLNYTSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQA 126
           RL Y + D + Y LNLIDTPGHVDF YEVSRSL+ACEGSLLVVDA+QGVEAQTLANVYQA
Sbjct: 65  RLIYNAEDGQQYTLNLIDTPGHVDFAYEVSRSLAACEGSLLVVDASQGVEAQTLANVYQA 124

Query: 127 IDNNHEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERIVQQ 186
           IDN+HEI+TVLNK DLP+A+PDR+K+QIE+ IGI T DA ++SAKTG GI  +LE IV+Q
Sbjct: 125 IDNDHEIVTVLNKIDLPAAEPDRIKEQIEDVIGIDTADACMISAKTGLGIESVLEAIVKQ 184

Query: 187 LPSPTSPEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVERI 246
           LP P      N  LKA+L+DSWY++YLGVMV++R+I+G L KGQ ++++GT A Y ++R+
Sbjct: 185 LPPPQGQ--PNGTLKAMLVDSWYDTYLGVMVMIRVIDGSLKKGQRVKMLGTGAVYDIDRV 242

Query: 247 GILTPKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVVFC 306
           G++TPK + ++ L  GEIGV+ ASIKEV+ TRVGDTIT D       LPGFKP QPVVFC
Sbjct: 243 GVMTPKFLQVDELRAGEIGVITASIKEVADTRVGDTITLDKVTNVEPLPGFKPAQPVVFC 302

Query: 307 GLFPVDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERLER 366
           GLFP+DA  FE LR+A+ KLRLNDASFSFE+E S ALGFGFRCGFLGLLHLEIIQERL R
Sbjct: 303 GLFPIDANDFEGLRSAMGKLRLNDASFSFEMETSAALGFGFRCGFLGLLHLEIIQERLSR 362

Query: 367 EFSLNLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEYLGS 426
           EF+L+LI T+PSVVYE+ + DGS  +L NP DMP+V KI E+REPWI+  I+TP+EYLG 
Sbjct: 363 EFNLDLIATAPSVVYEMTLTDGSEVELHNPADMPDVVKIDEIREPWIRANIMTPDEYLGG 422

Query: 427 ILKLCQERRGIQIDMSHLDNRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDYRD 486
           ILKLCQERRG+QID+S++ +RAM+ Y+LPLNEV+FDFYDRLKS+SKGYASFDY + DYR 
Sbjct: 423 ILKLCQERRGLQIDLSYVGSRAMVTYDLPLNEVVFDFYDRLKSISKGYASFDYQISDYRA 482

Query: 487 SDLVKLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGGRII 546
            DLVK++ILVN E +DALS+LVHRS +E+RGR + EKLK LIP+ MF+I IQAAIGG++I
Sbjct: 483 GDLVKMSILVNEEPVDALSVLVHRSQAERRGRAMVEKLKELIPRHMFKIPIQAAIGGKVI 542

Query: 547 ARETVKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISILKTDN 605
           ARET+ A RKDVTAKCYGGD TRKRKLLEKQK GKK+MR+FG+V+IPQ AFI  LK D+
Sbjct: 543 ARETLSALRKDVTAKCYGGDATRKRKLLEKQKAGKKKMRQFGKVEIPQEAFIQALKMDD 601


>gi|146337850|ref|YP_001202898.1| GTP-binding protein LepA [Bradyrhizobium sp. ORS278]
 gi|146190656|emb|CAL74658.1| GTP-binding elongation factor [Bradyrhizobium sp. ORS278]
          Length = 617

 Score =  899 bits (2324), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 422/602 (70%), Positives = 506/602 (84%), Gaps = 4/602 (0%)

Query: 6   TPLSRIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSS--QVLDNMDIERERGITIKA 63
            P+  IRNFSIVAHIDHGKSTLADR IQ   GL++REM+   QVLD+MDIERERGITIKA
Sbjct: 18  VPIPNIRNFSIVAHIDHGKSTLADRLIQMTGGLSDREMAGKEQVLDSMDIERERGITIKA 77

Query: 64  QTVRLNYTSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANV 123
           QTVRL Y + D KDY  NL+DTPGHVDF YEVSRSL+ACEGSLLVVDA+QGVEAQTLANV
Sbjct: 78  QTVRLQYRAKDGKDYIFNLMDTPGHVDFAYEVSRSLAACEGSLLVVDASQGVEAQTLANV 137

Query: 124 YQAIDNNHEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERI 183
           YQA+DNNHEI+ VLNK DLP+A+PD++K+QIE+ IGI   DA+++SAKTG GIP +LE I
Sbjct: 138 YQALDNNHEIVPVLNKIDLPAAEPDKIKQQIEDVIGIDASDAVMISAKTGLGIPDVLEAI 197

Query: 184 VQQLPSPTSPEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQV 243
           V +LP P       A LKALL+DSWY+ YLGV+VLVRI++G + KGQ IR+MGT A Y V
Sbjct: 198 VTRLPPPKGDR--EATLKALLVDSWYDVYLGVVVLVRIVDGVMKKGQRIRMMGTGAAYDV 255

Query: 244 ERIGILTPKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPV 303
           ER+G  TPKM  ++ L PGE+G + A+IKEV+ TRVGDTITDD  P +  LPGFKP  PV
Sbjct: 256 ERVGFFTPKMQQVDELGPGEVGFITAAIKEVADTRVGDTITDDRKPVSEMLPGFKPAIPV 315

Query: 304 VFCGLFPVDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQER 363
           VFCGLFPVDA  FE LR A+ KLRLNDASFSFE+E S ALGFGFRCGFLGLLHLEIIQER
Sbjct: 316 VFCGLFPVDADDFETLRAAMGKLRLNDASFSFEMETSAALGFGFRCGFLGLLHLEIIQER 375

Query: 364 LEREFSLNLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEY 423
           L REF LNLI T+PSV+Y++ + DG   ++ NP+DMP+V KIAE++EPWI+ TI+TP+EY
Sbjct: 376 LSREFDLNLIATAPSVIYKMKLTDGEEIEIHNPVDMPDVVKIAEIQEPWIEATILTPDEY 435

Query: 424 LGSILKLCQERRGIQIDMSHLDNRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVID 483
           LGS+LKLCQ+RRG Q +++++ +RAM+ Y+LPLNEV+FDFYDRLKSVSKGYASFDY++ D
Sbjct: 436 LGSVLKLCQDRRGNQKELTYVGSRAMVKYDLPLNEVVFDFYDRLKSVSKGYASFDYHLTD 495

Query: 484 YRDSDLVKLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGG 543
           Y+ +DLVK+ ILVNNE +DALS+LVHR+ +E RGR + EK+K+LIP  MFQI IQAAIGG
Sbjct: 496 YKPADLVKMQILVNNEPVDALSMLVHRTRAEGRGRAMVEKMKDLIPPHMFQIPIQAAIGG 555

Query: 544 RIIARETVKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISILKT 603
           ++IARETV+A RKDVTAKCYGGDITRKRKLLEKQKEGKK+MR+FG+VDIPQ AFI+ LK 
Sbjct: 556 KVIARETVRALRKDVTAKCYGGDITRKRKLLEKQKEGKKKMRQFGKVDIPQEAFIAALKV 615

Query: 604 DN 605
           D+
Sbjct: 616 DS 617


>gi|75674541|ref|YP_316962.1| GTP-binding protein LepA [Nitrobacter winogradskyi Nb-255]
 gi|90185163|sp|Q3SVT1|LEPA_NITWN RecName: Full=Elongation factor 4; Short=EF-4; AltName:
           Full=Ribosomal back-translocase LepA
 gi|74419411|gb|ABA03610.1| GTP-binding protein LepA [Nitrobacter winogradskyi Nb-255]
          Length = 603

 Score =  898 bits (2320), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 420/602 (69%), Positives = 505/602 (83%), Gaps = 4/602 (0%)

Query: 6   TPLSRIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSS--QVLDNMDIERERGITIKA 63
           +P++ IRNFSIVAHIDHGKSTLADR IQ   GL++REM+   QVLD+MDIERERGITIKA
Sbjct: 4   SPIANIRNFSIVAHIDHGKSTLADRLIQMTGGLSDREMAGKEQVLDSMDIERERGITIKA 63

Query: 64  QTVRLNYTSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANV 123
           QTVRL Y + D KDY  NL+DTPGHVDF YEVSRSL+ACEGSLLVVDA+QGVEAQTLANV
Sbjct: 64  QTVRLKYRAKDGKDYVFNLMDTPGHVDFAYEVSRSLAACEGSLLVVDASQGVEAQTLANV 123

Query: 124 YQAIDNNHEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERI 183
           YQA+DNNHEI+ VLNK DLP+A+PD+VK+QIE+ IGI   DA+++SAKTG G+P +LE I
Sbjct: 124 YQALDNNHEIVPVLNKVDLPAAEPDKVKQQIEDVIGIDASDAVMISAKTGLGVPDVLEAI 183

Query: 184 VQQLPSPTSPEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQV 243
           V +LP P      +A LKALL+DSWY+ YLGV+VL+R+I+G L KG  IR++GT+A Y V
Sbjct: 184 VTRLPPPKGDR--DATLKALLVDSWYDVYLGVVVLIRVIDGALRKGSRIRMIGTSAAYDV 241

Query: 244 ERIGILTPKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPV 303
           ER+G  TPKM  ++ L PGEIG + A+IKEV+ TRVGDTITDD  P T  LPGFKP  PV
Sbjct: 242 ERVGFFTPKMQQVDELGPGEIGFITAAIKEVADTRVGDTITDDRKPVTEMLPGFKPAIPV 301

Query: 304 VFCGLFPVDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQER 363
           VFCGLFPVDA  FE LR A+ KLRLNDASFSFE+E S ALGFGFRCGFLGLLHLEI+QER
Sbjct: 302 VFCGLFPVDADDFETLRAAMGKLRLNDASFSFEMETSAALGFGFRCGFLGLLHLEIVQER 361

Query: 364 LEREFSLNLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEY 423
           L REF LNLI T+PSV+Y + + DG   ++ NPIDMP+V KIAE++EPWI+ TI+TP+EY
Sbjct: 362 LSREFDLNLIATAPSVIYRMRLTDGVEIEIHNPIDMPDVVKIAEIQEPWIEATILTPDEY 421

Query: 424 LGSILKLCQERRGIQIDMSHLDNRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVID 483
           LGS+LKLCQ+RRG+Q +++++  RAM  Y+LPLNEV+FDFYDRLKSVSKGYASFDY++ D
Sbjct: 422 LGSVLKLCQDRRGVQKELTYVGARAMAKYDLPLNEVVFDFYDRLKSVSKGYASFDYHLTD 481

Query: 484 YRDSDLVKLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGG 543
           Y+ +DLVK+ ILVN E +DALS+LVHR+ +E RGR + EK+K LIP  MFQI IQAAIGG
Sbjct: 482 YKPADLVKMQILVNGEPVDALSMLVHRTRAEGRGRAMVEKMKELIPPHMFQIPIQAAIGG 541

Query: 544 RIIARETVKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISILKT 603
           ++IARETV+A RKDVTAKCYGGD++RKRKLLEKQKEGKK+MR+FG+VDIPQ AFI+ LK 
Sbjct: 542 KVIARETVRALRKDVTAKCYGGDVSRKRKLLEKQKEGKKKMRQFGKVDIPQEAFIAALKV 601

Query: 604 DN 605
           DN
Sbjct: 602 DN 603


>gi|148258558|ref|YP_001243143.1| GTP-binding protein LepA [Bradyrhizobium sp. BTAi1]
 gi|146410731|gb|ABQ39237.1| GTP-binding protein LepA [Bradyrhizobium sp. BTAi1]
          Length = 617

 Score =  897 bits (2319), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 421/602 (69%), Positives = 506/602 (84%), Gaps = 4/602 (0%)

Query: 6   TPLSRIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSS--QVLDNMDIERERGITIKA 63
            P+  IRNFSIVAHIDHGKSTLADR IQ   GL++REM+   QVLD+MDIERERGITIKA
Sbjct: 18  VPIPNIRNFSIVAHIDHGKSTLADRLIQMTGGLSDREMAGKEQVLDSMDIERERGITIKA 77

Query: 64  QTVRLNYTSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANV 123
           QTVRL Y + D KDY  NL+DTPGHVDF YEVSRSL+ACEGSLLVVDA+QGVEAQTLANV
Sbjct: 78  QTVRLQYRAKDGKDYIFNLMDTPGHVDFAYEVSRSLAACEGSLLVVDASQGVEAQTLANV 137

Query: 124 YQAIDNNHEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERI 183
           YQA+DNNHEI+ VLNK DLP+A+P+++K+QIE+ IGI   DA+++SAKTG GIP +LE I
Sbjct: 138 YQALDNNHEIVPVLNKIDLPAAEPEKIKQQIEDVIGIDASDAVMISAKTGLGIPDVLEAI 197

Query: 184 VQQLPSPTSPEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQV 243
           V +LP P       A LKALL+DSWY+ YLGV+VLVRI++G + KGQ IR+MGT A Y V
Sbjct: 198 VTRLPPPKGDR--EATLKALLVDSWYDVYLGVVVLVRIVDGVMKKGQRIRMMGTGAAYDV 255

Query: 244 ERIGILTPKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPV 303
           ER+G  TPKM  ++ L PGE+G + A+IKEV+ TRVGDTITDD  P +  LPGFKP  PV
Sbjct: 256 ERVGFFTPKMQQVDELGPGEVGFITAAIKEVADTRVGDTITDDRKPVSEMLPGFKPAIPV 315

Query: 304 VFCGLFPVDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQER 363
           VFCGLFPVDA  FE LR A+ KLRLNDASFSFE+E S ALGFGFRCGFLGLLHLEIIQER
Sbjct: 316 VFCGLFPVDADDFETLRAAMGKLRLNDASFSFEMETSAALGFGFRCGFLGLLHLEIIQER 375

Query: 364 LEREFSLNLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEY 423
           L REF LNLI T+PSV+Y++ + DG   ++ NP+DMP+V KIAE++EPWI+ TI+TP+EY
Sbjct: 376 LSREFDLNLIATAPSVIYKMKLTDGQEIEIHNPVDMPDVVKIAEIQEPWIEATILTPDEY 435

Query: 424 LGSILKLCQERRGIQIDMSHLDNRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVID 483
           LGS+LKLCQ+RRG Q +++++ +RAM+ Y+LPLNEV+FDFYDRLKSVSKGYASFDY++ D
Sbjct: 436 LGSVLKLCQDRRGNQKELTYVGSRAMVKYDLPLNEVVFDFYDRLKSVSKGYASFDYHLTD 495

Query: 484 YRDSDLVKLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGG 543
           Y+ +DLVK+ ILVNNE +DALS+LVHR+ +E RGR + EK+K+LIP  MFQI IQAAIGG
Sbjct: 496 YKPADLVKMQILVNNEPVDALSMLVHRTRAEGRGRAMVEKMKDLIPPHMFQIPIQAAIGG 555

Query: 544 RIIARETVKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISILKT 603
           ++IARETV+A RKDVTAKCYGGDITRKRKLLEKQKEGKK+MR+FG+VDIPQ AFI+ LK 
Sbjct: 556 KVIARETVRALRKDVTAKCYGGDITRKRKLLEKQKEGKKKMRQFGKVDIPQEAFIAALKV 615

Query: 604 DN 605
           D+
Sbjct: 616 DS 617


>gi|85713445|ref|ZP_01044435.1| GTP-binding protein LepA [Nitrobacter sp. Nb-311A]
 gi|85699349|gb|EAQ37216.1| GTP-binding protein LepA [Nitrobacter sp. Nb-311A]
          Length = 603

 Score =  897 bits (2318), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 420/602 (69%), Positives = 506/602 (84%), Gaps = 4/602 (0%)

Query: 6   TPLSRIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSS--QVLDNMDIERERGITIKA 63
           +P++ IRNFSIVAHIDHGKSTLADR IQ   GLT+REM+   QVLD+MDIERERGITIKA
Sbjct: 4   SPIANIRNFSIVAHIDHGKSTLADRLIQMTGGLTDREMAGKEQVLDSMDIERERGITIKA 63

Query: 64  QTVRLNYTSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANV 123
           QTVRL Y + D KDY  NL+DTPGHVDF YEVSRSL+ACEGSLLVVDA+QGVEAQTLANV
Sbjct: 64  QTVRLKYRAKDGKDYVFNLMDTPGHVDFAYEVSRSLAACEGSLLVVDASQGVEAQTLANV 123

Query: 124 YQAIDNNHEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERI 183
           YQA+DNNHEI+ VLNK DLP+A+ D+VK+QIE+ IGI   DA+++SAKTG G+P +LE I
Sbjct: 124 YQALDNNHEIVPVLNKVDLPAAEADKVKQQIEDVIGIDASDAVMISAKTGLGVPDVLEAI 183

Query: 184 VQQLPSPTSPEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQV 243
           V +LP P      +A LKALL+DSWY+ YLGV+VL+R+I+G L KG  IR+MGT+A Y V
Sbjct: 184 VTRLPPPKGDR--DATLKALLVDSWYDVYLGVVVLIRVIDGVLRKGSRIRMMGTSAAYDV 241

Query: 244 ERIGILTPKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPV 303
           ER+G  TPKM  ++ L PGEIG + A+IKEV+ TRVGDTITDD  P T  LPGFKP  PV
Sbjct: 242 ERVGFFTPKMQQVDELGPGEIGFITAAIKEVADTRVGDTITDDRKPVTEMLPGFKPAIPV 301

Query: 304 VFCGLFPVDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQER 363
           VFCGLFPVDA  FE LRTA+ KLRLNDASFSFE+E S ALGFGFRCGFLGLLHLEIIQER
Sbjct: 302 VFCGLFPVDADDFETLRTAMGKLRLNDASFSFEMETSAALGFGFRCGFLGLLHLEIIQER 361

Query: 364 LEREFSLNLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEY 423
           L REF LNLI T+PSV+Y++++ DG   ++ NPIDMP+V KIAE+ EPWI+ TI+TP+EY
Sbjct: 362 LSREFDLNLIATAPSVIYKMHLTDGQEIEIHNPIDMPDVVKIAEIEEPWIEATILTPDEY 421

Query: 424 LGSILKLCQERRGIQIDMSHLDNRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVID 483
           LG +LKLCQ+RRG+Q +++++  RAM+ Y+LPLNEV+FDFYDRLKSVSKGYASFDY++ +
Sbjct: 422 LGGVLKLCQDRRGVQKELTYVGARAMVKYDLPLNEVVFDFYDRLKSVSKGYASFDYHLTE 481

Query: 484 YRDSDLVKLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGG 543
           Y+ +DLVK+ ILVN E +DALS+LVHR+ +E RGR + EK+K LIP  MFQI IQAAIGG
Sbjct: 482 YKPADLVKMQILVNGEPVDALSMLVHRTRAEGRGRAMVEKMKELIPPHMFQIPIQAAIGG 541

Query: 544 RIIARETVKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISILKT 603
           ++IARETV+A RKDVTAKCYGGD++RKRKLLEKQKEGKK+MR+FG+VDIPQ AFI+ LK 
Sbjct: 542 KVIARETVRALRKDVTAKCYGGDVSRKRKLLEKQKEGKKKMRQFGKVDIPQEAFIAALKV 601

Query: 604 DN 605
           D+
Sbjct: 602 DS 603


>gi|27383261|ref|NP_774790.1| GTP-binding protein LepA [Bradyrhizobium japonicum USDA 110]
 gi|27356435|dbj|BAC53415.1| GTP-binding elongation factor [Bradyrhizobium japonicum USDA 110]
          Length = 616

 Score =  897 bits (2317), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 419/601 (69%), Positives = 504/601 (83%), Gaps = 4/601 (0%)

Query: 7   PLSRIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSS--QVLDNMDIERERGITIKAQ 64
           P+S IRNFSIVAHIDHGKSTLADR IQ   GLT+REM+   QVLD+MDIERERGITIKAQ
Sbjct: 18  PISNIRNFSIVAHIDHGKSTLADRLIQMTGGLTDREMAGKEQVLDSMDIERERGITIKAQ 77

Query: 65  TVRLNYTSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVY 124
           TVRL Y + D KDY  NL+DTPGHVDF YEVSRSL+ACEGSLLVVDA+QGVEAQTLANVY
Sbjct: 78  TVRLAYRAKDGKDYIFNLMDTPGHVDFAYEVSRSLAACEGSLLVVDASQGVEAQTLANVY 137

Query: 125 QAIDNNHEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERIV 184
           QA+DNNHEI+ VLNK DLP+A+P++VK+QIE+ IGI   DA+++SAKTG G+P +LE IV
Sbjct: 138 QALDNNHEIVPVLNKVDLPAAEPEKVKQQIEDVIGIDASDAVMISAKTGLGVPDVLEAIV 197

Query: 185 QQLPSPTSPEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVE 244
            +LP P      +A LKALL+DSWY+ YLGV+VL+R+++G + KG  +R+MGT A Y VE
Sbjct: 198 TRLPPPKGDR--DATLKALLVDSWYDVYLGVVVLIRVVDGVMKKGSRVRMMGTGAAYDVE 255

Query: 245 RIGILTPKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVV 304
           R+G  TPKM  ++ L PGEIG + A+IKEV+ TRVGDTITDD  P T  LPGFKP  PVV
Sbjct: 256 RVGFFTPKMTQVDELGPGEIGFITAAIKEVADTRVGDTITDDRKPVTEMLPGFKPAIPVV 315

Query: 305 FCGLFPVDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERL 364
           FCGLFPVDA  FE LR A+ KLRLNDASFSFE+E S ALGFGFRCGFLGLLHLEIIQERL
Sbjct: 316 FCGLFPVDADDFETLRAAMGKLRLNDASFSFEMETSAALGFGFRCGFLGLLHLEIIQERL 375

Query: 365 EREFSLNLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEYL 424
            REF LNLI T+PSV+Y++ + DG+  ++ NP+DMP+V KI E++EPWI+ TI+TP+EYL
Sbjct: 376 SREFDLNLIATAPSVIYKMKLTDGTELEIHNPVDMPDVVKIEEIQEPWIEATILTPDEYL 435

Query: 425 GSILKLCQERRGIQIDMSHLDNRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDY 484
           GS+LKLCQ+RRG Q +++++  RAM+ Y+LPLNEV+FDFYDRLKSVSKGYASFDY++ DY
Sbjct: 436 GSVLKLCQDRRGAQKELTYVGARAMVKYDLPLNEVVFDFYDRLKSVSKGYASFDYHLTDY 495

Query: 485 RDSDLVKLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGGR 544
           + +DLVK+ ILVN E +DALS+LVHR+ +E RGR + EK+K LIP  MFQI IQAAIGG+
Sbjct: 496 KPADLVKMQILVNAEPVDALSMLVHRTRAEGRGRAMVEKMKELIPPHMFQIPIQAAIGGK 555

Query: 545 IIARETVKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISILKTD 604
           +IARETV+A RKDVTAKCYGGDITRKRKLLEKQKEGKK+MR+FG+VDIPQ AFI+ LK D
Sbjct: 556 VIARETVRALRKDVTAKCYGGDITRKRKLLEKQKEGKKKMRQFGKVDIPQEAFIAALKVD 615

Query: 605 N 605
           +
Sbjct: 616 S 616


>gi|33112363|sp|Q89BJ8|LEPA_BRAJA RecName: Full=Elongation factor 4; Short=EF-4; AltName:
           Full=Ribosomal back-translocase LepA
          Length = 603

 Score =  896 bits (2316), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 419/601 (69%), Positives = 504/601 (83%), Gaps = 4/601 (0%)

Query: 7   PLSRIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSS--QVLDNMDIERERGITIKAQ 64
           P+S IRNFSIVAHIDHGKSTLADR IQ   GLT+REM+   QVLD+MDIERERGITIKAQ
Sbjct: 5   PISNIRNFSIVAHIDHGKSTLADRLIQMTGGLTDREMAGKEQVLDSMDIERERGITIKAQ 64

Query: 65  TVRLNYTSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVY 124
           TVRL Y + D KDY  NL+DTPGHVDF YEVSRSL+ACEGSLLVVDA+QGVEAQTLANVY
Sbjct: 65  TVRLAYRAKDGKDYIFNLMDTPGHVDFAYEVSRSLAACEGSLLVVDASQGVEAQTLANVY 124

Query: 125 QAIDNNHEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERIV 184
           QA+DNNHEI+ VLNK DLP+A+P++VK+QIE+ IGI   DA+++SAKTG G+P +LE IV
Sbjct: 125 QALDNNHEIVPVLNKVDLPAAEPEKVKQQIEDVIGIDASDAVMISAKTGLGVPDVLEAIV 184

Query: 185 QQLPSPTSPEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVE 244
            +LP P      +A LKALL+DSWY+ YLGV+VL+R+++G + KG  +R+MGT A Y VE
Sbjct: 185 TRLPPPKGDR--DATLKALLVDSWYDVYLGVVVLIRVVDGVMKKGSRVRMMGTGAAYDVE 242

Query: 245 RIGILTPKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVV 304
           R+G  TPKM  ++ L PGEIG + A+IKEV+ TRVGDTITDD  P T  LPGFKP  PVV
Sbjct: 243 RVGFFTPKMTQVDELGPGEIGFITAAIKEVADTRVGDTITDDRKPVTEMLPGFKPAIPVV 302

Query: 305 FCGLFPVDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERL 364
           FCGLFPVDA  FE LR A+ KLRLNDASFSFE+E S ALGFGFRCGFLGLLHLEIIQERL
Sbjct: 303 FCGLFPVDADDFETLRAAMGKLRLNDASFSFEMETSAALGFGFRCGFLGLLHLEIIQERL 362

Query: 365 EREFSLNLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEYL 424
            REF LNLI T+PSV+Y++ + DG+  ++ NP+DMP+V KI E++EPWI+ TI+TP+EYL
Sbjct: 363 SREFDLNLIATAPSVIYKMKLTDGTELEIHNPVDMPDVVKIEEIQEPWIEATILTPDEYL 422

Query: 425 GSILKLCQERRGIQIDMSHLDNRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDY 484
           GS+LKLCQ+RRG Q +++++  RAM+ Y+LPLNEV+FDFYDRLKSVSKGYASFDY++ DY
Sbjct: 423 GSVLKLCQDRRGAQKELTYVGARAMVKYDLPLNEVVFDFYDRLKSVSKGYASFDYHLTDY 482

Query: 485 RDSDLVKLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGGR 544
           + +DLVK+ ILVN E +DALS+LVHR+ +E RGR + EK+K LIP  MFQI IQAAIGG+
Sbjct: 483 KPADLVKMQILVNAEPVDALSMLVHRTRAEGRGRAMVEKMKELIPPHMFQIPIQAAIGGK 542

Query: 545 IIARETVKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISILKTD 604
           +IARETV+A RKDVTAKCYGGDITRKRKLLEKQKEGKK+MR+FG+VDIPQ AFI+ LK D
Sbjct: 543 VIARETVRALRKDVTAKCYGGDITRKRKLLEKQKEGKKKMRQFGKVDIPQEAFIAALKVD 602

Query: 605 N 605
           +
Sbjct: 603 S 603


>gi|312115729|ref|YP_004013325.1| GTP-binding protein LepA [Rhodomicrobium vannielii ATCC 17100]
 gi|311220858|gb|ADP72226.1| GTP-binding protein LepA [Rhodomicrobium vannielii ATCC 17100]
          Length = 638

 Score =  896 bits (2316), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 421/604 (69%), Positives = 512/604 (84%), Gaps = 3/604 (0%)

Query: 3   KKPTPLSRIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMS--SQVLDNMDIERERGIT 60
           K  TPLSRIRNFSIVAHIDHGKSTLADR IQ+C G+T+REM+  +QVLDNMDIE+ERGIT
Sbjct: 34  KTVTPLSRIRNFSIVAHIDHGKSTLADRLIQYCGGMTDREMAGQAQVLDNMDIEKERGIT 93

Query: 61  IKAQTVRLNYTSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTL 120
           IKAQTVRL+Y + D + YQLNL+DTPGHVDF YEVSRSL+ACEGSLLVVDA+QGVEAQTL
Sbjct: 94  IKAQTVRLDYKAEDGELYQLNLMDTPGHVDFAYEVSRSLAACEGSLLVVDASQGVEAQTL 153

Query: 121 ANVYQAIDNNHEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLL 180
           ANVYQA+DNNHEII VLNK DLP+A+PDRVK+QIE+ IG+   +A+ +SAKTG  I  +L
Sbjct: 154 ANVYQALDNNHEIIPVLNKIDLPAAEPDRVKQQIEDVIGLDASNAVEISAKTGLNIQAVL 213

Query: 181 ERIVQQLPSPTSPEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAK 240
           E IV +LP P   +   APLKA+LIDSWY+ YLGV+VLVR+I+G L KG  I+LM T   
Sbjct: 214 EAIVHRLPPPREGD-VKAPLKAMLIDSWYDPYLGVVVLVRMIDGVLKKGMRIKLMETGGV 272

Query: 241 YQVERIGILTPKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPI 300
           Y V+R+GI  PK   ++AL PGE+G    +IKEV+ TRVGDTIT++  PT  ALPGFKP+
Sbjct: 273 YPVDRVGIFRPKQEMLDALRPGEVGFFTGAIKEVADTRVGDTITEEKRPTAKALPGFKPV 332

Query: 301 QPVVFCGLFPVDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEII 360
           QPVVFCGLFPVDA+QFE+LR A+ KLRLNDASF +E+E S ALGFGFRCGFLGLLHLEI+
Sbjct: 333 QPVVFCGLFPVDASQFEDLRDAMGKLRLNDASFQYEMETSAALGFGFRCGFLGLLHLEIV 392

Query: 361 QERLEREFSLNLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITP 420
           +ERLEREF+++LI T+PSV+Y LYM DG M+++ NP DMP++ KI  + EPWI+ TI+ P
Sbjct: 393 RERLEREFNIDLITTAPSVIYRLYMIDGQMEEMHNPADMPDIVKIDHIEEPWIKATILVP 452

Query: 421 NEYLGSILKLCQERRGIQIDMSHLDNRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYN 480
           ++YLG++LKLC++RRG QID+S+  NRAM+VYELPLNEV+FDFYDRLKSVS+GYASFDY 
Sbjct: 453 DDYLGAVLKLCEDRRGRQIDLSYAGNRAMVVYELPLNEVVFDFYDRLKSVSRGYASFDYQ 512

Query: 481 VIDYRDSDLVKLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAA 540
           +I+YR+ DLVK+TILVN E +DALSI+V+R  +E RGR +CEKLK LIP+ +FQI IQAA
Sbjct: 513 LIEYREGDLVKMTILVNAEPVDALSIIVNRGRAETRGRMMCEKLKELIPRHLFQIPIQAA 572

Query: 541 IGGRIIARETVKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISI 600
           IGG+IIARET+ A RKDVTAKCYGGD++RKRKLL+KQKEGKK+MR+FGRV+IPQ AFI+ 
Sbjct: 573 IGGKIIARETLSALRKDVTAKCYGGDVSRKRKLLDKQKEGKKKMRQFGRVEIPQEAFIAA 632

Query: 601 LKTD 604
           LK D
Sbjct: 633 LKMD 636


>gi|296447321|ref|ZP_06889249.1| GTP-binding protein LepA [Methylosinus trichosporium OB3b]
 gi|296255186|gb|EFH02285.1| GTP-binding protein LepA [Methylosinus trichosporium OB3b]
          Length = 601

 Score =  896 bits (2315), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 414/598 (69%), Positives = 508/598 (84%), Gaps = 2/598 (0%)

Query: 8   LSRIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVR 67
           +  IRNFSIVAHIDHGKSTLADR IQ    +  R+M  QVLD+MDIERERGITIKAQTVR
Sbjct: 6   IDNIRNFSIVAHIDHGKSTLADRLIQATGTVAARDMVEQVLDSMDIERERGITIKAQTVR 65

Query: 68  LNYTSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQAI 127
           L+Y + D KDY LNL+DTPGHVDF YEVSRSL ACEGSLLVVDA+QGVEAQTLANVYQA+
Sbjct: 66  LDYKAKDGKDYVLNLMDTPGHVDFAYEVSRSLKACEGSLLVVDASQGVEAQTLANVYQAL 125

Query: 128 DNNHEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERIVQQL 187
           D  HEI+ VLNK DLP+A+PDR+++QIE+ IG+   DA+L+SAKTG GIP +LE IV +L
Sbjct: 126 DAGHEIVPVLNKIDLPAAEPDRIRQQIEDVIGLDAADAVLISAKTGIGIPDVLEAIVTRL 185

Query: 188 PSPTSPEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVERIG 247
           P P   E  +APLKA+L+DSWY++YLGV+VLVR+I+G++ KGQ I +MGT+A Y++++IG
Sbjct: 186 PPPQGDE--DAPLKAMLVDSWYDAYLGVVVLVRVIDGRMRKGQKILMMGTSAHYEIDKIG 243

Query: 248 ILTPKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVVFCG 307
           +  PKM+D+ +L PGE+G + A IK+V+ TRVGDTIT+D  P  +ALPGFKP QPVVFCG
Sbjct: 244 VFKPKMLDVASLGPGEVGFITAQIKQVADTRVGDTITEDKKPCDAALPGFKPAQPVVFCG 303

Query: 308 LFPVDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERLERE 367
           LFPVDA +FE+LR AI KLRLNDASFS+E+E S ALGFGFRCGFLGLLHLEIIQERL RE
Sbjct: 304 LFPVDAAEFEDLRAAIGKLRLNDASFSYEMETSAALGFGFRCGFLGLLHLEIIQERLHRE 363

Query: 368 FSLNLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEYLGSI 427
           F+L+LI T+PSVVY++ + +G   +L NP DMP+V KIAE++EPWI+ TI+TP++YLGS+
Sbjct: 364 FNLDLIATAPSVVYKIKLTNGDEIELHNPADMPDVVKIAEIQEPWIRATIMTPDDYLGSV 423

Query: 428 LKLCQERRGIQIDMSHLDNRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDYRDS 487
           LKLCQ+RRG+Q D++++  RAM VY+LPLNEV+FDFYDRLKS+SKGYASFDY++ DYR  
Sbjct: 424 LKLCQDRRGVQADLNYVGKRAMAVYDLPLNEVVFDFYDRLKSISKGYASFDYHITDYRAG 483

Query: 488 DLVKLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGGRIIA 547
           DLVK++ILVN E +DALS+LVHR+ ++ RGR +CEKLK LIP  MFQ+ IQAAIGG+IIA
Sbjct: 484 DLVKMSILVNAEPVDALSMLVHRTRADSRGRQMCEKLKELIPPHMFQVPIQAAIGGKIIA 543

Query: 548 RETVKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISILKTDN 605
           RETV+A RKDVTAKCYGGD TRKRKLLEKQKEGKK+MR+FGRV+IPQ AFI+ LK + 
Sbjct: 544 RETVRAFRKDVTAKCYGGDATRKRKLLEKQKEGKKKMRQFGRVEIPQEAFIAALKMEE 601


>gi|158421881|ref|YP_001523173.1| GTP-binding protein LepA [Azorhizobium caulinodans ORS 571]
 gi|158328770|dbj|BAF86255.1| GTP-binding LepA protein [Azorhizobium caulinodans ORS 571]
          Length = 612

 Score =  895 bits (2313), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 418/600 (69%), Positives = 507/600 (84%), Gaps = 2/600 (0%)

Query: 6   TPLSRIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQT 65
           T    IRNFSIVAHIDHGKSTLADR IQ   GL+EREMS QVLDNMDIERERGITIKAQT
Sbjct: 15  TAQKNIRNFSIVAHIDHGKSTLADRLIQLTGGLSEREMSDQVLDNMDIERERGITIKAQT 74

Query: 66  VRLNYTSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQ 125
           VRL+Y + D + Y LNLIDTPGHVDF YEVSRSL+A EGSLLVVDA+QGVEAQTLANVYQ
Sbjct: 75  VRLSYKAQDGETYTLNLIDTPGHVDFAYEVSRSLAAVEGSLLVVDASQGVEAQTLANVYQ 134

Query: 126 AIDNNHEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERIVQ 185
           AIDNNH+I+ VLNK DLP+A+P++VK QIE+ IG+   +A+ +SAKTG  I  +LE IV 
Sbjct: 135 AIDNNHDIVPVLNKIDLPAAEPEKVKSQIEDVIGLDASNAIGISAKTGLNIDQVLEAIVT 194

Query: 186 QLPSPTSPEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVER 245
           +LP+P       APLKALL+DSWY++YLGV+VLVRII+G L KG  I++MG +A Y V+R
Sbjct: 195 RLPAPVGDR--EAPLKALLVDSWYDTYLGVVVLVRIIDGVLKKGMRIKMMGADAVYDVDR 252

Query: 246 IGILTPKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVVF 305
           +G+ TPKM+ +E+L PGEIG +  SIKEV+ TRVGDTITDD  PT+ ALPGFKP QPVVF
Sbjct: 253 VGVFTPKMVAMESLGPGEIGFLNGSIKEVADTRVGDTITDDKRPTSEALPGFKPAQPVVF 312

Query: 306 CGLFPVDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERLE 365
           CGLFPVDA  FE+LR A+ KLRLNDASFSFE+E S ALGFGFRCGFLGLLHLEIIQERL 
Sbjct: 313 CGLFPVDAADFEDLRAAMGKLRLNDASFSFEMETSAALGFGFRCGFLGLLHLEIIQERLS 372

Query: 366 REFSLNLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEYLG 425
           REF+L+LI T+PSV+Y++ + DGS   L NP DMP+V KI E+REPWI+ TI+TP++YLG
Sbjct: 373 REFNLDLIATAPSVIYQMELTDGSTIDLHNPADMPDVVKIEEIREPWIRATIMTPDDYLG 432

Query: 426 SILKLCQERRGIQIDMSHLDNRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDYR 485
           ++LKLCQ+RRG QI+++++  RAM+ Y+LPLNEV+FDFYD+LKS+SKGYASFDYN+ DYR
Sbjct: 433 AVLKLCQDRRGNQIELTYVGARAMVTYDLPLNEVVFDFYDKLKSISKGYASFDYNITDYR 492

Query: 486 DSDLVKLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGGRI 545
             +LVK++ILVN E +DALS+LVHR+ +E RGR +CEKLK+LIPQ +F I IQAAIG ++
Sbjct: 493 PGELVKMSILVNGEPVDALSMLVHRTRAEFRGRAMCEKLKDLIPQHLFNIPIQAAIGAKV 552

Query: 546 IARETVKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISILKTDN 605
           IARET+KA RKDVTAKCYGGD++RKRKLL+KQKEGKK+MR+FG+V+IPQ AFI+ LK D+
Sbjct: 553 IARETIKALRKDVTAKCYGGDVSRKRKLLDKQKEGKKKMRQFGKVEIPQEAFIAALKMDD 612


>gi|254505149|ref|ZP_05117300.1| GTP-binding protein LepA [Labrenzia alexandrii DFL-11]
 gi|222441220|gb|EEE47899.1| GTP-binding protein LepA [Labrenzia alexandrii DFL-11]
          Length = 604

 Score =  894 bits (2309), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 418/598 (69%), Positives = 506/598 (84%), Gaps = 4/598 (0%)

Query: 8   LSRIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVR 67
           LS IRNFSIVAHIDHGKSTLADR IQ    +T+REM+ Q+LD+MDIERERGITIKAQTVR
Sbjct: 9   LSNIRNFSIVAHIDHGKSTLADRLIQMTGTVTDREMTEQLLDSMDIERERGITIKAQTVR 68

Query: 68  LNYTSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQAI 127
           L Y + D + Y LNLIDTPGHVDF YEVSRSL+ACEGSLLVVDA+QGVEAQTLANVYQAI
Sbjct: 69  LIYNAKDGQQYILNLIDTPGHVDFAYEVSRSLAACEGSLLVVDASQGVEAQTLANVYQAI 128

Query: 128 DNNHEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERIVQQL 187
           +N+HEI+ VLNK DLP+A+P+R+++QIE+ IGI   +A ++SAKTG G+  +LE IV +L
Sbjct: 129 ENDHEIVPVLNKVDLPAAEPERIQEQIEDVIGIDASEACMISAKTGLGVDTVLEAIVAKL 188

Query: 188 PSPTSPEG-ANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVERI 246
           P+P   EG  +  LKA+L+DSWY++YLGVMVLVR+ING L KGQ I++MGT A Y V+R+
Sbjct: 189 PAP---EGDPDDTLKAMLVDSWYDTYLGVMVLVRVINGSLKKGQKIKMMGTGAAYDVDRV 245

Query: 247 GILTPKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVVFC 306
           G++TPK + ++ L  GEIGV+  SIKEV+ TRVGDTIT +  P T ALPGFKP QPVVFC
Sbjct: 246 GVMTPKFLQVDELKAGEIGVITGSIKEVADTRVGDTITLEKKPCTEALPGFKPAQPVVFC 305

Query: 307 GLFPVDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERLER 366
           GLFPVDA  FE+LR A+ KLRLNDASFSFE+E S ALGFGFRCGFLGLLHLEIIQERL R
Sbjct: 306 GLFPVDANDFEDLRAAMGKLRLNDASFSFEMETSAALGFGFRCGFLGLLHLEIIQERLSR 365

Query: 367 EFSLNLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEYLGS 426
           EF+L+LI T+PSVVY++ M DG+   L NP DMPEV KI+E+REPWI+ +I+TP++YLG 
Sbjct: 366 EFNLDLIATAPSVVYQMTMTDGTDIDLHNPADMPEVVKISEIREPWIRASIMTPDDYLGG 425

Query: 427 ILKLCQERRGIQIDMSHLDNRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDYRD 486
           ILKLCQERRGIQ+D+S++ +RA++ Y+LPLNEV+FDFYDRLKS+SKGYASFDY + DYR 
Sbjct: 426 ILKLCQERRGIQVDLSYVGSRALVAYDLPLNEVVFDFYDRLKSISKGYASFDYQISDYRA 485

Query: 487 SDLVKLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGGRII 546
            DLVK++ILVN+E +DALS+LVHRS +E+RGR + EKLK LIP+ MF+I IQAAIGG++I
Sbjct: 486 GDLVKMSILVNDEPVDALSVLVHRSQAERRGRAMVEKLKELIPRHMFKIPIQAAIGGKVI 545

Query: 547 ARETVKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISILKTD 604
           ARET+ A RKDVTAKCYGGD TRKRKLLEKQK GKK+MR+FG+V+IPQ AFI  LK D
Sbjct: 546 ARETLSALRKDVTAKCYGGDATRKRKLLEKQKAGKKKMRQFGKVEIPQEAFIQALKMD 603


>gi|254705505|ref|ZP_05167333.1| GTP-binding protein LepA [Brucella pinnipedialis M163/99/10]
 gi|261312909|ref|ZP_05952106.1| GTP-binding protein lepA [Brucella pinnipedialis M163/99/10]
 gi|261301935|gb|EEY05432.1| GTP-binding protein lepA [Brucella pinnipedialis M163/99/10]
          Length = 601

 Score =  892 bits (2305), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 422/574 (73%), Positives = 493/574 (85%), Gaps = 1/574 (0%)

Query: 6   TPLSRIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQT 65
           TPL  IRNFSIVAHIDHGKSTLADR IQ   GL  REM  QVLD+MDIERERGITIKAQT
Sbjct: 3   TPLDHIRNFSIVAHIDHGKSTLADRLIQLTGGLDTREMKDQVLDSMDIERERGITIKAQT 62

Query: 66  VRLNYTSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQ 125
           VRL+Y + + +DY LNLIDTPGHVDF YEVSRSL+ACEGSLLVVDA+QGVEAQTLANVYQ
Sbjct: 63  VRLSYKAKNGEDYVLNLIDTPGHVDFAYEVSRSLAACEGSLLVVDASQGVEAQTLANVYQ 122

Query: 126 AIDNNHEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERIVQ 185
           AIDNNHEI+ VLNK DLP+A+P+RVK+QIEE IGI   DA+ +SAKTG GI  +LE IV 
Sbjct: 123 AIDNNHEIVVVLNKIDLPAAEPERVKQQIEEVIGIDASDAVEISAKTGLGIEDVLEAIVN 182

Query: 186 QLPSPTSPEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVER 245
           +LP+P   +  NAPLKA+L+DSWY+SYLGV+VLVR+I+G L KGQ+IR+MGT AKY VER
Sbjct: 183 KLPAPKEGD-RNAPLKAMLVDSWYDSYLGVIVLVRVIDGVLKKGQTIRMMGTGAKYPVER 241

Query: 246 IGILTPKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVVF 305
            G+ TPKM+ ++ L PGE+G + ASIKEV+ TRVGDTIT+D  PT + L GFKP QPVVF
Sbjct: 242 TGVFTPKMVQVDDLGPGELGFITASIKEVADTRVGDTITEDRRPTENMLSGFKPAQPVVF 301

Query: 306 CGLFPVDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERLE 365
           CGLFPVDA  FE+LR A+ KLRLNDASFSFE+E S ALGFGFRCGFLGLLHLEIIQERLE
Sbjct: 302 CGLFPVDAADFEDLRGAMGKLRLNDASFSFEMETSAALGFGFRCGFLGLLHLEIIQERLE 361

Query: 366 REFSLNLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEYLG 425
           REF+L+LI T+PSVVY L M DG+ ++L NP DMP+V KIA + EPWI+ TI+TP++YLG
Sbjct: 362 REFNLDLITTAPSVVYRLNMTDGTHKELHNPADMPDVVKIASIEEPWIKATIMTPDDYLG 421

Query: 426 SILKLCQERRGIQIDMSHLDNRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDYR 485
           +I+KLCQERRGIQID++++  RAMI Y+LPLNEV+FDFYDRLKS+SKGYASFDYN+ DYR
Sbjct: 422 AIMKLCQERRGIQIDLTYVGPRAMITYDLPLNEVVFDFYDRLKSISKGYASFDYNLSDYR 481

Query: 486 DSDLVKLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGGRI 545
           + DLVK++ILVN E +DALS+LVHRS +EKRGR +CEKLK LIPQ MF+I IQAAIGGRI
Sbjct: 482 EGDLVKMSILVNEEPVDALSMLVHRSAAEKRGRALCEKLKELIPQHMFKIPIQAAIGGRI 541

Query: 546 IARETVKARRKDVTAKCYGGDITRKRKLLEKQKE 579
           +ARET+ A RKDVTAKCYGGD+TRKRKLLEKQKE
Sbjct: 542 VARETISALRKDVTAKCYGGDVTRKRKLLEKQKE 575


>gi|154245110|ref|YP_001416068.1| GTP-binding protein LepA [Xanthobacter autotrophicus Py2]
 gi|238686706|sp|A7IEG8|LEPA_XANP2 RecName: Full=Elongation factor 4; Short=EF-4; AltName:
           Full=Ribosomal back-translocase LepA
 gi|154159195|gb|ABS66411.1| GTP-binding protein LepA [Xanthobacter autotrophicus Py2]
          Length = 601

 Score =  890 bits (2300), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 417/594 (70%), Positives = 502/594 (84%), Gaps = 2/594 (0%)

Query: 11  IRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVRLNY 70
           IRNFSIVAHIDHGKSTLADR IQ   GLTEREM+ QVLD+MDIERERGITIKAQTVRL+Y
Sbjct: 9   IRNFSIVAHIDHGKSTLADRLIQITGGLTEREMTDQVLDSMDIERERGITIKAQTVRLSY 68

Query: 71  TSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQAIDNN 130
            + D + Y LNLIDTPGHVDF YEV+RSL+A EGSLLVVDA+QGVEAQTLANVYQAIDNN
Sbjct: 69  KAKDGETYILNLIDTPGHVDFAYEVNRSLAAVEGSLLVVDASQGVEAQTLANVYQAIDNN 128

Query: 131 HEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERIVQQLPSP 190
           H+I+ VLNK DLP+A+P++VK QIE+ IG+   DA+ +SAKTG  +  +LE IV +LP P
Sbjct: 129 HDIVPVLNKVDLPAAEPEKVKAQIEDVIGLDASDAIGISAKTGLNVDQVLEAIVTRLPPP 188

Query: 191 TSPEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVERIGILT 250
                A  PLKALL+DSWY++YLGV+VLVRII+G L KGQ I++MG+ A   V+R+G+ T
Sbjct: 189 MGDRAA--PLKALLVDSWYDTYLGVVVLVRIIDGVLKKGQRIKMMGSGAVNDVDRVGVFT 246

Query: 251 PKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVVFCGLFP 310
           PKM+ +  L PGEIG +  SIKEV+ TRVGDTIT+D  P    LPGFKP QPVVFCGLFP
Sbjct: 247 PKMVAMAELGPGEIGFLTGSIKEVADTRVGDTITEDKRPCADMLPGFKPAQPVVFCGLFP 306

Query: 311 VDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERLEREFSL 370
           VDA QFE+LR A+ KLRLNDASFS+E+E S ALGFGFRCGFLGLLHLEIIQERLEREF+L
Sbjct: 307 VDAAQFEDLRAAMGKLRLNDASFSYEMETSAALGFGFRCGFLGLLHLEIIQERLEREFNL 366

Query: 371 NLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEYLGSILKL 430
           +LI T+PSV+YE+ M DGS+  L NP DMP+V KI E+REPWI+ TI+TP+EYLGS+LKL
Sbjct: 367 DLIATAPSVIYEIQMTDGSVIDLHNPADMPDVVKIEEIREPWIRATILTPDEYLGSVLKL 426

Query: 431 CQERRGIQIDMSHLDNRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDYRDSDLV 490
           CQ+RRG QI+++++  RAM+ Y+LPLNEV+FDFYDRLKS+SKGYASFDY + +YR  DLV
Sbjct: 427 CQDRRGTQIELTYVGARAMVTYDLPLNEVVFDFYDRLKSISKGYASFDYQITEYRAGDLV 486

Query: 491 KLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGGRIIARET 550
           K++ILVN+E +DALS+LVHR+ ++ RGR +CEKLK+LIPQ +F I IQAAIG +IIARET
Sbjct: 487 KMSILVNSEPVDALSMLVHRARADARGRVMCEKLKDLIPQHLFNIPIQAAIGAKIIARET 546

Query: 551 VKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISILKTD 604
           +KA RKDVTAKCYGGDI+RKRKLL+KQKEGKK+MR+FG+V+IPQ AFI+ LK D
Sbjct: 547 IKALRKDVTAKCYGGDISRKRKLLDKQKEGKKKMRQFGKVEIPQEAFIAALKMD 600


>gi|295690601|ref|YP_003594294.1| GTP-binding protein LepA [Caulobacter segnis ATCC 21756]
 gi|295432504|gb|ADG11676.1| GTP-binding protein LepA [Caulobacter segnis ATCC 21756]
          Length = 608

 Score =  887 bits (2292), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 414/601 (68%), Positives = 500/601 (83%), Gaps = 2/601 (0%)

Query: 6   TPLSRIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQT 65
           TPL +IRNFSIVAHIDHGKSTL+DR IQ   GLT REMS+QVLDNMDIE+ERGITIKAQT
Sbjct: 10  TPLDKIRNFSIVAHIDHGKSTLSDRLIQTTGGLTAREMSAQVLDNMDIEKERGITIKAQT 69

Query: 66  VRLNYTSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQ 125
           VRL Y + D + Y LNL+DTPGHVDF YEVSRSL+ACEGS+LVVDA+QGVEAQTLANVYQ
Sbjct: 70  VRLTYKAADGETYILNLMDTPGHVDFAYEVSRSLAACEGSILVVDASQGVEAQTLANVYQ 129

Query: 126 AIDNNHEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERIVQ 185
           AIDNNHEI+ VLNK DLP+AD DRVK QIE+ IG+   DA+  SAKTG GIP +LE IV 
Sbjct: 130 AIDNNHEIVPVLNKVDLPAADVDRVKAQIEDVIGLDASDAVECSAKTGLGIPDVLEAIVT 189

Query: 186 QLPSPTSPEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVER 245
           +LP P      NAPLKALL+D+WY++YLGV+VLVRI +G L  GQ +R+M T A +++++
Sbjct: 190 RLPPPKGDR--NAPLKALLVDAWYDAYLGVVVLVRIFDGTLKAGQQVRMMQTGATHRIDK 247

Query: 246 IGILTPKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVVF 305
           +G+ TPK  D+  L PGE+G   ASIKEV+   VGDTITD+  PT  AL GFK + PVVF
Sbjct: 248 VGVFTPKATDVAELGPGEVGFFTASIKEVADAAVGDTITDEKKPTAEALKGFKEVVPVVF 307

Query: 306 CGLFPVDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERLE 365
           CGLFPVDA  FE+LR A+ KLRLNDASF++E+E+S ALGFGFRCGFLGLLHLEIIQERL 
Sbjct: 308 CGLFPVDAADFEDLRAAVGKLRLNDASFTYEMESSAALGFGFRCGFLGLLHLEIIQERLS 367

Query: 366 REFSLNLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEYLG 425
           REF L+LI T+PSVVY++ + +G   +L NP D+P+V +I E+ EPWI+ TI TP+EYLG
Sbjct: 368 REFDLDLIATAPSVVYKIKLRNGDEIELHNPADLPDVMQIEEIAEPWIKATIFTPDEYLG 427

Query: 426 SILKLCQERRGIQIDMSHLDNRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDYR 485
            ++KLCQ+RRG+Q ++S++ +RAM+VY+LPLNEV+FDFYDRLKS+SKGYASFDY + DYR
Sbjct: 428 GVIKLCQDRRGMQRELSYVGSRAMVVYDLPLNEVVFDFYDRLKSISKGYASFDYQLEDYR 487

Query: 486 DSDLVKLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGGRI 545
             DLVK++ILVN+E +DALS+LVHRS +E RGRG+CEK+K LIPQ MF I IQAAIGGRI
Sbjct: 488 AGDLVKMSILVNSEPVDALSMLVHRSRAESRGRGMCEKMKELIPQHMFVIPIQAAIGGRI 547

Query: 546 IARETVKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISILKTDN 605
           IARETV+A RKDVTAKCYGGD +RKRKLL+KQKEGKKRMR+FG+V+IPQ AFI+ LK D 
Sbjct: 548 IARETVRALRKDVTAKCYGGDASRKRKLLDKQKEGKKRMRQFGKVEIPQEAFIAALKMDE 607

Query: 606 E 606
           +
Sbjct: 608 D 608


>gi|188580443|ref|YP_001923888.1| GTP-binding protein LepA [Methylobacterium populi BJ001]
 gi|226732764|sp|B1ZC10|LEPA_METPB RecName: Full=Elongation factor 4; Short=EF-4; AltName:
           Full=Ribosomal back-translocase LepA
 gi|179343941|gb|ACB79353.1| GTP-binding protein LepA [Methylobacterium populi BJ001]
          Length = 601

 Score =  885 bits (2286), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 416/598 (69%), Positives = 499/598 (83%), Gaps = 2/598 (0%)

Query: 8   LSRIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVR 67
           +  IRNFSIVAHIDHGKSTLADR IQ    +  R+MS Q+LD+MDIERERGITIKA TVR
Sbjct: 6   IDNIRNFSIVAHIDHGKSTLADRLIQQTGTVALRDMSEQMLDSMDIERERGITIKANTVR 65

Query: 68  LNYTSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQAI 127
           L Y + D +DY LNL+DTPGHVDF YEVSRSL+ACEGSLLVVDA+QGVEAQTLANVYQA+
Sbjct: 66  LEYKAEDGQDYVLNLMDTPGHVDFAYEVSRSLAACEGSLLVVDASQGVEAQTLANVYQAL 125

Query: 128 DNNHEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERIVQQL 187
           D NHEI+ VLNK DLP+A+PDRVK+QIEE IG+   +A+ +SAKTG  I  +LE IV++L
Sbjct: 126 DANHEIVPVLNKVDLPAAEPDRVKEQIEEVIGLDASEAVPISAKTGLNIEAVLEAIVKRL 185

Query: 188 PSPTSPEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVERIG 247
           P P       APLKALL+DSWY+ YLGV+VLVRI++G L KG +IR+MG +A Y V+RIG
Sbjct: 186 PPPKGDR--EAPLKALLVDSWYDVYLGVVVLVRIVDGVLKKGMTIRMMGADAAYGVDRIG 243

Query: 248 ILTPKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVVFCG 307
           +  PKM DI  L PGE+G    SIKEV+ TRVGDTIT+D   TT  LPGFK +Q VVFCG
Sbjct: 244 VFRPKMADIGELGPGEVGFFTGSIKEVADTRVGDTITEDKRQTTQMLPGFKEVQAVVFCG 303

Query: 308 LFPVDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERLERE 367
           LFPVDA  FENLR A+ KLRLNDASFS+E+E S ALGFGFRCGFLGLLHLEIIQERLERE
Sbjct: 304 LFPVDAADFENLRGAMGKLRLNDASFSYEMETSAALGFGFRCGFLGLLHLEIIQERLERE 363

Query: 368 FSLNLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEYLGSI 427
           F+L+LI T+PSVVY L M DG +++L NP DMP+  KI  + EPWI+ TI+TP++YLG +
Sbjct: 364 FNLDLISTAPSVVYRLMMRDGELKELHNPADMPDPMKIETVEEPWIRATILTPDDYLGGV 423

Query: 428 LKLCQERRGIQIDMSHLDNRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDYRDS 487
           LKLCQ+RRGIQID++++  RAM+VY+LPLNEV+FDFYDRLKS+SKGYASFDY+V DYR+ 
Sbjct: 424 LKLCQDRRGIQIDLNYVGKRAMVVYDLPLNEVVFDFYDRLKSISKGYASFDYHVSDYREG 483

Query: 488 DLVKLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGGRIIA 547
           DLVK++ILVN E +DALS+LVHR+ +E RGR +CEKLK+LIP+ +FQI +QAAIGG+IIA
Sbjct: 484 DLVKMSILVNAEPVDALSMLVHRTRAESRGRAMCEKLKDLIPRHLFQIPVQAAIGGKIIA 543

Query: 548 RETVKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISILKTDN 605
           RET++A  KDVTAKCYGGDI+RKRKLL+KQKEGKKRMR+FGRV+IPQ AFI+ LK D+
Sbjct: 544 RETIRALSKDVTAKCYGGDISRKRKLLDKQKEGKKRMRQFGRVEIPQEAFIAALKMDD 601


>gi|218529395|ref|YP_002420211.1| GTP-binding protein LepA [Methylobacterium chloromethanicum CM4]
 gi|240137724|ref|YP_002962196.1| GTP-binding protein lepA [Methylobacterium extorquens AM1]
 gi|254808738|sp|B7KR78|LEPA_METC4 RecName: Full=Elongation factor 4; Short=EF-4; AltName:
           Full=Ribosomal back-translocase LepA
 gi|218521698|gb|ACK82283.1| GTP-binding protein LepA [Methylobacterium chloromethanicum CM4]
 gi|240007693|gb|ACS38919.1| GTP-binding protein lepA [Methylobacterium extorquens AM1]
          Length = 601

 Score =  884 bits (2285), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 417/598 (69%), Positives = 500/598 (83%), Gaps = 2/598 (0%)

Query: 8   LSRIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVR 67
           +  IRNFSIVAHIDHGKSTLADR IQ    +  R+MS Q+LD+MDIE+ERGITIKAQTVR
Sbjct: 6   IDNIRNFSIVAHIDHGKSTLADRLIQTTGTVALRDMSEQMLDSMDIEKERGITIKAQTVR 65

Query: 68  LNYTSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQAI 127
           L Y + D KDY LNL+DTPGHVDF YEVSRSL+ACEGSLLVVDA+QGVEAQTLANVYQA+
Sbjct: 66  LEYRAEDGKDYILNLMDTPGHVDFAYEVSRSLAACEGSLLVVDASQGVEAQTLANVYQAL 125

Query: 128 DNNHEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERIVQQL 187
           D NHEI+ VLNK DLP+A+PDRVK+QIEE IG+   +A+ +SAKTG  I  +LE IV++L
Sbjct: 126 DANHEIVPVLNKVDLPAAEPDRVKEQIEEVIGLDASEAVPISAKTGLNIEAVLEAIVKRL 185

Query: 188 PSPTSPEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVERIG 247
           P+P       APLKALL+DSWY+ YLGV+VLVRII+G L KG +IR+MG +A Y V+RIG
Sbjct: 186 PAPKGDR--EAPLKALLVDSWYDVYLGVVVLVRIIDGVLKKGMTIRMMGADAAYGVDRIG 243

Query: 248 ILTPKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVVFCG 307
           +  PKM DI  L PGE+G    SIKEV+ TRVGDTIT+D   TT  L GFK +Q VVFCG
Sbjct: 244 VFRPKMADIGELGPGEVGFFTGSIKEVADTRVGDTITEDKRQTTQMLAGFKEVQAVVFCG 303

Query: 308 LFPVDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERLERE 367
           LFPVDA  FE+LR A+ KLRLNDASFS+E+E S ALGFGFRCGFLGLLHLEIIQERLERE
Sbjct: 304 LFPVDAADFESLRGAMGKLRLNDASFSYEMETSAALGFGFRCGFLGLLHLEIIQERLERE 363

Query: 368 FSLNLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEYLGSI 427
           F+L+LI T+PSVVY L M DG +++L NP DMP+  KI  + EPWI+ TI+TP+EYLG +
Sbjct: 364 FNLDLISTAPSVVYRLLMRDGELKELHNPADMPDPMKIETVEEPWIRATILTPDEYLGGV 423

Query: 428 LKLCQERRGIQIDMSHLDNRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDYRDS 487
           LKLCQ+RRGIQID++++  RAM+VY+LPLNEV+FDFYDRLKS+SKGYASFDY+V DYR+ 
Sbjct: 424 LKLCQDRRGIQIDLNYVGKRAMVVYDLPLNEVVFDFYDRLKSISKGYASFDYHVSDYREG 483

Query: 488 DLVKLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGGRIIA 547
           DLVK++ILVN E +DALS+LVHR+ +E RGR +CEKLK+LIP+ +FQI +QAAIGG+IIA
Sbjct: 484 DLVKMSILVNAEPVDALSMLVHRTRAESRGRAMCEKLKDLIPRHLFQIPVQAAIGGKIIA 543

Query: 548 RETVKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISILKTDN 605
           RET++A  KDVTAKCYGGDI+RKRKLL+KQKEGKKRMR+FGRV+IPQ AFI+ LK D+
Sbjct: 544 RETIRALSKDVTAKCYGGDISRKRKLLDKQKEGKKRMRQFGRVEIPQEAFIAALKMDD 601


>gi|254560297|ref|YP_003067392.1| GTP-binding protein lepA [Methylobacterium extorquens DM4]
 gi|254267575|emb|CAX23417.1| GTP-binding protein lepA [Methylobacterium extorquens DM4]
          Length = 601

 Score =  884 bits (2283), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 417/598 (69%), Positives = 499/598 (83%), Gaps = 2/598 (0%)

Query: 8   LSRIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVR 67
           +  IRNFSIVAHIDHGKSTLADR IQ    +  R+MS Q+LD+MDIE+ERGITIKAQTVR
Sbjct: 6   IDNIRNFSIVAHIDHGKSTLADRLIQTTGTVALRDMSEQMLDSMDIEKERGITIKAQTVR 65

Query: 68  LNYTSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQAI 127
           L Y + D KDY LNL+DTPGHVDF YEVSRSL+ACEGSLLVVDA+QGVEAQTLANVYQA+
Sbjct: 66  LEYRAEDGKDYILNLMDTPGHVDFAYEVSRSLAACEGSLLVVDASQGVEAQTLANVYQAL 125

Query: 128 DNNHEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERIVQQL 187
           D NHEI+ VLNK DLP+A+PDRVK+QIEE IG+   +A+ +SAKTG  I  +LE IV++L
Sbjct: 126 DANHEIVPVLNKVDLPAAEPDRVKEQIEEVIGLDASEAVPISAKTGLNIEAVLEAIVKRL 185

Query: 188 PSPTSPEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVERIG 247
           P+P       APLKALL+DSWY+ YLGV+VLVRII+G L KG +IR+MG +A Y V+RIG
Sbjct: 186 PAPKGDR--EAPLKALLVDSWYDVYLGVVVLVRIIDGVLKKGMTIRMMGADAAYGVDRIG 243

Query: 248 ILTPKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVVFCG 307
           +  PKM DI  L PGE+G    SIKEV+ TRVGDTIT+D   TT  L GFK +Q VVFCG
Sbjct: 244 VFRPKMADIGELGPGEVGFFTGSIKEVADTRVGDTITEDKRQTTQMLAGFKEVQAVVFCG 303

Query: 308 LFPVDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERLERE 367
           LFPVDA  FE+LR A+ KLRLNDASFS+E+E S ALGFGFRCGFLGLLHLEIIQERLERE
Sbjct: 304 LFPVDAADFESLRGAMGKLRLNDASFSYEMETSAALGFGFRCGFLGLLHLEIIQERLERE 363

Query: 368 FSLNLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEYLGSI 427
           F+L+LI T+PSVVY L M DG +++L NP DMP+  KI  + EPWI+ TI+TP+EYLG +
Sbjct: 364 FNLDLISTAPSVVYRLLMRDGELKELHNPADMPDPMKIETVEEPWIRATILTPDEYLGGV 423

Query: 428 LKLCQERRGIQIDMSHLDNRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDYRDS 487
           LKLCQ+RRGIQID++++  RAM+VY+LPLNEV+FDFYDRLKS+SKGYASFDY+V DYR+ 
Sbjct: 424 LKLCQDRRGIQIDLNYVGKRAMVVYDLPLNEVVFDFYDRLKSISKGYASFDYHVSDYREG 483

Query: 488 DLVKLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGGRIIA 547
           DLVK++ILVN E +DALS+LVHR+ +E RGR +CEKLK LIP+ +FQI +QAAIGG+IIA
Sbjct: 484 DLVKMSILVNAEPVDALSMLVHRTRAESRGRAMCEKLKELIPRHLFQIPVQAAIGGKIIA 543

Query: 548 RETVKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISILKTDN 605
           RET++A  KDVTAKCYGGDI+RKRKLL+KQKEGKKRMR+FGRV+IPQ AFI+ LK D+
Sbjct: 544 RETIRALSKDVTAKCYGGDISRKRKLLDKQKEGKKRMRQFGRVEIPQEAFIAALKMDD 601


>gi|163850670|ref|YP_001638713.1| GTP-binding protein LepA [Methylobacterium extorquens PA1]
 gi|163662275|gb|ABY29642.1| GTP-binding protein LepA [Methylobacterium extorquens PA1]
          Length = 606

 Score =  882 bits (2280), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 416/598 (69%), Positives = 500/598 (83%), Gaps = 2/598 (0%)

Query: 8   LSRIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVR 67
           +  IRNFSIVAHIDHGKSTLADR IQ    +  R+MS Q+LD+MDIE+ERGITIKAQTVR
Sbjct: 11  IDNIRNFSIVAHIDHGKSTLADRLIQTTGTVALRDMSEQMLDSMDIEKERGITIKAQTVR 70

Query: 68  LNYTSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQAI 127
           L Y + D +DY LNL+DTPGHVDF YEVSRSL+ACEGSLLVVDA+QGVEAQTLANVYQA+
Sbjct: 71  LEYRAEDGRDYILNLMDTPGHVDFAYEVSRSLAACEGSLLVVDASQGVEAQTLANVYQAL 130

Query: 128 DNNHEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERIVQQL 187
           D NHEI+ VLNK DLP+A+PDRVK+QIEE IG+   +A+ +SAKTG  I  +LE IV++L
Sbjct: 131 DANHEIVPVLNKVDLPAAEPDRVKEQIEEVIGLDASEAVPISAKTGLNIEAVLEAIVKRL 190

Query: 188 PSPTSPEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVERIG 247
           P+P       APLKALL+DSWY+ YLGV+VLVRII+G L KG +IR+MG +A Y V+RIG
Sbjct: 191 PAPKGDR--EAPLKALLVDSWYDVYLGVVVLVRIIDGVLKKGMTIRMMGADAAYGVDRIG 248

Query: 248 ILTPKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVVFCG 307
           +  PKM DI  L PGE+G    SIKEV+ TRVGDTIT+D   TT  L GFK +Q VVFCG
Sbjct: 249 VFRPKMADIGELGPGEVGFFTGSIKEVADTRVGDTITEDKRQTTQMLAGFKEVQAVVFCG 308

Query: 308 LFPVDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERLERE 367
           LFPVDA  FE+LR A+ KLRLNDASFS+E+E S ALGFGFRCGFLGLLHLEIIQERLERE
Sbjct: 309 LFPVDAADFESLRGAMGKLRLNDASFSYEMETSAALGFGFRCGFLGLLHLEIIQERLERE 368

Query: 368 FSLNLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEYLGSI 427
           F+L+LI T+PSVVY L M DG +++L NP DMP+  KI  + EPWI+ TI+TP+EYLG +
Sbjct: 369 FNLDLISTAPSVVYRLLMRDGELKELHNPADMPDPMKIETVEEPWIRATILTPDEYLGGV 428

Query: 428 LKLCQERRGIQIDMSHLDNRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDYRDS 487
           LKLCQ+RRGIQID++++  RAM+VY+LPLNEV+FDFYDRLKS+SKGYASFDY+V DYR+ 
Sbjct: 429 LKLCQDRRGIQIDLNYVGKRAMVVYDLPLNEVVFDFYDRLKSISKGYASFDYHVSDYREG 488

Query: 488 DLVKLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGGRIIA 547
           DLVK++ILVN E +DALS+LVHR+ +E RGR +CEKLK+LIP+ +FQI +QAAIGG+IIA
Sbjct: 489 DLVKMSILVNAEPVDALSMLVHRTRAESRGRAMCEKLKDLIPRHLFQIPVQAAIGGKIIA 548

Query: 548 RETVKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISILKTDN 605
           RET++A  KDVTAKCYGGDI+RKRKLL+KQKEGKKRMR+FGRV+IPQ AFI+ LK D+
Sbjct: 549 RETIRALSKDVTAKCYGGDISRKRKLLDKQKEGKKRMRQFGRVEIPQEAFIAALKMDD 606


>gi|300021903|ref|YP_003754514.1| GTP-binding protein LepA [Hyphomicrobium denitrificans ATCC 51888]
 gi|299523724|gb|ADJ22193.1| GTP-binding protein LepA [Hyphomicrobium denitrificans ATCC 51888]
          Length = 600

 Score =  882 bits (2278), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 411/600 (68%), Positives = 502/600 (83%), Gaps = 2/600 (0%)

Query: 6   TPLSRIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQT 65
           T +SRIRNFSI+AHIDHGKSTL+DR IQ C  +T REM +Q+LD+MDIERERGITIKAQT
Sbjct: 2   TDISRIRNFSIIAHIDHGKSTLSDRLIQLCGNVTNREMKAQILDSMDIERERGITIKAQT 61

Query: 66  VRLNYTSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQ 125
           VRL+Y + D + YQLNL+DTPGHVDF YEVSRSL+ACEG++LVVDA+QGVEAQTLANVYQ
Sbjct: 62  VRLDYKAKDGEIYQLNLMDTPGHVDFAYEVSRSLAACEGAILVVDASQGVEAQTLANVYQ 121

Query: 126 AIDNNHEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERIVQ 185
           A+DNN EI+ VLNK DLP+AD DRVK+QIE+ IGI   DA+ VSAKTG  +  +LE IV+
Sbjct: 122 ALDNNLEILPVLNKIDLPAADADRVKQQIEDVIGIDASDAIGVSAKTGLNVEAVLEAIVE 181

Query: 186 QLPSPTSPEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVER 245
           +LP P        PLKA+LIDSWY++YLGV+VLVR+I+G L KGQ ++LM + A YQ+ER
Sbjct: 182 RLPPPKG--DGTKPLKAMLIDSWYDAYLGVIVLVRVIDGTLKKGQRVKLMSSGADYQIER 239

Query: 246 IGILTPKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVVF 305
           +GI  PK   +E L PGE+G   A+IKEV+ TRVGDT+TD+ +PT  ALPGFKP QPVVF
Sbjct: 240 VGIFRPKQEMLEKLGPGEVGFFTAAIKEVADTRVGDTVTDEKNPTAEALPGFKPAQPVVF 299

Query: 306 CGLFPVDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERLE 365
           CGLFPVDA  FE+LR A+ KLRLNDASFSFE E+S ALGFGFRCGFLGLLHLEII ERLE
Sbjct: 300 CGLFPVDAADFEDLREAMGKLRLNDASFSFEAESSAALGFGFRCGFLGLLHLEIITERLE 359

Query: 366 REFSLNLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEYLG 425
           REF+L+LI T+PSV+Y L+M+DG+M ++ NP DMPEV +I  + EPWI+ TI+ P++YLG
Sbjct: 360 REFNLDLITTAPSVIYHLHMNDGTMIEMHNPADMPEVVRIDHIEEPWIEATILVPDDYLG 419

Query: 426 SILKLCQERRGIQIDMSHLDNRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDYR 485
           ++LKLCQ+RRG Q  +++  +RAM++YELPLNEV+FDFYDRLKSVS+GYASFDY++ DY 
Sbjct: 420 AVLKLCQDRRGRQKQLTYAGSRAMVIYELPLNEVVFDFYDRLKSVSRGYASFDYHIKDYE 479

Query: 486 DSDLVKLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGGRI 545
           + DLVKL+ILVN+E +DALSI+VHRS +E RGR +CEKLK LIP  +FQI IQAAIG ++
Sbjct: 480 EGDLVKLSILVNSEPVDALSIVVHRSRAESRGRSMCEKLKELIPPHLFQIPIQAAIGAKV 539

Query: 546 IARETVKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISILKTDN 605
           IARET+KA RKDV AKCYGGDITRKRKLL+KQK GKK+MR FG+V+IPQ AFI+ LK D+
Sbjct: 540 IARETIKALRKDVLAKCYGGDITRKRKLLDKQKAGKKKMREFGKVEIPQEAFINALKMDD 599


>gi|209886689|ref|YP_002290546.1| GTP-binding protein LepA [Oligotropha carboxidovorans OM5]
 gi|229485820|sp|B6JJT7|LEPA_OLICO RecName: Full=Elongation factor 4; Short=EF-4; AltName:
           Full=Ribosomal back-translocase LepA
 gi|209874885|gb|ACI94681.1| GTP-binding protein LepA [Oligotropha carboxidovorans OM5]
          Length = 601

 Score =  879 bits (2272), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 426/600 (71%), Positives = 508/600 (84%), Gaps = 2/600 (0%)

Query: 6   TPLSRIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQT 65
           TP+S +RNFSIVAHIDHGKSTLADR IQ   GL +REM  QVLD+MDIERERGITIKAQT
Sbjct: 4   TPISNVRNFSIVAHIDHGKSTLADRLIQTTGGLQDREMKEQVLDSMDIERERGITIKAQT 63

Query: 66  VRLNYTSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQ 125
           VRL Y + D KDY LNL+DTPGHVDF YEVSR L+ACEG+LLVVDA+QGVEAQTLANVYQ
Sbjct: 64  VRLRYKAKDGKDYILNLMDTPGHVDFAYEVSRCLAACEGALLVVDASQGVEAQTLANVYQ 123

Query: 126 AIDNNHEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERIVQ 185
           AIDNN EI+ VLNK DLP+A+PD+VK+QIE+ IGI   +A++VSAKTG GIP +LE IV 
Sbjct: 124 AIDNNLEIVPVLNKVDLPAAEPDQVKQQIEDVIGIDASEAIMVSAKTGIGIPDVLEAIVT 183

Query: 186 QLPSPTSPEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVER 245
           +LP P      +A LKALL+DSWY+ YLGV+VLVR+++G L KG  IR+MGTNA Y VER
Sbjct: 184 RLPPPKGDR--DATLKALLVDSWYDVYLGVVVLVRVVDGVLKKGDRIRMMGTNAAYDVER 241

Query: 246 IGILTPKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVVF 305
           +G+ TPKM++++ L PGE+G + A+IKEV+ TRVGDTITDD  P T  LPGFKP  PVVF
Sbjct: 242 VGVFTPKMVNVDELGPGEVGFITAAIKEVADTRVGDTITDDRKPITEMLPGFKPAIPVVF 301

Query: 306 CGLFPVDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERLE 365
           CGLFPVDA  FE LR A+ KLRLNDASFSFE+E S ALGFGFRCGFLGLLHLEIIQERL 
Sbjct: 302 CGLFPVDADDFETLRGAMGKLRLNDASFSFEMETSAALGFGFRCGFLGLLHLEIIQERLS 361

Query: 366 REFSLNLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEYLG 425
           REF+LNLI T+PSV+Y++++ DG   ++ NPIDMP+V KIAE+ EPWI+ TI+TP++YLG
Sbjct: 362 REFNLNLIATAPSVIYKMHLTDGQEIEIHNPIDMPDVVKIAEIEEPWIEATIMTPDDYLG 421

Query: 426 SILKLCQERRGIQIDMSHLDNRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDYR 485
           ++LKLCQERRG Q +++++ +RAM  YELPLNEV+FDFYDRLKSVSKGYASFDY++ DY+
Sbjct: 422 AVLKLCQERRGTQKELTYVGSRAMAKYELPLNEVVFDFYDRLKSVSKGYASFDYHLTDYK 481

Query: 486 DSDLVKLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGGRI 545
            +DLVK+ ILVNNE +DALS+LVHRS +E RGR + EK+K LIP  MFQI IQAAIGG++
Sbjct: 482 AADLVKMQILVNNEPVDALSMLVHRSRAEGRGRAMVEKMKELIPPHMFQIPIQAAIGGKV 541

Query: 546 IARETVKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISILKTDN 605
           IARETV+A RKDVTAKCYGGDITRKRKLLEKQKEGKK+MR+FG+VDIPQ AFI+ LK D+
Sbjct: 542 IARETVRALRKDVTAKCYGGDITRKRKLLEKQKEGKKKMRQFGKVDIPQEAFIAALKVDS 601


>gi|319898266|ref|YP_004158359.1| GTP-binding protein LepA [Bartonella clarridgeiae 73]
 gi|319402230|emb|CBI75763.1| GTP-binding protein LepA [Bartonella clarridgeiae 73]
          Length = 578

 Score =  879 bits (2271), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 410/576 (71%), Positives = 491/576 (85%), Gaps = 1/576 (0%)

Query: 27  LADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVRLNYTSTDAKDYQLNLIDTP 86
           +ADR IQ   GL  REM  QVLD+MDIERERGITIKAQTVRL Y + + + Y LNLIDTP
Sbjct: 1   MADRLIQMTGGLETREMKEQVLDSMDIERERGITIKAQTVRLRYKAKNGETYILNLIDTP 60

Query: 87  GHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQAIDNNHEIITVLNKADLPSAD 146
           GHVDF YEVSRSL+ACEGSLLVVDA+QGVEAQTLANVYQAIDN+HE++ VLNK DLP+A+
Sbjct: 61  GHVDFAYEVSRSLAACEGSLLVVDASQGVEAQTLANVYQAIDNSHELVVVLNKVDLPAAE 120

Query: 147 PDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERIVQQLPSPTSPEGANAPLKALLID 206
           P+RVK+QIE+ IGI T  A+ +SAKTG GI  +LE I+ QLP P +    + PLK +L+D
Sbjct: 121 PERVKEQIEDVIGIDTSKAVEISAKTGFGIADVLEEIITQLPPPHTGNVID-PLKVMLVD 179

Query: 207 SWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVERIGILTPKMIDIEALYPGEIGV 266
           SWY++YLGV+VLVR+I+G L KGQ+IR+MGT AKY VER+G+ TPKM+ ++ L PGEIG 
Sbjct: 180 SWYDAYLGVIVLVRVIDGVLKKGQTIRMMGTGAKYPVERVGVFTPKMVSVDKLGPGEIGF 239

Query: 267 MIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVVFCGLFPVDATQFENLRTAINKL 326
           + ASIKEV+ TR+GDTIT+D  P   ALPGFKP QPVVFCG+FPVDA  FENLR A+ KL
Sbjct: 240 ITASIKEVADTRIGDTITEDRRPCKKALPGFKPAQPVVFCGIFPVDAADFENLRAAMGKL 299

Query: 327 RLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERLEREFSLNLIGTSPSVVYELYMH 386
           RLNDASFSFE+E S ALGFGFRCGFLGLLHLEIIQERLEREF+L+LI T+PSV+Y + M+
Sbjct: 300 RLNDASFSFEMETSAALGFGFRCGFLGLLHLEIIQERLEREFNLDLIATAPSVIYRMNMN 359

Query: 387 DGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEYLGSILKLCQERRGIQIDMSHLDN 446
           DGS+++L NP DMP+V K+  + EPWI+ TI+TPN YLG+IL+LCQERRG+Q  +S++  
Sbjct: 360 DGSVKELHNPADMPDVVKVVSIEEPWIRATIMTPNNYLGAILELCQERRGLQTGLSYVGT 419

Query: 447 RAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDYRDSDLVKLTILVNNETIDALSI 506
           RAM++Y+LPLNEVIFDFYDRLKS+SKGYASFDY V DY + DLVK++ILVN E+IDALS+
Sbjct: 420 RAMVMYDLPLNEVIFDFYDRLKSISKGYASFDYQVTDYSEGDLVKMSILVNGESIDALSM 479

Query: 507 LVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGGRIIARETVKARRKDVTAKCYGGD 566
           LVHRS++EKRGR +CEKLK+LIPQ MFQI IQAAIGG+IIARET++A RKDVTAKCYGGD
Sbjct: 480 LVHRSIAEKRGRSMCEKLKDLIPQHMFQIPIQAAIGGKIIARETIRALRKDVTAKCYGGD 539

Query: 567 ITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISILK 602
           ITRKRKLLEKQK GKKRMR+FG+V+IPQSAFI  LK
Sbjct: 540 ITRKRKLLEKQKAGKKRMRQFGKVEIPQSAFIQALK 575


>gi|167645146|ref|YP_001682809.1| GTP-binding protein LepA [Caulobacter sp. K31]
 gi|167347576|gb|ABZ70311.1| GTP-binding protein LepA [Caulobacter sp. K31]
          Length = 602

 Score =  878 bits (2269), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 410/601 (68%), Positives = 499/601 (83%), Gaps = 2/601 (0%)

Query: 6   TPLSRIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQT 65
           TPL  IRNFSIVAHIDHGKSTL+DR IQ   GLT REM++QVLDNMDIE+ERGITIKAQT
Sbjct: 4   TPLHLIRNFSIVAHIDHGKSTLSDRLIQETGGLTAREMTAQVLDNMDIEKERGITIKAQT 63

Query: 66  VRLNYTSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQ 125
           VRL+Y + D + Y LNL+DTPGHVDF YEVSRSL+ACEGS+LVVDA+QGVEAQTLANVY 
Sbjct: 64  VRLDYKADDGQTYVLNLMDTPGHVDFAYEVSRSLAACEGSILVVDASQGVEAQTLANVYS 123

Query: 126 AIDNNHEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERIVQ 185
           AIDNNHEI+ VLNK DLP+A+P+RV+ QIE+ IG+   DA+L SAK+G GI  +LE IV 
Sbjct: 124 AIDNNHEIVPVLNKIDLPAAEPERVRAQIEDLIGLDASDAVLASAKSGVGIHEVLEAIVT 183

Query: 186 QLPSPTSPEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVER 245
           +LP P   E  NAPLKALL+D+WY++YLGV+VLVR+I+G+L  GQ I++M   + + V+R
Sbjct: 184 RLPPPKGDE--NAPLKALLVDAWYDAYLGVVVLVRVIDGRLKAGQKIKMMQHGSTHLVDR 241

Query: 246 IGILTPKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVVF 305
           +G+  PK   +E+L PGEIG + A IKEV+   VGDTITD+  PT  ALPGFK +QPVVF
Sbjct: 242 VGVFKPKNTPVESLGPGEIGFITAQIKEVADAAVGDTITDEKKPTDKALPGFKDVQPVVF 301

Query: 306 CGLFPVDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERLE 365
           CGLFPVDA  FE+LR A+ KLRLND SF++E+E+S ALGFGFRCGFLGLLHLEIIQERL 
Sbjct: 302 CGLFPVDAADFEDLRAAVGKLRLNDGSFTYEMESSAALGFGFRCGFLGLLHLEIIQERLS 361

Query: 366 REFSLNLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEYLG 425
           REF L+LI T+PSVVY+++M DG+  +L NP D+P+V +I  + EPWI+ TI TP+EYLG
Sbjct: 362 REFDLDLIATAPSVVYKIHMRDGAEIELHNPADLPDVMQIESISEPWIKATIFTPDEYLG 421

Query: 426 SILKLCQERRGIQIDMSHLDNRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDYR 485
            ++KLCQ+RRG Q ++S++ +RAM+VY+LPLNEV+FDFYDRLKS+SKGYASFDY V DYR
Sbjct: 422 GVIKLCQDRRGAQRELSYVGSRAMVVYDLPLNEVVFDFYDRLKSISKGYASFDYQVEDYR 481

Query: 486 DSDLVKLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGGRI 545
             DLVK++ILVN E +DALS+LVHR  +E RGRG+CEK+K LIPQ MF I IQAAIGGRI
Sbjct: 482 VGDLVKMSILVNAEPVDALSMLVHRDRAESRGRGMCEKMKELIPQHMFVIPIQAAIGGRI 541

Query: 546 IARETVKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISILKTDN 605
           IARETV+A RKDVTAKCYGGD +RKRKLL+KQK GKKRMR+FG+V+IPQ AFI+ LK D 
Sbjct: 542 IARETVRALRKDVTAKCYGGDASRKRKLLDKQKAGKKRMRQFGKVEIPQEAFIAALKMDG 601

Query: 606 E 606
           +
Sbjct: 602 D 602


>gi|182680029|ref|YP_001834175.1| GTP-binding protein LepA [Beijerinckia indica subsp. indica ATCC
           9039]
 gi|182635912|gb|ACB96686.1| GTP-binding protein LepA [Beijerinckia indica subsp. indica ATCC
           9039]
          Length = 616

 Score =  875 bits (2262), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 413/600 (68%), Positives = 495/600 (82%), Gaps = 2/600 (0%)

Query: 6   TPLSRIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQT 65
           TP+  IRNFSIVAHIDHGKSTLADR IQ    L EREM  QVLD+MDIERERGITIKAQT
Sbjct: 19  TPIDHIRNFSIVAHIDHGKSTLADRLIQATGTLAEREMVEQVLDSMDIERERGITIKAQT 78

Query: 66  VRLNYTSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQ 125
           VRL Y + D + Y LNL+DTPGHVDF YEVSRSL+ACEGSLLVVDA+QGVEAQTLANVY 
Sbjct: 79  VRLEYRAKDGELYVLNLMDTPGHVDFAYEVSRSLAACEGSLLVVDASQGVEAQTLANVYH 138

Query: 126 AIDNNHEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERIVQ 185
           A+D  HEI+ VLNK DLP+A+PDR+K+QIE+ IG+   +A+L+SAKTG GI  +LE IV 
Sbjct: 139 ALDAGHEIVPVLNKIDLPAAEPDRIKQQIEDVIGLDASNAVLISAKTGLGIDEVLEAIVT 198

Query: 186 QLPSPTSPEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVER 245
           +LP P   +   APLKALL+DSWY++YLGV+VLVRII+G L K Q I+++G+ A Y+V+R
Sbjct: 199 RLPPPKGDK--EAPLKALLVDSWYDAYLGVVVLVRIIDGTLKKNQKIQMLGSGAHYEVDR 256

Query: 246 IGILTPKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVVF 305
           IG+  PKM D+  L PGE+G + A IK+V+ TRVGDTITD+  P + ALPGFKP QPVVF
Sbjct: 257 IGVFRPKMQDLPELGPGEVGFITAQIKQVADTRVGDTITDERRPCSEALPGFKPAQPVVF 316

Query: 306 CGLFPVDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERLE 365
           CGLFPVDA  F++LR A+ KLRLNDASFS+E+E+S ALGFGFRCGFLGLLHLEIIQERLE
Sbjct: 317 CGLFPVDAADFDDLRAAMGKLRLNDASFSYEMESSAALGFGFRCGFLGLLHLEIIQERLE 376

Query: 366 REFSLNLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEYLG 425
           REF+L+LI T+PSVVY + M DG   +L NP DMP+ T+I  + EPWI+ TI+TP++YLG
Sbjct: 377 REFNLDLIATAPSVVYRIVMRDGETIELHNPADMPDPTRIEAIEEPWIRATILTPDDYLG 436

Query: 426 SILKLCQERRGIQIDMSHLDNRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDYR 485
           ++LKLCQERRG+Q D+S++  RAM  Y+LPLNEV+FDFYDRLKS+SKGYASFDY + DYR
Sbjct: 437 AVLKLCQERRGLQADLSYVGKRAMATYDLPLNEVVFDFYDRLKSISKGYASFDYAITDYR 496

Query: 486 DSDLVKLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGGRI 545
             DLVK+ ILVN E +DALS+LVHR  ++ RGR + EKLK LIP  MFQI IQAAIGG+I
Sbjct: 497 AGDLVKMQILVNAEPVDALSMLVHRDRADMRGRAMVEKLKELIPPHMFQIPIQAAIGGKI 556

Query: 546 IARETVKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISILKTDN 605
           IARETV+A RKDVTAKCYGGD TRKRKLLEKQK GKK+MR+FG+V+IPQ AFI+ LK D+
Sbjct: 557 IARETVRALRKDVTAKCYGGDATRKRKLLEKQKAGKKKMRQFGKVEIPQEAFIAALKMDS 616


>gi|225629489|ref|ZP_03787522.1| GTP-binding protein LepA [Brucella ceti str. Cudo]
 gi|225615985|gb|EEH13034.1| GTP-binding protein LepA [Brucella ceti str. Cudo]
          Length = 601

 Score =  875 bits (2261), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 418/590 (70%), Positives = 491/590 (83%), Gaps = 6/590 (1%)

Query: 6   TPLSRIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQT 65
           TPL  IRNFSIVAHIDHGKSTLADR IQ   GL  REM  QVLD+MDIERERGITIKAQT
Sbjct: 3   TPLDHIRNFSIVAHIDHGKSTLADRLIQLTGGLDTREMKDQVLDSMDIERERGITIKAQT 62

Query: 66  VRLNYTSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQ 125
           VRL+Y + + +DY LNLIDTPGHVDF YEVSRSL+ACEGSLLVVDA+QGVEAQTLANVYQ
Sbjct: 63  VRLSYKAKNGEDYVLNLIDTPGHVDFAYEVSRSLAACEGSLLVVDASQGVEAQTLANVYQ 122

Query: 126 AIDNNHEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERIVQ 185
           AIDNNHEI+ VLNK DLP+A+P+RVK+QIEE IGI   DA+ +SAKTG GI  +LE IV 
Sbjct: 123 AIDNNHEIVVVLNKIDLPAAEPERVKQQIEEVIGIDASDAVEISAKTGLGIEDVLEAIVN 182

Query: 186 QLPSPTSPEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVER 245
           +LP+P   +  NAPLKA+L+DSWY+SYLGV+VLVR+I+G L KGQ+IR+MGT AKY VER
Sbjct: 183 KLPAPKEGD-RNAPLKAMLVDSWYDSYLGVIVLVRVIDGVLKKGQTIRMMGTGAKYPVER 241

Query: 246 IGILTPKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVVF 305
            G+ TPKM+ ++ L PGE+G + ASIKEV+ TRVGDTIT+D  PT + L GFKP QPVVF
Sbjct: 242 TGVFTPKMVQVDDLGPGELGFITASIKEVADTRVGDTITEDRRPTENMLSGFKPAQPVVF 301

Query: 306 CGLFPVDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERLE 365
           CGLFPVDA  FE+LR A+ KLRLNDASFSFE+E S ALGFGFRCGFLGLLHLEIIQERLE
Sbjct: 302 CGLFPVDAADFEDLRGAMGKLRLNDASFSFEMETSAALGFGFRCGFLGLLHLEIIQERLE 361

Query: 366 REFSLNLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEYLG 425
           REF+L+LI T+PSVVY L M DG+ ++L NP DMP+V KIA + EPWI+ TI+TP++YLG
Sbjct: 362 REFNLDLITTAPSVVYRLNMTDGTHKELHNPADMPDVVKIASIEEPWIKATIMTPDDYLG 421

Query: 426 SILKLCQERRGIQIDMSHLDNRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDYR 485
           +I+KLCQERRGIQID++++  RAMI Y+LPLNEV+FDFYDRLKS+SKGYASFDYN+ DYR
Sbjct: 422 AIMKLCQERRGIQIDLTYVGPRAMITYDLPLNEVVFDFYDRLKSISKGYASFDYNLSDYR 481

Query: 486 DSDLVKLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGGRI 545
           + DLVK++ILVN E +DALS+LVHRS +EKRGR +CEKLK LIPQ MF+I IQAAIGGRI
Sbjct: 482 EGDLVKMSILVNEEPVDALSMLVHRSAAEKRGRALCEKLKELIPQHMFKIPIQAAIGGRI 541

Query: 546 IARETVKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQS 595
           +ARET+ A RKDVTAKCYGGD+TRK      Q  GK   R+     + Q 
Sbjct: 542 VARETISALRKDVTAKCYGGDVTRK-----PQTSGKAEGRQEAHAPVRQG 586


>gi|217977357|ref|YP_002361504.1| GTP-binding protein LepA [Methylocella silvestris BL2]
 gi|254808740|sp|B8ENL1|LEPA_METSB RecName: Full=Elongation factor 4; Short=EF-4; AltName:
           Full=Ribosomal back-translocase LepA
 gi|217502733|gb|ACK50142.1| GTP-binding protein LepA [Methylocella silvestris BL2]
          Length = 601

 Score =  875 bits (2260), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 408/599 (68%), Positives = 494/599 (82%), Gaps = 2/599 (0%)

Query: 7   PLSRIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTV 66
           P+  IRNFSIVAHIDHGKSTLADR IQ    +  R+M  QVLD+MDIERERGITIKAQTV
Sbjct: 5   PIKNIRNFSIVAHIDHGKSTLADRLIQQTGAVAARDMVEQVLDSMDIERERGITIKAQTV 64

Query: 67  RLNYTSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQA 126
           RL Y + D + Y LNL+DTPGHVDF YEVSRSL+ACEGSLLVVDA+QGVEAQTLANVY A
Sbjct: 65  RLEYKAADGEAYILNLMDTPGHVDFAYEVSRSLAACEGSLLVVDASQGVEAQTLANVYHA 124

Query: 127 IDNNHEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERIVQQ 186
           +D  HEI+ VLNK DLP+A+P+R+K+QIE+ IG+    A+++SAKTG GI L+LE IV +
Sbjct: 125 LDAGHEIVPVLNKIDLPAAEPERIKQQIEDVIGLDASHAVMISAKTGVGIDLVLEAIVTR 184

Query: 187 LPSPTSPEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVERI 246
           LP P   E   APLKALL+DSWY++YLGV+VLVR+I+G L KGQ I++M  +A Y+V+RI
Sbjct: 185 LPPPQGDE--TAPLKALLVDSWYDAYLGVVVLVRVIDGVLRKGQKIKMMAADAHYEVDRI 242

Query: 247 GILTPKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVVFC 306
           G+  PKM D E L PGEIG + A IK+V+ TRVGDTITD+  P   ALPGFKP QPVVFC
Sbjct: 243 GVFRPKMQDAEQLSPGEIGFITAQIKQVADTRVGDTITDERRPCAQALPGFKPAQPVVFC 302

Query: 307 GLFPVDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERLER 366
           GLFPVDA  FE+LR A+ +LRLNDASFS+E+E+S ALGFGFRCGFLGLLHLEIIQERLER
Sbjct: 303 GLFPVDAADFEDLRAAMGRLRLNDASFSYEMESSAALGFGFRCGFLGLLHLEIIQERLER 362

Query: 367 EFSLNLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEYLGS 426
           EF+L+LI T+PSV+Y++   DG   +L NP DMP+ TKI  + EPWI+ TI+TP++YLG+
Sbjct: 363 EFNLDLIATAPSVIYKIVQRDGDTIELHNPADMPDPTKIETIEEPWIRATILTPDDYLGA 422

Query: 427 ILKLCQERRGIQIDMSHLDNRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDYRD 486
           +LKLCQERRG+Q+D++++  RAM VY+LPLNEV+FDFYDRLKS+SKGYASFDY + DYR 
Sbjct: 423 VLKLCQERRGVQVDLNYVGKRAMAVYDLPLNEVVFDFYDRLKSISKGYASFDYAITDYRP 482

Query: 487 SDLVKLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGGRII 546
            DLVK++ILVN E +DALS+LVHR  ++ RGR + EKLK LIP  MFQI IQAAIGG+II
Sbjct: 483 GDLVKMSILVNAEPVDALSMLVHRDRADTRGRVMVEKLKELIPPHMFQIPIQAAIGGKII 542

Query: 547 ARETVKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISILKTDN 605
           ARETV+A RKDVTAKCYGGD +RKRKLL+KQK GKK+MR+FG+V+IPQ AFI+ LK D 
Sbjct: 543 ARETVRALRKDVTAKCYGGDASRKRKLLDKQKAGKKKMRQFGKVEIPQEAFIAALKMDG 601


>gi|254294792|ref|YP_003060815.1| GTP-binding protein LepA [Hirschia baltica ATCC 49814]
 gi|254043323|gb|ACT60118.1| GTP-binding protein LepA [Hirschia baltica ATCC 49814]
          Length = 603

 Score =  872 bits (2254), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 408/598 (68%), Positives = 503/598 (84%), Gaps = 2/598 (0%)

Query: 10  RIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVRLN 69
           +IRNFSIVAHIDHGKSTLADR IQ   GLTEREM++QVLD+MDIERERGITIKAQTVRL+
Sbjct: 6   KIRNFSIVAHIDHGKSTLADRLIQVTGGLTEREMTAQVLDSMDIERERGITIKAQTVRLD 65

Query: 70  YTSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQAIDN 129
           YT+ D + Y LNL+DTPGHVDFTYEVSR L+ACEGSLLVVDA+QGVEAQTLANVYQAID 
Sbjct: 66  YTAEDGETYILNLMDTPGHVDFTYEVSRCLNACEGSLLVVDASQGVEAQTLANVYQAIDA 125

Query: 130 NHEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERIVQQLPS 189
           NHEI+ +LNK DLP+A+P+RVK+QIE+ IGI   DA+ +SAKTG G+P +LE I+++LP 
Sbjct: 126 NHEIVPILNKIDLPAAEPERVKEQIEDVIGIDASDAVEMSAKTGLGVPDVLEAIIKRLPP 185

Query: 190 PTSPEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVERIGIL 249
           P   +  NAPLKA L+D++Y+ Y+GV+V+VRI++G + K Q ++++ T A Y+++R+G  
Sbjct: 186 PKDGD-ENAPLKASLVDAYYDPYMGVVVIVRIMDGVMKKKQRVKMLKTGASYELDRVGYF 244

Query: 250 TP-KMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVVFCGL 308
            P ++ D +ALYPGE+G + ASIKEV+   VGDTITD   P   ALPGFK +QPVVFCGL
Sbjct: 245 RPGRLQDADALYPGEVGFLTASIKEVADCAVGDTITDVKRPCEGALPGFKEVQPVVFCGL 304

Query: 309 FPVDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERLEREF 368
           FPVDA  F++LR A+ KLRLNDASFS+E+E+S ALGFGFRCGFLGLLHLEIIQERL REF
Sbjct: 305 FPVDAADFDDLRNAMGKLRLNDASFSWEMESSAALGFGFRCGFLGLLHLEIIQERLSREF 364

Query: 369 SLNLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEYLGSIL 428
            L+LI T+PSVVYE+ M DGSM +L NP DMP+V +I E+REPWI  TI+TP+EYLG IL
Sbjct: 365 DLDLIATAPSVVYEMEMRDGSMIELHNPADMPDVMQIMEIREPWISSTIMTPDEYLGGIL 424

Query: 429 KLCQERRGIQIDMSHLDNRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDYRDSD 488
           KLCQERRG+Q D+S++  RAM+ YELPLNEV+FDFYDRLKS+SKGYASFDY V ++R  D
Sbjct: 425 KLCQERRGLQTDLSYVGTRAMVKYELPLNEVVFDFYDRLKSISKGYASFDYQVKEHRAED 484

Query: 489 LVKLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGGRIIAR 548
           LVK++ILVN E +DALS+LVHRS +E RGR +CE+LK+LIP+  F+I IQAAIGG++IAR
Sbjct: 485 LVKMSILVNEEPVDALSMLVHRSRAEGRGRAMCERLKDLIPRHQFKIPIQAAIGGKVIAR 544

Query: 549 ETVKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISILKTDNE 606
           ET+ A RKDVTAKCYGGD +RKRKLL+KQK GKKRMR+FG+V+IPQ AF++ LK D +
Sbjct: 545 ETIAAMRKDVTAKCYGGDASRKRKLLDKQKAGKKRMRQFGKVEIPQEAFVAALKMDGD 602


>gi|119371385|sp|Q21BS0|LEPA_RHOPB RecName: Full=Elongation factor 4; Short=EF-4; AltName:
           Full=Ribosomal back-translocase LepA
          Length = 601

 Score =  870 bits (2248), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 420/599 (70%), Positives = 501/599 (83%), Gaps = 2/599 (0%)

Query: 7   PLSRIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTV 66
           P+S IRNFSIVAHIDHGKSTLADR IQ   GL  REM  QVLD+MDIERERGITIKAQTV
Sbjct: 5   PISNIRNFSIVAHIDHGKSTLADRLIQTTGGLQAREMKEQVLDSMDIERERGITIKAQTV 64

Query: 67  RLNYTSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQA 126
           RLNY + D +DY  NL+DTPGHVDF YEVSRSL+ACEGSLLVVDA+QGVEAQTLANVY A
Sbjct: 65  RLNYHAQDGRDYIFNLMDTPGHVDFAYEVSRSLAACEGSLLVVDASQGVEAQTLANVYHA 124

Query: 127 IDNNHEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERIVQQ 186
           +D  HEI+ VLNK DLP+A+P++V++QIE+ IGI   +A+++SAKTG GI L+LE IV +
Sbjct: 125 LDAGHEIVPVLNKVDLPAAEPEQVRQQIEDVIGIDASEAVMISAKTGLGIDLVLEAIVHR 184

Query: 187 LPSPTSPEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVERI 246
           LP P       APLKALL+DSWY+ YLGV+VLVR+++G + KGQ IR+MGTNA Y +ER+
Sbjct: 185 LPPPQGDR--EAPLKALLVDSWYDVYLGVVVLVRVVDGVMKKGQRIRMMGTNAAYDLERV 242

Query: 247 GILTPKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVVFC 306
           G  TPKM  ++ L PGEIG + A IKEV+ TRVGDTITDD  P T  LPGFKP  PVVFC
Sbjct: 243 GFFTPKMTQVDELGPGEIGFITAGIKEVADTRVGDTITDDKKPVTEMLPGFKPAVPVVFC 302

Query: 307 GLFPVDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERLER 366
           GLFPVDA  FE LR A+ KLRLNDASFSFE+E S ALGFGFRCGFLGLLHLEIIQERL R
Sbjct: 303 GLFPVDADDFETLRAAMGKLRLNDASFSFEMETSAALGFGFRCGFLGLLHLEIIQERLSR 362

Query: 367 EFSLNLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEYLGS 426
           EF LNLI T+PSV+Y++++ DG+  ++ NPIDMP+V KIAE++EPWI+ TI+TP+EYLGS
Sbjct: 363 EFDLNLIATAPSVIYKMHLTDGTELEIHNPIDMPDVVKIAEIQEPWIEATILTPDEYLGS 422

Query: 427 ILKLCQERRGIQIDMSHLDNRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDYRD 486
           +LKLCQ+RRG Q +++++ +RAM+ Y LPLNEV+FDFYDRLKSVSKGYASFDY++ DY+ 
Sbjct: 423 VLKLCQDRRGTQKELTYVGSRAMVKYNLPLNEVVFDFYDRLKSVSKGYASFDYHLTDYQP 482

Query: 487 SDLVKLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGGRII 546
           +DLVK+ ILVN E +DALS+LVHR+ +E RGR + EK+K LIP  MF I IQAAIGG+II
Sbjct: 483 ADLVKMQILVNAEPVDALSMLVHRTRAEGRGRAMVEKMKELIPPHMFVIPIQAAIGGKII 542

Query: 547 ARETVKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISILKTDN 605
           ARETV+A RKDVTAKCYGGDITRKRKLLEKQKEGKK+MR+FG+VDIPQ AFI+ LK D+
Sbjct: 543 ARETVRALRKDVTAKCYGGDITRKRKLLEKQKEGKKKMRQFGKVDIPQEAFIAALKVDS 601


>gi|90422115|ref|YP_530485.1| GTP-binding protein LepA [Rhodopseudomonas palustris BisB18]
 gi|90104129|gb|ABD86166.1| GTP-binding protein LepA [Rhodopseudomonas palustris BisB18]
          Length = 637

 Score =  870 bits (2248), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 420/599 (70%), Positives = 501/599 (83%), Gaps = 2/599 (0%)

Query: 7   PLSRIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTV 66
           P+S IRNFSIVAHIDHGKSTLADR IQ   GL  REM  QVLD+MDIERERGITIKAQTV
Sbjct: 41  PISNIRNFSIVAHIDHGKSTLADRLIQTTGGLQAREMKEQVLDSMDIERERGITIKAQTV 100

Query: 67  RLNYTSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQA 126
           RLNY + D +DY  NL+DTPGHVDF YEVSRSL+ACEGSLLVVDA+QGVEAQTLANVY A
Sbjct: 101 RLNYHAQDGRDYIFNLMDTPGHVDFAYEVSRSLAACEGSLLVVDASQGVEAQTLANVYHA 160

Query: 127 IDNNHEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERIVQQ 186
           +D  HEI+ VLNK DLP+A+P++V++QIE+ IGI   +A+++SAKTG GI L+LE IV +
Sbjct: 161 LDAGHEIVPVLNKVDLPAAEPEQVRQQIEDVIGIDASEAVMISAKTGLGIDLVLEAIVHR 220

Query: 187 LPSPTSPEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVERI 246
           LP P       APLKALL+DSWY+ YLGV+VLVR+++G + KGQ IR+MGTNA Y +ER+
Sbjct: 221 LPPPQGDR--EAPLKALLVDSWYDVYLGVVVLVRVVDGVMKKGQRIRMMGTNAAYDLERV 278

Query: 247 GILTPKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVVFC 306
           G  TPKM  ++ L PGEIG + A IKEV+ TRVGDTITDD  P T  LPGFKP  PVVFC
Sbjct: 279 GFFTPKMTQVDELGPGEIGFITAGIKEVADTRVGDTITDDKKPVTEMLPGFKPAVPVVFC 338

Query: 307 GLFPVDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERLER 366
           GLFPVDA  FE LR A+ KLRLNDASFSFE+E S ALGFGFRCGFLGLLHLEIIQERL R
Sbjct: 339 GLFPVDADDFETLRAAMGKLRLNDASFSFEMETSAALGFGFRCGFLGLLHLEIIQERLSR 398

Query: 367 EFSLNLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEYLGS 426
           EF LNLI T+PSV+Y++++ DG+  ++ NPIDMP+V KIAE++EPWI+ TI+TP+EYLGS
Sbjct: 399 EFDLNLIATAPSVIYKMHLTDGTELEIHNPIDMPDVVKIAEIQEPWIEATILTPDEYLGS 458

Query: 427 ILKLCQERRGIQIDMSHLDNRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDYRD 486
           +LKLCQ+RRG Q +++++ +RAM+ Y LPLNEV+FDFYDRLKSVSKGYASFDY++ DY+ 
Sbjct: 459 VLKLCQDRRGTQKELTYVGSRAMVKYNLPLNEVVFDFYDRLKSVSKGYASFDYHLTDYQP 518

Query: 487 SDLVKLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGGRII 546
           +DLVK+ ILVN E +DALS+LVHR+ +E RGR + EK+K LIP  MF I IQAAIGG+II
Sbjct: 519 ADLVKMQILVNAEPVDALSMLVHRTRAEGRGRAMVEKMKELIPPHMFVIPIQAAIGGKII 578

Query: 547 ARETVKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISILKTDN 605
           ARETV+A RKDVTAKCYGGDITRKRKLLEKQKEGKK+MR+FG+VDIPQ AFI+ LK D+
Sbjct: 579 ARETVRALRKDVTAKCYGGDITRKRKLLEKQKEGKKKMRQFGKVDIPQEAFIAALKVDS 637


>gi|315499561|ref|YP_004088364.1| gtp-binding protein lepa [Asticcacaulis excentricus CB 48]
 gi|315417573|gb|ADU14213.1| GTP-binding protein LepA [Asticcacaulis excentricus CB 48]
          Length = 600

 Score =  868 bits (2242), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 414/601 (68%), Positives = 502/601 (83%), Gaps = 2/601 (0%)

Query: 6   TPLSRIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQT 65
           T LS+IRNFSIVAHIDHGKSTL+DR IQ   GLT REM  QVLDNM+IERERGITIKAQT
Sbjct: 2   TELSQIRNFSIVAHIDHGKSTLSDRLIQFTGGLTAREMKEQVLDNMEIERERGITIKAQT 61

Query: 66  VRLNYTSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQ 125
           VRLNY + D K Y LNL+DTPGHVDF YEVSRSL+ACEGS+LVVDA+QGVEAQTLANVYQ
Sbjct: 62  VRLNYKAKDGKSYVLNLMDTPGHVDFAYEVSRSLAACEGSILVVDASQGVEAQTLANVYQ 121

Query: 126 AIDNNHEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERIVQ 185
           AIDNNHEI+ VLNK DLP+A+P+RV+ QIE+ IGI   +A+L SAK+G GI  +LE IV 
Sbjct: 122 AIDNNHEIVPVLNKVDLPAAEPERVRAQIEDVIGIDASEAVLASAKSGIGIEDVLEAIVS 181

Query: 186 QLPSPTSPEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVER 245
           +LP+P       APLKALL+D+WY+ YLGV+VLVR+ +G L  GQ I+LM   A Y++++
Sbjct: 182 KLPAPKG--DPTAPLKALLVDAWYDPYLGVVVLVRVFDGFLKPGQQIKLMNAGATYKIDK 239

Query: 246 IGILTPKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVVF 305
           +G+  PK  D+EAL PGE+G   A IKEV    VGDTITD+  PT+ AL GFK +QPVVF
Sbjct: 240 LGVFQPKATDVEALGPGEVGFFTAQIKEVQDAAVGDTITDERKPTSQALTGFKEVQPVVF 299

Query: 306 CGLFPVDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERLE 365
           CG+FPVDA  FE+LR+A+ KLRLNDASFS+E+E S ALGFGFRCGFLGLLHLEIIQERL 
Sbjct: 300 CGIFPVDAADFEDLRSAMGKLRLNDASFSYEMETSAALGFGFRCGFLGLLHLEIIQERLS 359

Query: 366 REFSLNLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEYLG 425
           REF+L+LI T+PSVVY++YM++G +  L NP DMP+  KI  + EPWI+ TI TP++YLG
Sbjct: 360 REFNLDLIATAPSVVYKIYMNNGDVIDLHNPADMPDPVKIDHIEEPWIKATIFTPDDYLG 419

Query: 426 SILKLCQERRGIQIDMSHLDNRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDYR 485
           +++KLCQ+RRGIQ D+S++ +RAM VYELPLNEV+FDFYDRLKS+SKGYASFDY + +YR
Sbjct: 420 AVIKLCQDRRGIQTDLSYVGSRAMAVYELPLNEVVFDFYDRLKSISKGYASFDYTIEEYR 479

Query: 486 DSDLVKLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGGRI 545
           + DLVK++ILVN E +DALS+LVHR  +E+RGRG+CEK+K+LIPQ +F I IQAAIGGRI
Sbjct: 480 EGDLVKMSILVNAEPVDALSMLVHRDRAEQRGRGMCEKMKDLIPQHLFVIPIQAAIGGRI 539

Query: 546 IARETVKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISILKTDN 605
           IARETV+A RKDVTAKCYGGD TRK+KLLEKQKEGKK+MR+FG+V+IPQ AFI+ LK DN
Sbjct: 540 IARETVRALRKDVTAKCYGGDATRKKKLLEKQKEGKKKMRQFGKVEIPQEAFIAALKMDN 599

Query: 606 E 606
           +
Sbjct: 600 D 600


>gi|24211938|sp|Q9A9F4|LEPA_CAUCR RecName: Full=Elongation factor 4; Short=EF-4; AltName:
           Full=Ribosomal back-translocase LepA
          Length = 606

 Score =  867 bits (2241), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 414/601 (68%), Positives = 501/601 (83%), Gaps = 2/601 (0%)

Query: 6   TPLSRIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQT 65
           TPL +IRNFSIVAHIDHGKSTL+DR IQ   GLT REMS+QVLDNMDIE+ERGITIKAQT
Sbjct: 8   TPLDKIRNFSIVAHIDHGKSTLSDRLIQTTGGLTAREMSAQVLDNMDIEKERGITIKAQT 67

Query: 66  VRLNYTSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQ 125
           VRL Y + D + Y LNL+DTPGHVDF YEVSRSL+ACEGS+LVVDA+QGVEAQTLANVYQ
Sbjct: 68  VRLTYKAADGETYILNLMDTPGHVDFAYEVSRSLAACEGSILVVDASQGVEAQTLANVYQ 127

Query: 126 AIDNNHEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERIVQ 185
           AIDNNHEI+ VLNK DLP+AD DRVK QIE+ IG+   DA+  SAKTG GIP +LE IV 
Sbjct: 128 AIDNNHEIVPVLNKVDLPAADVDRVKAQIEDVIGLDASDAVECSAKTGVGIPEVLEAIVT 187

Query: 186 QLPSPTSPEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVER 245
           +LP P      NAPLKALL+D+WY++YLGV+VLVRI +G L  GQ +R+M T A +++++
Sbjct: 188 RLPPPKG--DPNAPLKALLVDAWYDAYLGVVVLVRIFDGSLKAGQQVRMMQTGATHRIDK 245

Query: 246 IGILTPKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVVF 305
           +G+ TPK  D+E L PGE+G   ASIKEV+   VGDTITD+  PT  AL GFK + PVVF
Sbjct: 246 VGVFTPKATDVEYLGPGEVGFFTASIKEVADAAVGDTITDEKKPTAEALKGFKEVVPVVF 305

Query: 306 CGLFPVDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERLE 365
           CGLFPVDA  FE+LR A+ KLRLNDASF++E+E+S ALGFGFRCGFLGLLHLEIIQERL 
Sbjct: 306 CGLFPVDAADFEDLRAAVGKLRLNDASFTYEMESSAALGFGFRCGFLGLLHLEIIQERLS 365

Query: 366 REFSLNLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEYLG 425
           REF L+LI T+PSVVY++ + +G   +L NP D+P+V +I E+ EPWI+ TI TP++YLG
Sbjct: 366 REFDLDLIATAPSVVYKIKLRNGDEIELHNPADLPDVMQIEEIAEPWIKATIFTPDDYLG 425

Query: 426 SILKLCQERRGIQIDMSHLDNRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDYR 485
            ++KLCQ+RRG+Q ++S++ +RAM+VY+LPLNEV+FDFYDRLKS+SKGYASFDY + DYR
Sbjct: 426 GVIKLCQDRRGMQRELSYVGSRAMVVYDLPLNEVVFDFYDRLKSISKGYASFDYQLEDYR 485

Query: 486 DSDLVKLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGGRI 545
             DLVK++ILVN+E +DALS+LVHRS +E RGRG+CEK+K LIPQ MF I IQAAIGGRI
Sbjct: 486 AGDLVKMSILVNSEPVDALSMLVHRSRAESRGRGMCEKMKELIPQHMFVIPIQAAIGGRI 545

Query: 546 IARETVKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISILKTDN 605
           IARETV+A RKDVTAKCYGGD +RK+KLLEKQKEGKKRMR+FG+V+IPQ AFI+ LK D 
Sbjct: 546 IARETVRALRKDVTAKCYGGDASRKKKLLEKQKEGKKRMRQFGKVEIPQEAFIAALKMDE 605

Query: 606 E 606
           +
Sbjct: 606 D 606


>gi|197106442|ref|YP_002131819.1| GTP-binding protein LepA [Phenylobacterium zucineum HLK1]
 gi|196479862|gb|ACG79390.1| GTP-binding protein LepA [Phenylobacterium zucineum HLK1]
          Length = 601

 Score =  867 bits (2240), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 410/601 (68%), Positives = 493/601 (82%), Gaps = 2/601 (0%)

Query: 6   TPLSRIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQT 65
           TPL +IRNFSIVAHIDHGKSTL+DR IQ    LT REMS QVLDNM+IERERGITIKAQT
Sbjct: 3   TPLDKIRNFSIVAHIDHGKSTLSDRLIQETGALTAREMSEQVLDNMEIERERGITIKAQT 62

Query: 66  VRLNYTSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQ 125
           VRL+Y + D + Y LNL+DTPGHVDF YEVSRSL+ACEGS+LVVDA+QGVEAQTLANVYQ
Sbjct: 63  VRLHYKADDGETYVLNLMDTPGHVDFAYEVSRSLAACEGSILVVDASQGVEAQTLANVYQ 122

Query: 126 AIDNNHEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERIVQ 185
           AIDNNHEI+ VLNK DLP+A+PDRV++QIE+ IG+   DA+  SAK+G GI  +LE IV 
Sbjct: 123 AIDNNHEIVPVLNKIDLPAAEPDRVRQQIEDVIGLDASDAVECSAKSGVGIHDVLEAIVT 182

Query: 186 QLPSPTSPEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVER 245
           +LP P      +APLKALL+D+WY+ YLGV+VLVR+ +G L  GQ +++M T A+YQ++R
Sbjct: 183 RLPPPKGDR--DAPLKALLVDAWYDQYLGVVVLVRVFDGTLKVGQKVKMMQTGAEYQIDR 240

Query: 246 IGILTPKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVVF 305
           +G+  PK  ++  L PGE+G + ASIKEV+H  VGDTITD   PT   LPGF+ +QPVVF
Sbjct: 241 LGVFRPKQTEMPELGPGEVGFITASIKEVAHAAVGDTITDLRKPTDKPLPGFREVQPVVF 300

Query: 306 CGLFPVDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERLE 365
           CGLFPVDA  FE+LR AI +LRLNDASF++E+E S ALGFGFRCGFLGLLHLEIIQERL 
Sbjct: 301 CGLFPVDAADFEDLRAAIGRLRLNDASFTYEMETSAALGFGFRCGFLGLLHLEIIQERLS 360

Query: 366 REFSLNLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEYLG 425
           REF L+LI T+PSVVY + + +G   +L NP D+P+  KI  + EPWI+ TI TP+EYLG
Sbjct: 361 REFDLDLIATAPSVVYRVKLTNGEEIELHNPADLPDPVKIDSIAEPWIKATIFTPDEYLG 420

Query: 426 SILKLCQERRGIQIDMSHLDNRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDYR 485
           +I+KLCQ+RRG Q ++S++  RAM+VY+LPLNEV+FDFYDRLKS+SKGYASFDY V  YR
Sbjct: 421 AIIKLCQDRRGEQRELSYVGARAMVVYDLPLNEVVFDFYDRLKSISKGYASFDYQVEGYR 480

Query: 486 DSDLVKLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGGRI 545
             DLVK++ILVN E +DALS+LVHR  +E RGRG+ EK+K LIP  MFQI IQAAIGGRI
Sbjct: 481 VGDLVKMSILVNAEPVDALSMLVHRDRAESRGRGMVEKMKELIPPHMFQIPIQAAIGGRI 540

Query: 546 IARETVKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISILKTDN 605
           IARETV+A RKDVTAKCYGGDITRKRKLLEKQKEGKKRMR+FG+V+IPQ AFI+ LK D 
Sbjct: 541 IARETVRALRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRQFGKVEIPQEAFIAALKMDA 600

Query: 606 E 606
           +
Sbjct: 601 D 601


>gi|119371386|sp|Q13E78|LEPA_RHOPS RecName: Full=Elongation factor 4; Short=EF-4; AltName:
           Full=Ribosomal back-translocase LepA
          Length = 603

 Score =  867 bits (2239), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 420/601 (69%), Positives = 502/601 (83%), Gaps = 4/601 (0%)

Query: 7   PLSRIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSS--QVLDNMDIERERGITIKAQ 64
           P+  IRNFSIVAHIDHGKSTLADR IQ   G+++REM+   QVLD+MDIERERGITIKAQ
Sbjct: 5   PIDNIRNFSIVAHIDHGKSTLADRLIQITGGMSDREMAGKEQVLDSMDIERERGITIKAQ 64

Query: 65  TVRLNYTSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVY 124
           TVRLNY + D KDY  NL+DTPGHVDF YEVSRSL+ACEGSLLVVDA+QGVEAQTLANVY
Sbjct: 65  TVRLNYRAKDGKDYIFNLMDTPGHVDFAYEVSRSLAACEGSLLVVDASQGVEAQTLANVY 124

Query: 125 QAIDNNHEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERIV 184
            A+D  HEI+ VLNK DLP+A+PD+VK+QIE+ IG+   DA+++SAKTG G+P +LE IV
Sbjct: 125 HALDAGHEIVPVLNKVDLPAAEPDKVKQQIEDVIGLDASDAVMISAKTGLGVPDVLEAIV 184

Query: 185 QQLPSPTSPEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVE 244
            +LP P    GA   LKALL+DSWY+ YLGV+VLVR+++G + KGQ IR+MGT A Y VE
Sbjct: 185 TRLPPPKGDRGAT--LKALLVDSWYDVYLGVVVLVRVVDGVMKKGQRIRMMGTGAAYDVE 242

Query: 245 RIGILTPKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVV 304
           R+G  TPKM  ++ L PGEIG + A+IKEV+ TRVGDTITDD  P T  LPGFKP  PVV
Sbjct: 243 RVGFFTPKMTAVDELGPGEIGFITAAIKEVADTRVGDTITDDRKPITEMLPGFKPAIPVV 302

Query: 305 FCGLFPVDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERL 364
           FCGLFPVDA  FE LR A+ KLRLNDASFSFE+E S ALGFGFRCGFLGLLHLEIIQERL
Sbjct: 303 FCGLFPVDADDFETLRAAMGKLRLNDASFSFEMETSAALGFGFRCGFLGLLHLEIIQERL 362

Query: 365 EREFSLNLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEYL 424
            REF LNLI T+PSV+Y++ ++DGS  ++ NP+DMP+V KIAE+ EPWI+ TI+TP+EYL
Sbjct: 363 SREFDLNLIATAPSVIYKMKLNDGSEIEIHNPVDMPDVVKIAEIEEPWIEATILTPDEYL 422

Query: 425 GSILKLCQERRGIQIDMSHLDNRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDY 484
           GS+LKLCQ+RRG Q +++++  RAM+ Y+LPLNEV+FDFYDRLKSVSKGYASFDY++ DY
Sbjct: 423 GSVLKLCQDRRGNQKELTYVGARAMVKYDLPLNEVVFDFYDRLKSVSKGYASFDYHLTDY 482

Query: 485 RDSDLVKLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGGR 544
           + +DLVK+ ILVN E +DALS+LVHR+ +E RGR + EK+K LIP  MF I IQAAIGG+
Sbjct: 483 KPADLVKMQILVNAEPVDALSMLVHRTRAEGRGRAMVEKMKELIPPHMFVIPIQAAIGGK 542

Query: 545 IIARETVKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISILKTD 604
           IIARETV+A RKDVTAKCYGGDITRKRKLLEKQKEGKK+MR+FG+VDIPQ AFI+ LK D
Sbjct: 543 IIARETVRALRKDVTAKCYGGDITRKRKLLEKQKEGKKKMRQFGKVDIPQEAFIAALKVD 602

Query: 605 N 605
           +
Sbjct: 603 S 603


>gi|154250679|ref|YP_001411503.1| GTP-binding protein LepA [Parvibaculum lavamentivorans DS-1]
 gi|154154629|gb|ABS61846.1| GTP-binding protein LepA [Parvibaculum lavamentivorans DS-1]
          Length = 612

 Score =  867 bits (2239), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 401/599 (66%), Positives = 500/599 (83%), Gaps = 2/599 (0%)

Query: 6   TPLSRIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQT 65
           T LS IRNFSI+AHIDHGKSTLADR IQ C GL+ REM  QVLD+MDIERERGITIKAQT
Sbjct: 14  TDLSHIRNFSIIAHIDHGKSTLADRLIQLCGGLSVREMKEQVLDSMDIERERGITIKAQT 73

Query: 66  VRLNYTSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQ 125
           VRL+Y + + + Y+LNLIDTPGHVDF YEV+RSL+ACEGSLLVVDA+QGVEAQTLANVY 
Sbjct: 74  VRLDYKAANGEMYELNLIDTPGHVDFAYEVNRSLAACEGSLLVVDASQGVEAQTLANVYH 133

Query: 126 AIDNNHEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERIVQ 185
           A+D NHEI+ VLNK DLP+A+P + ++QIE+ IG+   +A+ +SAK+G GIP +LE IV 
Sbjct: 134 ALDVNHEIVPVLNKIDLPAAEPAKTRQQIEDVIGLDASEAVEISAKSGIGIPDVLEAIVN 193

Query: 186 QLPSPTSPEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVER 245
           +LP P      +APLKA+L+DSWY++YLGV+VLVRII+G+L KGQ I++MGT   Y ++ 
Sbjct: 194 RLPPPKG--DLSAPLKAMLVDSWYDAYLGVVVLVRIIDGELKKGQRIKMMGTGGTYTIDN 251

Query: 246 IGILTPKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVVF 305
           +GI  PK   + +L PGEIG   ASIKEV+ TRVGDT+T++  P   ALPGFKP QPVVF
Sbjct: 252 VGIFRPKKETVASLTPGEIGFFTASIKEVADTRVGDTVTEEKRPCAQALPGFKPAQPVVF 311

Query: 306 CGLFPVDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERLE 365
           CGLFPVDA +FE+LR A+ +LRLNDASF FE+E S ALGFGFRCGFLGLLHLEI++ERLE
Sbjct: 312 CGLFPVDAAEFEDLRDAMGRLRLNDASFEFEMETSAALGFGFRCGFLGLLHLEIVRERLE 371

Query: 366 REFSLNLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEYLG 425
           REF+++LI T+PSV+Y+L+M+DGS+ ++ NP DMP+  KI  + EPWI+ TI+ P+EYLG
Sbjct: 372 REFNIDLITTAPSVIYQLHMNDGSIIEMHNPADMPDTMKIDHIEEPWIRATILVPDEYLG 431

Query: 426 SILKLCQERRGIQIDMSHLDNRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDYR 485
           ++LKLC++RRG Q+D+++  +RAM+VY LPLNEV+ DFYDRLKSVS+GYASFDY++  Y 
Sbjct: 432 AVLKLCEDRRGHQVDLTYAGSRAMLVYRLPLNEVVLDFYDRLKSVSRGYASFDYHIEGYE 491

Query: 486 DSDLVKLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGGRI 545
             DLVK+TILVN E +DALS +VHRS +E+RGR +CEKLK LIP+ +F+I IQAAIGGRI
Sbjct: 492 TGDLVKMTILVNEELVDALSTVVHRSRAEQRGRVMCEKLKELIPKHLFKIPIQAAIGGRI 551

Query: 546 IARETVKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISILKTD 604
           +ARET+ A RKDVTAKCYGGD++RKRKLL+KQKEGKK+MR+FGRV+IPQ AFIS LK D
Sbjct: 552 VARETISAMRKDVTAKCYGGDVSRKRKLLDKQKEGKKKMRQFGRVEIPQDAFISALKMD 610


>gi|221234023|ref|YP_002516459.1| GTP-binding protein LepA [Caulobacter crescentus NA1000]
 gi|254808385|sp|B8H2Z7|LEPA_CAUCN RecName: Full=Elongation factor 4; Short=EF-4; AltName:
           Full=Ribosomal back-translocase LepA
 gi|220963195|gb|ACL94551.1| GTP-binding protein lepA [Caulobacter crescentus NA1000]
          Length = 602

 Score =  867 bits (2239), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 414/601 (68%), Positives = 501/601 (83%), Gaps = 2/601 (0%)

Query: 6   TPLSRIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQT 65
           TPL +IRNFSIVAHIDHGKSTL+DR IQ   GLT REMS+QVLDNMDIE+ERGITIKAQT
Sbjct: 4   TPLDKIRNFSIVAHIDHGKSTLSDRLIQTTGGLTAREMSAQVLDNMDIEKERGITIKAQT 63

Query: 66  VRLNYTSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQ 125
           VRL Y + D + Y LNL+DTPGHVDF YEVSRSL+ACEGS+LVVDA+QGVEAQTLANVYQ
Sbjct: 64  VRLTYKAADGETYILNLMDTPGHVDFAYEVSRSLAACEGSILVVDASQGVEAQTLANVYQ 123

Query: 126 AIDNNHEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERIVQ 185
           AIDNNHEI+ VLNK DLP+AD DRVK QIE+ IG+   DA+  SAKTG GIP +LE IV 
Sbjct: 124 AIDNNHEIVPVLNKVDLPAADVDRVKAQIEDVIGLDASDAVECSAKTGVGIPEVLEAIVT 183

Query: 186 QLPSPTSPEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVER 245
           +LP P      NAPLKALL+D+WY++YLGV+VLVRI +G L  GQ +R+M T A +++++
Sbjct: 184 RLPPPKG--DPNAPLKALLVDAWYDAYLGVVVLVRIFDGSLKAGQQVRMMQTGATHRIDK 241

Query: 246 IGILTPKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVVF 305
           +G+ TPK  D+E L PGE+G   ASIKEV+   VGDTITD+  PT  AL GFK + PVVF
Sbjct: 242 VGVFTPKATDVEYLGPGEVGFFTASIKEVADAAVGDTITDEKKPTAEALKGFKEVVPVVF 301

Query: 306 CGLFPVDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERLE 365
           CGLFPVDA  FE+LR A+ KLRLNDASF++E+E+S ALGFGFRCGFLGLLHLEIIQERL 
Sbjct: 302 CGLFPVDAADFEDLRAAVGKLRLNDASFTYEMESSAALGFGFRCGFLGLLHLEIIQERLS 361

Query: 366 REFSLNLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEYLG 425
           REF L+LI T+PSVVY++ + +G   +L NP D+P+V +I E+ EPWI+ TI TP++YLG
Sbjct: 362 REFDLDLIATAPSVVYKIKLRNGDEIELHNPADLPDVMQIEEIAEPWIKATIFTPDDYLG 421

Query: 426 SILKLCQERRGIQIDMSHLDNRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDYR 485
            ++KLCQ+RRG+Q ++S++ +RAM+VY+LPLNEV+FDFYDRLKS+SKGYASFDY + DYR
Sbjct: 422 GVIKLCQDRRGMQRELSYVGSRAMVVYDLPLNEVVFDFYDRLKSISKGYASFDYQLEDYR 481

Query: 486 DSDLVKLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGGRI 545
             DLVK++ILVN+E +DALS+LVHRS +E RGRG+CEK+K LIPQ MF I IQAAIGGRI
Sbjct: 482 AGDLVKMSILVNSEPVDALSMLVHRSRAESRGRGMCEKMKELIPQHMFVIPIQAAIGGRI 541

Query: 546 IARETVKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISILKTDN 605
           IARETV+A RKDVTAKCYGGD +RK+KLLEKQKEGKKRMR+FG+V+IPQ AFI+ LK D 
Sbjct: 542 IARETVRALRKDVTAKCYGGDASRKKKLLEKQKEGKKRMRQFGKVEIPQEAFIAALKMDE 601

Query: 606 E 606
           +
Sbjct: 602 D 602


>gi|16125286|ref|NP_419850.1| GTP-binding protein LepA [Caulobacter crescentus CB15]
 gi|13422328|gb|AAK23018.1| GTP-binding protein LepA [Caulobacter crescentus CB15]
          Length = 648

 Score =  866 bits (2238), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 414/601 (68%), Positives = 501/601 (83%), Gaps = 2/601 (0%)

Query: 6   TPLSRIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQT 65
           TPL +IRNFSIVAHIDHGKSTL+DR IQ   GLT REMS+QVLDNMDIE+ERGITIKAQT
Sbjct: 50  TPLDKIRNFSIVAHIDHGKSTLSDRLIQTTGGLTAREMSAQVLDNMDIEKERGITIKAQT 109

Query: 66  VRLNYTSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQ 125
           VRL Y + D + Y LNL+DTPGHVDF YEVSRSL+ACEGS+LVVDA+QGVEAQTLANVYQ
Sbjct: 110 VRLTYKAADGETYILNLMDTPGHVDFAYEVSRSLAACEGSILVVDASQGVEAQTLANVYQ 169

Query: 126 AIDNNHEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERIVQ 185
           AIDNNHEI+ VLNK DLP+AD DRVK QIE+ IG+   DA+  SAKTG GIP +LE IV 
Sbjct: 170 AIDNNHEIVPVLNKVDLPAADVDRVKAQIEDVIGLDASDAVECSAKTGVGIPEVLEAIVT 229

Query: 186 QLPSPTSPEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVER 245
           +LP P      NAPLKALL+D+WY++YLGV+VLVRI +G L  GQ +R+M T A +++++
Sbjct: 230 RLPPPKG--DPNAPLKALLVDAWYDAYLGVVVLVRIFDGSLKAGQQVRMMQTGATHRIDK 287

Query: 246 IGILTPKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVVF 305
           +G+ TPK  D+E L PGE+G   ASIKEV+   VGDTITD+  PT  AL GFK + PVVF
Sbjct: 288 VGVFTPKATDVEYLGPGEVGFFTASIKEVADAAVGDTITDEKKPTAEALKGFKEVVPVVF 347

Query: 306 CGLFPVDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERLE 365
           CGLFPVDA  FE+LR A+ KLRLNDASF++E+E+S ALGFGFRCGFLGLLHLEIIQERL 
Sbjct: 348 CGLFPVDAADFEDLRAAVGKLRLNDASFTYEMESSAALGFGFRCGFLGLLHLEIIQERLS 407

Query: 366 REFSLNLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEYLG 425
           REF L+LI T+PSVVY++ + +G   +L NP D+P+V +I E+ EPWI+ TI TP++YLG
Sbjct: 408 REFDLDLIATAPSVVYKIKLRNGDEIELHNPADLPDVMQIEEIAEPWIKATIFTPDDYLG 467

Query: 426 SILKLCQERRGIQIDMSHLDNRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDYR 485
            ++KLCQ+RRG+Q ++S++ +RAM+VY+LPLNEV+FDFYDRLKS+SKGYASFDY + DYR
Sbjct: 468 GVIKLCQDRRGMQRELSYVGSRAMVVYDLPLNEVVFDFYDRLKSISKGYASFDYQLEDYR 527

Query: 486 DSDLVKLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGGRI 545
             DLVK++ILVN+E +DALS+LVHRS +E RGRG+CEK+K LIPQ MF I IQAAIGGRI
Sbjct: 528 AGDLVKMSILVNSEPVDALSMLVHRSRAESRGRGMCEKMKELIPQHMFVIPIQAAIGGRI 587

Query: 546 IARETVKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISILKTDN 605
           IARETV+A RKDVTAKCYGGD +RK+KLLEKQKEGKKRMR+FG+V+IPQ AFI+ LK D 
Sbjct: 588 IARETVRALRKDVTAKCYGGDASRKKKLLEKQKEGKKRMRQFGKVEIPQEAFIAALKMDE 647

Query: 606 E 606
           +
Sbjct: 648 D 648


>gi|316931667|ref|YP_004106649.1| GTP-binding protein LepA [Rhodopseudomonas palustris DX-1]
 gi|315599381|gb|ADU41916.1| GTP-binding protein LepA [Rhodopseudomonas palustris DX-1]
          Length = 603

 Score =  866 bits (2237), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 417/601 (69%), Positives = 503/601 (83%), Gaps = 4/601 (0%)

Query: 7   PLSRIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSS--QVLDNMDIERERGITIKAQ 64
           P+  IRNFSIVAHIDHGKSTLADR IQ   G+++REM+   QVLD+MDIERERGITIKAQ
Sbjct: 5   PIDNIRNFSIVAHIDHGKSTLADRLIQITGGMSDREMAGKEQVLDSMDIERERGITIKAQ 64

Query: 65  TVRLNYTSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVY 124
           TVRLNY + D KDY  NL+DTPGHVDF YEVSRSL+ACEGSLLVVDA+QGVEAQTLANVY
Sbjct: 65  TVRLNYRANDGKDYIFNLMDTPGHVDFAYEVSRSLAACEGSLLVVDASQGVEAQTLANVY 124

Query: 125 QAIDNNHEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERIV 184
            A+D NHEI+ VLNK DLP+A+P+++K+QIE+ IG+   DA+++SAKTG G+P +LE IV
Sbjct: 125 HALDANHEIVPVLNKVDLPAAEPEKIKQQIEDVIGLDASDAVMISAKTGLGVPDVLEAIV 184

Query: 185 QQLPSPTSPEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVE 244
            +LP P       A LKALL+DSWY+ YLGV+VLVR+++G L KGQ IR+MGT A Y VE
Sbjct: 185 TRLPPPKGDR--EATLKALLVDSWYDVYLGVVVLVRVVDGVLKKGQRIRMMGTGAAYDVE 242

Query: 245 RIGILTPKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVV 304
           R+G  TPKM++++ L PGE+G + A+IKEV+ TRVGDTITDD  P T  LPGFKP  PVV
Sbjct: 243 RVGFFTPKMVNVDELGPGEVGFITAAIKEVADTRVGDTITDDKKPITEMLPGFKPAIPVV 302

Query: 305 FCGLFPVDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERL 364
           FCGLFPVDA  FE LR A+ KLRLNDASFSFE+E S ALGFGFRCGFLGLLHLEIIQERL
Sbjct: 303 FCGLFPVDADDFETLRGAMGKLRLNDASFSFEMETSAALGFGFRCGFLGLLHLEIIQERL 362

Query: 365 EREFSLNLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEYL 424
            REF LNLI T+PSV+Y + + DG+  ++ NP+DMP+V KIAE++EPWI+ TI+TP+EYL
Sbjct: 363 SREFDLNLIATAPSVIYHMKLTDGTEMEIHNPVDMPDVVKIAEIQEPWIEATILTPDEYL 422

Query: 425 GSILKLCQERRGIQIDMSHLDNRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDY 484
           GS+LKLCQ+RRG Q +++++  RAM+ Y+LPLNEV+FDFYDRLKSVSKGYASFDY++ DY
Sbjct: 423 GSVLKLCQDRRGNQKELTYVGARAMVKYDLPLNEVVFDFYDRLKSVSKGYASFDYHLTDY 482

Query: 485 RDSDLVKLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGGR 544
           + +DLVK+ ILVN E +DALS+LVHR+ +E RGR + EK+K LIP  MFQI IQAAIGG+
Sbjct: 483 KPADLVKMQILVNAEPVDALSMLVHRTRAEGRGRAMVEKMKELIPPHMFQIPIQAAIGGK 542

Query: 545 IIARETVKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISILKTD 604
           +IARETV+A RKDVTAKCYGGDITRKRKLLEKQKEGKK+MR+FG+VDIPQ AFI+ LK D
Sbjct: 543 VIARETVRALRKDVTAKCYGGDITRKRKLLEKQKEGKKKMRQFGKVDIPQEAFIAALKVD 602

Query: 605 N 605
            
Sbjct: 603 G 603


>gi|91974853|ref|YP_567512.1| GTP-binding protein LepA [Rhodopseudomonas palustris BisB5]
 gi|91681309|gb|ABE37611.1| GTP-binding protein LepA [Rhodopseudomonas palustris BisB5]
          Length = 644

 Score =  865 bits (2236), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 420/601 (69%), Positives = 502/601 (83%), Gaps = 4/601 (0%)

Query: 7   PLSRIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSS--QVLDNMDIERERGITIKAQ 64
           P+  IRNFSIVAHIDHGKSTLADR IQ   G+++REM+   QVLD+MDIERERGITIKAQ
Sbjct: 46  PIDNIRNFSIVAHIDHGKSTLADRLIQITGGMSDREMAGKEQVLDSMDIERERGITIKAQ 105

Query: 65  TVRLNYTSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVY 124
           TVRLNY + D KDY  NL+DTPGHVDF YEVSRSL+ACEGSLLVVDA+QGVEAQTLANVY
Sbjct: 106 TVRLNYRAKDGKDYIFNLMDTPGHVDFAYEVSRSLAACEGSLLVVDASQGVEAQTLANVY 165

Query: 125 QAIDNNHEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERIV 184
            A+D  HEI+ VLNK DLP+A+PD+VK+QIE+ IG+   DA+++SAKTG G+P +LE IV
Sbjct: 166 HALDAGHEIVPVLNKVDLPAAEPDKVKQQIEDVIGLDASDAVMISAKTGLGVPDVLEAIV 225

Query: 185 QQLPSPTSPEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVE 244
            +LP P    GA   LKALL+DSWY+ YLGV+VLVR+++G + KGQ IR+MGT A Y VE
Sbjct: 226 TRLPPPKGDRGAT--LKALLVDSWYDVYLGVVVLVRVVDGVMKKGQRIRMMGTGAAYDVE 283

Query: 245 RIGILTPKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVV 304
           R+G  TPKM  ++ L PGEIG + A+IKEV+ TRVGDTITDD  P T  LPGFKP  PVV
Sbjct: 284 RVGFFTPKMTAVDELGPGEIGFITAAIKEVADTRVGDTITDDRKPITEMLPGFKPAIPVV 343

Query: 305 FCGLFPVDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERL 364
           FCGLFPVDA  FE LR A+ KLRLNDASFSFE+E S ALGFGFRCGFLGLLHLEIIQERL
Sbjct: 344 FCGLFPVDADDFETLRAAMGKLRLNDASFSFEMETSAALGFGFRCGFLGLLHLEIIQERL 403

Query: 365 EREFSLNLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEYL 424
            REF LNLI T+PSV+Y++ ++DGS  ++ NP+DMP+V KIAE+ EPWI+ TI+TP+EYL
Sbjct: 404 SREFDLNLIATAPSVIYKMKLNDGSEIEIHNPVDMPDVVKIAEIEEPWIEATILTPDEYL 463

Query: 425 GSILKLCQERRGIQIDMSHLDNRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDY 484
           GS+LKLCQ+RRG Q +++++  RAM+ Y+LPLNEV+FDFYDRLKSVSKGYASFDY++ DY
Sbjct: 464 GSVLKLCQDRRGNQKELTYVGARAMVKYDLPLNEVVFDFYDRLKSVSKGYASFDYHLTDY 523

Query: 485 RDSDLVKLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGGR 544
           + +DLVK+ ILVN E +DALS+LVHR+ +E RGR + EK+K LIP  MF I IQAAIGG+
Sbjct: 524 KPADLVKMQILVNAEPVDALSMLVHRTRAEGRGRAMVEKMKELIPPHMFVIPIQAAIGGK 583

Query: 545 IIARETVKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISILKTD 604
           IIARETV+A RKDVTAKCYGGDITRKRKLLEKQKEGKK+MR+FG+VDIPQ AFI+ LK D
Sbjct: 584 IIARETVRALRKDVTAKCYGGDITRKRKLLEKQKEGKKKMRQFGKVDIPQEAFIAALKVD 643

Query: 605 N 605
           +
Sbjct: 644 S 644


>gi|329850388|ref|ZP_08265233.1| GTP-binding protein LepA [Asticcacaulis biprosthecum C19]
 gi|328840703|gb|EGF90274.1| GTP-binding protein LepA [Asticcacaulis biprosthecum C19]
          Length = 600

 Score =  865 bits (2235), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 417/601 (69%), Positives = 497/601 (82%), Gaps = 2/601 (0%)

Query: 6   TPLSRIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQT 65
           T LS IRNFSIVAHIDHGKSTL+DR IQ+  GLT REM  QVLDNMDIERERGITIKAQT
Sbjct: 2   TDLSLIRNFSIVAHIDHGKSTLSDRLIQYTGGLTAREMKEQVLDNMDIERERGITIKAQT 61

Query: 66  VRLNYTSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQ 125
           VRLNY + D K Y LNL+DTPGHVDF YEVSRSL+ACEGS+LVVDA+QGVEAQTLANVYQ
Sbjct: 62  VRLNYKAHDGKTYILNLMDTPGHVDFAYEVSRSLAACEGSILVVDASQGVEAQTLANVYQ 121

Query: 126 AIDNNHEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERIVQ 185
           AIDNNHEI+ VLNK DLP+A+P+RV+ QIE+ IGI   +A+L SAK+G GI  +LE IV+
Sbjct: 122 AIDNNHEIVPVLNKIDLPAAEPERVRAQIEDVIGIDASEAVLASAKSGLGIEDVLEAIVK 181

Query: 186 QLPSPTSPEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVER 245
           +LP P     A APLKALL+D+WY++YLGV+VLVRI +G +  GQ ++LM   A Y++++
Sbjct: 182 RLPPPKG--DATAPLKALLVDAWYDAYLGVVVLVRIFDGVMKPGQQVKLMNAGATYKIDK 239

Query: 246 IGILTPKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVVF 305
           +G+  PK  D  +L PGEIG   A IKEVS   VGDTITD+  PT  AL GFK +QPVVF
Sbjct: 240 LGVFFPKATDAASLGPGEIGFFTAQIKEVSDAAVGDTITDERKPTEKALTGFKEVQPVVF 299

Query: 306 CGLFPVDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERLE 365
           CG+FPVDA  FE+LR A+ +LRLNDASFSFE+E S ALGFGFRCGFLGLLHLEIIQERL 
Sbjct: 300 CGIFPVDAADFEDLRAAMGRLRLNDASFSFEMETSAALGFGFRCGFLGLLHLEIIQERLS 359

Query: 366 REFSLNLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEYLG 425
           REF+L+LI T+PSVVY+++M+ G +  L NP DMP+   I  + EPWI+ TI  P++YLG
Sbjct: 360 REFNLDLIATAPSVVYKIHMNKGDVIDLHNPADMPDPVHIEHIEEPWIKATIFCPDDYLG 419

Query: 426 SILKLCQERRGIQIDMSHLDNRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDYR 485
           +I+KLCQ+RRGIQ+D+S++  RAM+VY LPLNEV+FDFYDRLKSVSKGYASFDY + DYR
Sbjct: 420 AIIKLCQDRRGIQVDLSYVGTRAMVVYNLPLNEVVFDFYDRLKSVSKGYASFDYTIEDYR 479

Query: 486 DSDLVKLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGGRI 545
           + DLVK++ILVN E +DALS+LVHR  +E RGRG+CEK+K+LIPQ MF I IQAAIGGRI
Sbjct: 480 EGDLVKMSILVNAEPVDALSMLVHRDRAEMRGRGMCEKMKDLIPQHMFVIPIQAAIGGRI 539

Query: 546 IARETVKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISILKTDN 605
           IARETV+A RKDVTAKCYGGD TRK+KLLEKQKEGKKRMR+FG+VDIPQ AFI+ LK DN
Sbjct: 540 IARETVRALRKDVTAKCYGGDATRKKKLLEKQKEGKKRMRQFGKVDIPQEAFIAALKMDN 599

Query: 606 E 606
           +
Sbjct: 600 D 600


>gi|114800355|ref|YP_758873.1| GTP-binding protein LepA [Hyphomonas neptunium ATCC 15444]
 gi|119371358|sp|Q0C5X0|LEPA_HYPNA RecName: Full=Elongation factor 4; Short=EF-4; AltName:
           Full=Ribosomal back-translocase LepA
 gi|114740529|gb|ABI78654.1| GTP-binding protein LepA [Hyphomonas neptunium ATCC 15444]
          Length = 604

 Score =  864 bits (2233), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 404/601 (67%), Positives = 495/601 (82%), Gaps = 1/601 (0%)

Query: 6   TPLSRIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQT 65
           TP  +IRNFSI+AHIDHGKSTLADR IQ C GLT+REMS QVLD+MDIE+ERGITIKAQT
Sbjct: 5   TPRDKIRNFSIIAHIDHGKSTLADRLIQACGGLTDREMSEQVLDSMDIEKERGITIKAQT 64

Query: 66  VRLNYTSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQ 125
           VRL+YT++D + Y LNL+DTPGHVDF YEVSR L+ACEGSLLVVDA+QGVEAQTLANVYQ
Sbjct: 65  VRLSYTASDGETYTLNLMDTPGHVDFAYEVSRCLAACEGSLLVVDASQGVEAQTLANVYQ 124

Query: 126 AIDNNHEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERIVQ 185
           AID NHEI+ VLNK DLP+AD DRVK+QIEE IG+   DA+ +SAKTG GIP +LE IV 
Sbjct: 125 AIDQNHEIVPVLNKIDLPAADVDRVKEQIEEIIGLDASDAVQISAKTGLGIPDVLEAIVN 184

Query: 186 QLPSPTSPEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVER 245
           +LP P   +   APLKA L+D++Y+ YLGV+V+VR+  G L K Q+IR+M T   Y++++
Sbjct: 185 RLPPPRGGD-HTAPLKAALVDAYYDPYLGVVVIVRVHEGILKKKQTIRMMRTGGVYEIDK 243

Query: 246 IGILTPKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVVF 305
           +G   PK+ + +AL PGE+G  +ASIKEV    +GDTIT+D  PT  ALPG+K +QPVVF
Sbjct: 244 VGTFNPKLTEADALGPGEVGYFVASIKEVGDCSIGDTITEDKRPTDKALPGYKDVQPVVF 303

Query: 306 CGLFPVDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERLE 365
           CGLFP+DA  F++LR A+ KLRLNDASF++E+E S ALG GFRCGFLGLLHLEIIQERL 
Sbjct: 304 CGLFPMDAGDFDDLRAAMGKLRLNDASFTWEMETSAALGMGFRCGFLGLLHLEIIQERLS 363

Query: 366 REFSLNLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEYLG 425
           REF L+LI T+PSVVYE+ M DG+  +L NP DMP+V +I E+REPWI  TI TP+EYLG
Sbjct: 364 REFDLDLIATAPSVVYEMSMTDGTEIELHNPADMPDVVRITEIREPWIAATIYTPDEYLG 423

Query: 426 SILKLCQERRGIQIDMSHLDNRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDYR 485
           SILKLCQ+RRGIQI++S++  RA + YELPLNEV+FDFYDRLKS+S+GYASFDY +I +R
Sbjct: 424 SILKLCQDRRGIQIELSYVGGRACVKYELPLNEVVFDFYDRLKSISRGYASFDYTLIGHR 483

Query: 486 DSDLVKLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGGRI 545
             +LVKL ILVN E +DAL++LVHR  +E RGR +CE+LK LIP+QMF+I IQAAIGGR+
Sbjct: 484 AENLVKLQILVNEEPVDALAMLVHRDRAESRGRQMCERLKELIPRQMFKIPIQAAIGGRV 543

Query: 546 IARETVKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISILKTDN 605
           +ARET+ A RKDVTAKCYGGD TRKRKLL+KQ  GKKRMR+FG+V+IPQ AF++ L+ D 
Sbjct: 544 VARETISAMRKDVTAKCYGGDATRKRKLLDKQAAGKKRMRQFGKVEIPQEAFVAALRMDG 603

Query: 606 E 606
           +
Sbjct: 604 D 604


>gi|83312961|ref|YP_423225.1| GTP-binding protein LepA [Magnetospirillum magneticum AMB-1]
 gi|119371363|sp|Q2W0F9|LEPA_MAGSA RecName: Full=Elongation factor 4; Short=EF-4; AltName:
           Full=Ribosomal back-translocase LepA
 gi|82947802|dbj|BAE52666.1| Membrane GTPase LepA [Magnetospirillum magneticum AMB-1]
          Length = 600

 Score =  864 bits (2232), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 406/598 (67%), Positives = 491/598 (82%), Gaps = 4/598 (0%)

Query: 6   TPLSRIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQT 65
           T LS IRNFSIVAHIDHGKSTLADR IQ C  +  REM  Q+LD+MDIERERGITIKAQT
Sbjct: 2   TKLSHIRNFSIVAHIDHGKSTLADRLIQACGAIEAREMKEQMLDSMDIERERGITIKAQT 61

Query: 66  VRLNYTSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQ 125
           VRL+Y + D K YQLNL+DTPGHVDF YEVSRSL+ACEGSLLVVDA+QGVEAQTLANVY 
Sbjct: 62  VRLDYKAKDGKTYQLNLMDTPGHVDFAYEVSRSLAACEGSLLVVDASQGVEAQTLANVYH 121

Query: 126 AIDNNHEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERIVQ 185
           A+D  HE++ VLNK DLP+A+P+RVK+QIE+ IG+ T DA+++SAKTG GI  +LE +V 
Sbjct: 122 ALDAGHEVVPVLNKIDLPAAEPERVKQQIEDVIGLDTSDAVMISAKTGIGIGDVLEALVN 181

Query: 186 QLPSPTSPEG-ANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVE 244
           +LP P   EG A+APL+ALL+DSWY+ YLGV++LVRI NG L KGQ IR+M T A YQV+
Sbjct: 182 RLPCP---EGDADAPLQALLVDSWYDPYLGVIILVRIKNGVLKKGQKIRMMATQAAYQVD 238

Query: 245 RIGILTPKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVV 304
             G  TPK++    L PGE+G   A+IK V+ T+VGDT+TDD  P  + LPGFKP  PVV
Sbjct: 239 SCGYFTPKLVQTTELRPGEMGFFTAAIKAVADTKVGDTVTDDKKPADTPLPGFKPSVPVV 298

Query: 305 FCGLFPVDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERL 364
           +CGLFP+DA  +E+LR ++ KLRLNDASF +E E S ALGFGFRCGFLGLLHLEIIQERL
Sbjct: 299 WCGLFPIDAADYEDLRDSLAKLRLNDASFQYEPETSAALGFGFRCGFLGLLHLEIIQERL 358

Query: 365 EREFSLNLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEYL 424
           EREF+L+LI T+PSVVY ++  +G M++L NP DMP+  +I  + EPWI+ TI+ P+EYL
Sbjct: 359 EREFNLDLITTAPSVVYRVHKTNGEMEELHNPADMPDPARIDHMEEPWIKATIMVPDEYL 418

Query: 425 GSILKLCQERRGIQIDMSHLDNRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDY 484
           G +L LC ERRG QID+++  +RAM VY+LPLNEV+FDFYDRLKS+S+GYASFDY V  Y
Sbjct: 419 GPVLTLCTERRGQQIDLTYAGSRAMAVYKLPLNEVVFDFYDRLKSISRGYASFDYEVDSY 478

Query: 485 RDSDLVKLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGGR 544
             SDLVK++ILVN E +DALS +VHR+ +E RGRGIC +LK LIP+QMFQIAIQAAIGGR
Sbjct: 479 AQSDLVKVSILVNAEPVDALSFVVHRANAESRGRGICTRLKELIPRQMFQIAIQAAIGGR 538

Query: 545 IIARETVKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISILK 602
           I+ARE++ A RKDVTAKCYGGD TRKRKLLEKQKEGKKRMR+FG+V+IPQSAF++ LK
Sbjct: 539 IVARESISALRKDVTAKCYGGDATRKRKLLEKQKEGKKRMRQFGKVEIPQSAFLAALK 596


>gi|329888556|ref|ZP_08267154.1| GTP-binding protein LepA [Brevundimonas diminuta ATCC 11568]
 gi|328847112|gb|EGF96674.1| GTP-binding protein LepA [Brevundimonas diminuta ATCC 11568]
          Length = 602

 Score =  863 bits (2230), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 401/600 (66%), Positives = 495/600 (82%), Gaps = 2/600 (0%)

Query: 7   PLSRIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTV 66
           P+ RIRNFS+VAHIDHGKSTL+DR IQ   GLT REMS QVLDNMDIE+ERGITIKAQTV
Sbjct: 5   PIERIRNFSVVAHIDHGKSTLSDRLIQFTGGLTAREMSEQVLDNMDIEKERGITIKAQTV 64

Query: 67  RLNYTSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQA 126
           RLNY + D + Y LNL+DTPGHVDF YEVSRSL+ACEGS+LVVDA+QGVEAQTLANVYQA
Sbjct: 65  RLNYKAKDGETYVLNLMDTPGHVDFAYEVSRSLAACEGSILVVDASQGVEAQTLANVYQA 124

Query: 127 IDNNHEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERIVQQ 186
           IDNNHEI+ VLNK DLP+A+PDRV+ QIE+ IGI   +A++ SAK+G GI  +LE IV +
Sbjct: 125 IDNNHEIVPVLNKIDLPAAEPDRVRAQIEDVIGIDASEAVMCSAKSGIGIEDVLEAIVAR 184

Query: 187 LPSPTSPEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVERI 246
           LP+P      NAPLKA+L+D+WY+ YLGV++LVR+ +G L  G  +++M T + + V+R+
Sbjct: 185 LPAPKG--DINAPLKAMLVDAWYDPYLGVVLLVRVFDGVLKAGMRVKMMQTGSSHLVDRV 242

Query: 247 GILTPKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVVFC 306
           G+  PK   +E L PGE+G + A IKEV+H  VGDTITD+  PT  AL GFK +Q VVFC
Sbjct: 243 GVFLPKNTPVEQLGPGEVGFITAQIKEVAHAAVGDTITDEKKPTAEALKGFKDVQSVVFC 302

Query: 307 GLFPVDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERLER 366
           GLFPVDA  FE+LR AI KLRLNDASF++E+E+S ALGFGFRCGFLGLLHLEIIQERL R
Sbjct: 303 GLFPVDAADFEDLRAAIGKLRLNDASFTYEMESSAALGFGFRCGFLGLLHLEIIQERLSR 362

Query: 367 EFSLNLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEYLGS 426
           EF+L+LI T+PSVVY++ + DG+   L NP D+P+V +I  + EPWI+ TI+TP+EYLG 
Sbjct: 363 EFNLDLIATAPSVVYKIGLRDGTEIDLHNPADLPDVMQIETISEPWIKATILTPDEYLGG 422

Query: 427 ILKLCQERRGIQIDMSHLDNRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDYRD 486
           ++KLCQ+RRG QI++S++ +RA++VYELPLNEV+FDFYDRLKS+SKGYASFDY + DY+ 
Sbjct: 423 VIKLCQDRRGSQIELSYVGSRALVVYELPLNEVVFDFYDRLKSISKGYASFDYEITDYKV 482

Query: 487 SDLVKLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGGRII 546
            DLVK++ILVN E +DALS+LVHR+ +E RGRG+ EK+K LIP  MF I IQAAIGG+II
Sbjct: 483 GDLVKMSILVNAEPVDALSMLVHRARAETRGRGMVEKMKELIPPHMFTIPIQAAIGGKII 542

Query: 547 ARETVKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISILKTDNE 606
           ARETV+A RKDVT+KCYGGD TRK+KLLEKQK GKKRMR+FG+V+IPQ AFI+ LK D +
Sbjct: 543 ARETVRALRKDVTSKCYGGDATRKKKLLEKQKAGKKRMRQFGKVEIPQEAFIAALKMDED 602


>gi|86747595|ref|YP_484091.1| GTP-binding protein LepA [Rhodopseudomonas palustris HaA2]
 gi|86570623|gb|ABD05180.1| GTP-binding protein LepA [Rhodopseudomonas palustris HaA2]
          Length = 644

 Score =  863 bits (2229), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 417/602 (69%), Positives = 502/602 (83%), Gaps = 4/602 (0%)

Query: 6   TPLSRIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSS--QVLDNMDIERERGITIKA 63
            P+  IRNFSIVAHIDHGKSTLADR IQ   G+++REM+   QVLD+MDIERERGITIKA
Sbjct: 45  APIDNIRNFSIVAHIDHGKSTLADRLIQITGGMSDREMAGKEQVLDSMDIERERGITIKA 104

Query: 64  QTVRLNYTSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANV 123
           QTVRLNY + D KDY  NL+DTPGHVDF YEVSRSL+ACEGSLLVVDA+QGVEAQTLANV
Sbjct: 105 QTVRLNYRAKDGKDYIFNLMDTPGHVDFAYEVSRSLAACEGSLLVVDASQGVEAQTLANV 164

Query: 124 YQAIDNNHEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERI 183
           Y A+D  HEI+ VLNK DLP+A+PD+VK+QIE+ IG+   DA+++SAKTG G+P +LE I
Sbjct: 165 YHALDAGHEIVPVLNKVDLPAAEPDKVKQQIEDVIGLDASDAVMISAKTGLGVPDVLEAI 224

Query: 184 VQQLPSPTSPEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQV 243
           V +LP P     A   LKALL+DSWY+ YLGV+VLVR+++G + KGQ IR+MGTNA Y +
Sbjct: 225 VTRLPPPQGDRSAQ--LKALLVDSWYDVYLGVVVLVRVVDGVMKKGQRIRMMGTNAAYDL 282

Query: 244 ERIGILTPKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPV 303
           ER+G  TPKM  ++ L PGEIG + A+IKEV+ TRVGDTITDD  P T  LPGFKP  PV
Sbjct: 283 ERVGYFTPKMTSVDELGPGEIGFITAAIKEVADTRVGDTITDDRKPITEMLPGFKPAIPV 342

Query: 304 VFCGLFPVDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQER 363
           VFCGLFPVDA  FE LR A+ KLRLNDASFSFE+E S ALGFGFRCGFLGLLHLEIIQER
Sbjct: 343 VFCGLFPVDADDFETLRGAMGKLRLNDASFSFEMETSAALGFGFRCGFLGLLHLEIIQER 402

Query: 364 LEREFSLNLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEY 423
           L REF LNLI T+PSV+Y++ + DG+  ++ NP+DMP+V KIAE++EPWI+ TI+TP+EY
Sbjct: 403 LSREFDLNLIATAPSVIYKMTLTDGTEMEIHNPVDMPDVVKIAEIQEPWIEATILTPDEY 462

Query: 424 LGSILKLCQERRGIQIDMSHLDNRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVID 483
           LGS+LKLCQ+RRG Q +++++  RAM+ Y+LPLNEV+FDFYDRLKSVSKGYASFDY++ +
Sbjct: 463 LGSVLKLCQDRRGNQKELTYVGARAMVKYDLPLNEVVFDFYDRLKSVSKGYASFDYHLTE 522

Query: 484 YRDSDLVKLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGG 543
           Y+ +DLVK+ ILVN E +DALS+LVHR+ +E RGR + EK+K LIP  MF I IQAAIGG
Sbjct: 523 YKPADLVKMQILVNAEPVDALSMLVHRTRAEGRGRAMVEKMKELIPPHMFVIPIQAAIGG 582

Query: 544 RIIARETVKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISILKT 603
           +IIARETV+A RKDVTAKCYGGDITRKRKLLEKQKEGKK+MR+FG+VDIPQ AFI+ LK 
Sbjct: 583 KIIARETVRALRKDVTAKCYGGDITRKRKLLEKQKEGKKKMRQFGKVDIPQEAFIAALKV 642

Query: 604 DN 605
           D+
Sbjct: 643 DS 644


>gi|119371384|sp|Q2J2Y0|LEPA_RHOP2 RecName: Full=Elongation factor 4; Short=EF-4; AltName:
           Full=Ribosomal back-translocase LepA
          Length = 603

 Score =  862 bits (2228), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 417/602 (69%), Positives = 502/602 (83%), Gaps = 4/602 (0%)

Query: 6   TPLSRIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSS--QVLDNMDIERERGITIKA 63
            P+  IRNFSIVAHIDHGKSTLADR IQ   G+++REM+   QVLD+MDIERERGITIKA
Sbjct: 4   APIDNIRNFSIVAHIDHGKSTLADRLIQITGGMSDREMAGKEQVLDSMDIERERGITIKA 63

Query: 64  QTVRLNYTSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANV 123
           QTVRLNY + D KDY  NL+DTPGHVDF YEVSRSL+ACEGSLLVVDA+QGVEAQTLANV
Sbjct: 64  QTVRLNYRAKDGKDYIFNLMDTPGHVDFAYEVSRSLAACEGSLLVVDASQGVEAQTLANV 123

Query: 124 YQAIDNNHEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERI 183
           Y A+D  HEI+ VLNK DLP+A+PD+VK+QIE+ IG+   DA+++SAKTG G+P +LE I
Sbjct: 124 YHALDAGHEIVPVLNKVDLPAAEPDKVKQQIEDVIGLDASDAVMISAKTGLGVPDVLEAI 183

Query: 184 VQQLPSPTSPEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQV 243
           V +LP P     A   LKALL+DSWY+ YLGV+VLVR+++G + KGQ IR+MGTNA Y +
Sbjct: 184 VTRLPPPQGDRSAQ--LKALLVDSWYDVYLGVVVLVRVVDGVMKKGQRIRMMGTNAAYDL 241

Query: 244 ERIGILTPKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPV 303
           ER+G  TPKM  ++ L PGEIG + A+IKEV+ TRVGDTITDD  P T  LPGFKP  PV
Sbjct: 242 ERVGYFTPKMTSVDELGPGEIGFITAAIKEVADTRVGDTITDDRKPITEMLPGFKPAIPV 301

Query: 304 VFCGLFPVDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQER 363
           VFCGLFPVDA  FE LR A+ KLRLNDASFSFE+E S ALGFGFRCGFLGLLHLEIIQER
Sbjct: 302 VFCGLFPVDADDFETLRGAMGKLRLNDASFSFEMETSAALGFGFRCGFLGLLHLEIIQER 361

Query: 364 LEREFSLNLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEY 423
           L REF LNLI T+PSV+Y++ + DG+  ++ NP+DMP+V KIAE++EPWI+ TI+TP+EY
Sbjct: 362 LSREFDLNLIATAPSVIYKMTLTDGTEMEIHNPVDMPDVVKIAEIQEPWIEATILTPDEY 421

Query: 424 LGSILKLCQERRGIQIDMSHLDNRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVID 483
           LGS+LKLCQ+RRG Q +++++  RAM+ Y+LPLNEV+FDFYDRLKSVSKGYASFDY++ +
Sbjct: 422 LGSVLKLCQDRRGNQKELTYVGARAMVKYDLPLNEVVFDFYDRLKSVSKGYASFDYHLTE 481

Query: 484 YRDSDLVKLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGG 543
           Y+ +DLVK+ ILVN E +DALS+LVHR+ +E RGR + EK+K LIP  MF I IQAAIGG
Sbjct: 482 YKPADLVKMQILVNAEPVDALSMLVHRTRAEGRGRAMVEKMKELIPPHMFVIPIQAAIGG 541

Query: 544 RIIARETVKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISILKT 603
           +IIARETV+A RKDVTAKCYGGDITRKRKLLEKQKEGKK+MR+FG+VDIPQ AFI+ LK 
Sbjct: 542 KIIARETVRALRKDVTAKCYGGDITRKRKLLEKQKEGKKKMRQFGKVDIPQEAFIAALKV 601

Query: 604 DN 605
           D+
Sbjct: 602 DS 603


>gi|302381955|ref|YP_003817778.1| GTP-binding protein LepA [Brevundimonas subvibrioides ATCC 15264]
 gi|302192583|gb|ADL00155.1| GTP-binding protein LepA [Brevundimonas subvibrioides ATCC 15264]
          Length = 602

 Score =  862 bits (2227), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 403/600 (67%), Positives = 496/600 (82%), Gaps = 2/600 (0%)

Query: 7   PLSRIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTV 66
           P+ RIRNFS+VAHIDHGKSTL+DR IQ   GLT REMS+QVLDNMDIE+ERGITIKAQTV
Sbjct: 5   PIDRIRNFSVVAHIDHGKSTLSDRLIQVTGGLTAREMSAQVLDNMDIEKERGITIKAQTV 64

Query: 67  RLNYTSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQA 126
           RLNY + D  DY LNL+DTPGHVDF YEVSRSL+ACEGSLLVVDA+QGVEAQTLANVYQA
Sbjct: 65  RLNYKAKDGLDYVLNLMDTPGHVDFAYEVSRSLAACEGSLLVVDASQGVEAQTLANVYQA 124

Query: 127 IDNNHEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERIVQQ 186
           IDNNHEI+ VLNK DLP+A+P+RV++QIE+ IGI   DA+L SAK+G GI  +LE IV +
Sbjct: 125 IDNNHEIVPVLNKIDLPAAEPERVRQQIEDVIGIDASDAVLCSAKSGIGIEDVLEAIVTR 184

Query: 187 LPSPTSPEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVERI 246
           LP+P      NAPLKALL+D+WY+ YLGV+VLVR+ +G L  G  +++M   + + ++R+
Sbjct: 185 LPAPKG--DPNAPLKALLVDAWYDPYLGVVVLVRVFDGTLKAGMRVKMMQNGSTHLIDRV 242

Query: 247 GILTPKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVVFC 306
           G+  PK   +E+L PGE+G + A IKEV+   VGDTITD+  PTT  L GFK +Q VVFC
Sbjct: 243 GVFLPKNTPVESLGPGEVGFITAQIKEVADAAVGDTITDEKKPTTEPLKGFKQVQSVVFC 302

Query: 307 GLFPVDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERLER 366
           GLFPVDA  FE+LR AI +LRLNDASF++E+E+S ALGFGFRCGFLGLLHLEIIQERL R
Sbjct: 303 GLFPVDAADFEDLRAAIGRLRLNDASFTYEMESSAALGFGFRCGFLGLLHLEIIQERLSR 362

Query: 367 EFSLNLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEYLGS 426
           EF+L+LI T+PSVVY++ + DGS   L NP D+P+V +I  + EPWI+ TI+TP+EYLG 
Sbjct: 363 EFNLDLIATAPSVVYKIGLRDGSELDLHNPADLPDVMQIETISEPWIKATILTPDEYLGG 422

Query: 427 ILKLCQERRGIQIDMSHLDNRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDYRD 486
           ++KLCQ+RRG QI++S++  RA++VYELPLNEV+FDFYDRLKS+SKGYASFDY + DY+ 
Sbjct: 423 VIKLCQDRRGSQIELSYVGTRALVVYELPLNEVVFDFYDRLKSISKGYASFDYELTDYKV 482

Query: 487 SDLVKLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGGRII 546
            DLVK++ILVN E +DALS+LVHR  +E RGRG+ EK+K+LIP  MF I IQAAIGG+II
Sbjct: 483 GDLVKMSILVNAEPVDALSMLVHRGRAETRGRGMVEKMKDLIPPHMFVIPIQAAIGGKII 542

Query: 547 ARETVKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISILKTDNE 606
           ARETV+A RKDVT+KCYGGD TRK+KLLEKQK GKKRMR+FG+V+IPQ AFI+ LK D++
Sbjct: 543 ARETVRALRKDVTSKCYGGDATRKKKLLEKQKAGKKRMRQFGKVEIPQEAFIAALKMDDD 602


>gi|39933429|ref|NP_945705.1| GTP-binding protein LepA [Rhodopseudomonas palustris CGA009]
 gi|192288786|ref|YP_001989391.1| GTP-binding protein LepA [Rhodopseudomonas palustris TIE-1]
 gi|46396182|sp|P60793|LEPA_RHOPA RecName: Full=Elongation factor 4; Short=EF-4; AltName:
           Full=Ribosomal back-translocase LepA
 gi|229485938|sp|B3Q991|LEPA_RHOPT RecName: Full=Elongation factor 4; Short=EF-4; AltName:
           Full=Ribosomal back-translocase LepA
 gi|39647275|emb|CAE25796.1| possible GTP-binding protein LepA [Rhodopseudomonas palustris
           CGA009]
 gi|192282535|gb|ACE98915.1| GTP-binding protein LepA [Rhodopseudomonas palustris TIE-1]
          Length = 603

 Score =  862 bits (2226), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 415/602 (68%), Positives = 503/602 (83%), Gaps = 4/602 (0%)

Query: 6   TPLSRIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSS--QVLDNMDIERERGITIKA 63
            P+  IRNFSIVAHIDHGKSTLADR IQ   G+++REM+   QVLD+MDIERERGITIKA
Sbjct: 4   APIDNIRNFSIVAHIDHGKSTLADRLIQITGGMSDREMAGKEQVLDSMDIERERGITIKA 63

Query: 64  QTVRLNYTSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANV 123
           QTVRL Y + D KDY  NL+DTPGHVDF YEVSRSL+ACEGSLLVVDA+QGVEAQTLANV
Sbjct: 64  QTVRLKYRAHDGKDYIFNLMDTPGHVDFAYEVSRSLAACEGSLLVVDASQGVEAQTLANV 123

Query: 124 YQAIDNNHEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERI 183
           Y A+D  HEI+ VLNK DLP+A+P+++K+QIE+ IG+   DA+++SAKTG G+P +LE I
Sbjct: 124 YHALDAGHEIVPVLNKVDLPAAEPEKIKQQIEDVIGLDASDAVMISAKTGLGVPDVLEAI 183

Query: 184 VQQLPSPTSPEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQV 243
           V +LP P      +A LKALL+DSWY+ YLGV+VLVR+++G L KGQ IR+MGT A Y V
Sbjct: 184 VTRLPPPKGDR--DATLKALLVDSWYDVYLGVVVLVRVVDGVLKKGQRIRMMGTGAAYDV 241

Query: 244 ERIGILTPKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPV 303
           ER+G  TPKM+++E L PGE+G + A+IKEV+ TRVGDTITDD  P T  LPGFKP  PV
Sbjct: 242 ERVGYFTPKMVNVEELGPGEVGFITAAIKEVADTRVGDTITDDKKPVTDMLPGFKPAIPV 301

Query: 304 VFCGLFPVDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQER 363
           VFCGLFPVDA  FE LR A+ KLRLNDASFSFE+E S ALGFGFRCGFLGLLHLEIIQER
Sbjct: 302 VFCGLFPVDADDFETLRAAMGKLRLNDASFSFEMETSAALGFGFRCGFLGLLHLEIIQER 361

Query: 364 LEREFSLNLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEY 423
           L REF L+LI T+PSV+Y++ + DG+  ++ NP+DMP+V KIAE+ EPWI+ TI+TP+EY
Sbjct: 362 LSREFDLDLIATAPSVIYKMKLTDGTEMEIHNPVDMPDVVKIAEIEEPWIEATILTPDEY 421

Query: 424 LGSILKLCQERRGIQIDMSHLDNRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVID 483
           LGS+LKLCQ+RRG Q +++++  RAM+ Y+LPLNEV+FDFYDRLKSVSKGYASFDY++ D
Sbjct: 422 LGSVLKLCQDRRGNQKELTYVGARAMVKYDLPLNEVVFDFYDRLKSVSKGYASFDYHLTD 481

Query: 484 YRDSDLVKLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGG 543
           Y+ +DLVK+ ILVN E +DALS+LVHR+ +E RGR + EK+K LIP  MFQI IQAAIGG
Sbjct: 482 YKPADLVKMQILVNAEPVDALSMLVHRTRAEGRGRAMVEKMKELIPPHMFQIPIQAAIGG 541

Query: 544 RIIARETVKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISILKT 603
           ++IARETV+A RKDVTAKCYGGDITRKRKLLEKQKEGKK+MR+FG+VDIPQ AFI+ LK 
Sbjct: 542 KVIARETVRALRKDVTAKCYGGDITRKRKLLEKQKEGKKKMRQFGKVDIPQEAFIAALKV 601

Query: 604 DN 605
           D+
Sbjct: 602 DS 603


>gi|288959432|ref|YP_003449773.1| GTP-binding protein [Azospirillum sp. B510]
 gi|288911740|dbj|BAI73229.1| GTP-binding protein [Azospirillum sp. B510]
          Length = 600

 Score =  862 bits (2226), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 403/601 (67%), Positives = 494/601 (82%), Gaps = 2/601 (0%)

Query: 6   TPLSRIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQT 65
           T LS IRNFSI+AHIDHGKSTLADR IQ C GL  REM  QVLD+MDIERERGITIKAQT
Sbjct: 2   TDLSHIRNFSIIAHIDHGKSTLADRLIQQCGGLDAREMREQVLDSMDIERERGITIKAQT 61

Query: 66  VRLNYTSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQ 125
           VRL Y + D K Y LNL+DTPGHVDF YEVSRSLSACEGS+LVVDA+QGVEAQTLANVYQ
Sbjct: 62  VRLLYKAEDGKQYTLNLMDTPGHVDFAYEVSRSLSACEGSILVVDASQGVEAQTLANVYQ 121

Query: 126 AIDNNHEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERIVQ 185
           AIDNNHEII VLNK DLP+A+PDRVK+QIE+ IG+   DA+ +SAK+G  I  +LE +V+
Sbjct: 122 AIDNNHEIIPVLNKIDLPAAEPDRVKQQIEDVIGLDASDAVEISAKSGLNIGAVLEAVVK 181

Query: 186 QLPSPTSPEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVER 245
           +LP P     A+A LKALL+DSWY+ YLGV++LVR+++G L  GQ +R M   + + V+R
Sbjct: 182 RLPPPKGD--ADAALKALLVDSWYDPYLGVVILVRVVDGVLKVGQKVRFMAAGSAHDVDR 239

Query: 246 IGILTPKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVVF 305
           +G+ TPK +    L PGE+G + A+IK+++ T+VGDTITD+  P T AL GFKP  PVV+
Sbjct: 240 VGVFTPKALLTGELRPGEMGFITAAIKDITLTKVGDTITDERKPATEALAGFKPSVPVVW 299

Query: 306 CGLFPVDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERLE 365
           CGLFPVDA  FE LR ++ KL+LNDASF +E E S ALGFGFRCGFLGLLHLEIIQERLE
Sbjct: 300 CGLFPVDAADFERLRDSLGKLKLNDASFHYEAETSAALGFGFRCGFLGLLHLEIIQERLE 359

Query: 366 REFSLNLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEYLG 425
           REF+L+LI T+PSVVY+L+M DGS+Q L NP DMP+V KI  + EPWI+ TI+ P+EYLG
Sbjct: 360 REFNLDLITTAPSVVYKLHMTDGSVQDLHNPADMPDVVKIDRIEEPWIKATIMLPDEYLG 419

Query: 426 SILKLCQERRGIQIDMSHLDNRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDYR 485
            IL+LC +RRG QI++++  NRAM++Y LPLNEV+FDFYDRLKS+S+GYASFDY +  Y 
Sbjct: 420 GILQLCTDRRGQQIELTYAGNRAMLIYRLPLNEVVFDFYDRLKSISRGYASFDYQMDGYE 479

Query: 486 DSDLVKLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGGRI 545
           + DLVK+ ILVN E +DALS++VHR  +E+RGR +CE+LK LIP+Q+F+IA+QAAIGGR+
Sbjct: 480 EGDLVKMAILVNAEPVDALSMIVHRGQAERRGRQLCERLKELIPRQLFKIAVQAAIGGRV 539

Query: 546 IARETVKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISILKTDN 605
           IARET+ A RKDV AKCYGGDI+RKRKLL+KQKEGKKRMR+FG+V+IPQSAFI+ LK  +
Sbjct: 540 IARETISAMRKDVLAKCYGGDISRKRKLLDKQKEGKKRMRQFGQVEIPQSAFIAALKMGD 599

Query: 606 E 606
           E
Sbjct: 600 E 600


>gi|58038716|ref|YP_190680.1| GTP-binding protein LepA [Gluconobacter oxydans 621H]
 gi|58001130|gb|AAW60024.1| GTP-binding elongation factor LepA [Gluconobacter oxydans 621H]
          Length = 616

 Score =  859 bits (2220), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 399/599 (66%), Positives = 499/599 (83%), Gaps = 2/599 (0%)

Query: 6   TPLSRIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQT 65
           TPLS IRNFSI+AHIDHGKSTLADR IQ C  LT REM +QVLD+M++E+ERGITIKAQT
Sbjct: 20  TPLSLIRNFSIIAHIDHGKSTLADRLIQACGALTAREMKNQVLDSMELEQERGITIKAQT 79

Query: 66  VRLNYTSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQ 125
           VRL Y + D K Y LNL+DTPGHVDF YEVSRSL+ACEGSLLVVDA+QGVEAQTLANVYQ
Sbjct: 80  VRLTYPAKDGKVYTLNLMDTPGHVDFAYEVSRSLAACEGSLLVVDASQGVEAQTLANVYQ 139

Query: 126 AIDNNHEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERIVQ 185
           A+D NHEI+ VLNK DLP+A+P+RV+ QIE+ +GI  +DA+ +SAKTG  I  +LE +VQ
Sbjct: 140 ALDANHEIVPVLNKIDLPAAEPERVRAQIEDVVGIPADDAVEISAKTGINIEGVLEALVQ 199

Query: 186 QLPSPTSPEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVER 245
           +LP+PT    A APL+ALL+DSWY++YLGV++LVRI +G+L +G  IR+M T A Y V++
Sbjct: 200 RLPAPTG--DAEAPLQALLVDSWYDAYLGVIILVRIKDGRLKRGDRIRMMQTGATYHVDQ 257

Query: 246 IGILTPKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVVF 305
           +G+  PKM  +E+L PGE+G + A+IK V+   VGDT+T D  P   ALPGFKP  PVV+
Sbjct: 258 VGVFLPKMQSVESLGPGEMGYINAAIKTVADCNVGDTVTLDKRPAEKALPGFKPSIPVVW 317

Query: 306 CGLFPVDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERLE 365
           CGLFP+DA  FE LR ++ KLRLNDASF FE E S ALGFGFRCGFLGLLHLEIIQERL 
Sbjct: 318 CGLFPIDADDFEKLRDSLGKLRLNDASFHFEAETSAALGFGFRCGFLGLLHLEIIQERLS 377

Query: 366 REFSLNLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEYLG 425
           REF+L+LI T+PSVVY+++M DG++++L NP DMPE++KI  + EPWI+ TI+  +EYLG
Sbjct: 378 REFNLDLIATAPSVVYKMHMTDGTVEELHNPADMPELSKIEMIEEPWIKATIMVQDEYLG 437

Query: 426 SILKLCQERRGIQIDMSHLDNRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDYR 485
            +L LC ERRGIQ+D++++ NRAM VY LPLNEV+FDFYDRLKS+S+GYASFDY +  Y 
Sbjct: 438 PVLTLCSERRGIQVDLTYVGNRAMAVYRLPLNEVVFDFYDRLKSISRGYASFDYQMDGYE 497

Query: 486 DSDLVKLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGGRI 545
           +SDLV+++ILVN+E +DALS + HR+V+E+RGR IC KLK+LIP+Q+F+IAIQAAIG ++
Sbjct: 498 ESDLVRISILVNHEPVDALSFISHRTVAEQRGRSICAKLKDLIPKQLFKIAIQAAIGSKV 557

Query: 546 IARETVKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISILKTD 604
           IARET+ A  KDVTAKCYGGDI+RKRKLL+KQKEGKKRMR+FG+V+IPQSAF++ LK D
Sbjct: 558 IARETIGALSKDVTAKCYGGDISRKRKLLDKQKEGKKRMRQFGKVEIPQSAFLAALKMD 616


>gi|90185156|sp|Q5FUC2|LEPA_GLUOX RecName: Full=Elongation factor 4; Short=EF-4; AltName:
           Full=Ribosomal back-translocase LepA
          Length = 600

 Score =  858 bits (2218), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 399/599 (66%), Positives = 499/599 (83%), Gaps = 2/599 (0%)

Query: 6   TPLSRIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQT 65
           TPLS IRNFSI+AHIDHGKSTLADR IQ C  LT REM +QVLD+M++E+ERGITIKAQT
Sbjct: 4   TPLSLIRNFSIIAHIDHGKSTLADRLIQACGALTAREMKNQVLDSMELEQERGITIKAQT 63

Query: 66  VRLNYTSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQ 125
           VRL Y + D K Y LNL+DTPGHVDF YEVSRSL+ACEGSLLVVDA+QGVEAQTLANVYQ
Sbjct: 64  VRLTYPAKDGKVYTLNLMDTPGHVDFAYEVSRSLAACEGSLLVVDASQGVEAQTLANVYQ 123

Query: 126 AIDNNHEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERIVQ 185
           A+D NHEI+ VLNK DLP+A+P+RV+ QIE+ +GI  +DA+ +SAKTG  I  +LE +VQ
Sbjct: 124 ALDANHEIVPVLNKIDLPAAEPERVRAQIEDVVGIPADDAVEISAKTGINIEGVLEALVQ 183

Query: 186 QLPSPTSPEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVER 245
           +LP+PT    A APL+ALL+DSWY++YLGV++LVRI +G+L +G  IR+M T A Y V++
Sbjct: 184 RLPAPTG--DAEAPLQALLVDSWYDAYLGVIILVRIKDGRLKRGDRIRMMQTGATYHVDQ 241

Query: 246 IGILTPKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVVF 305
           +G+  PKM  +E+L PGE+G + A+IK V+   VGDT+T D  P   ALPGFKP  PVV+
Sbjct: 242 VGVFLPKMQSVESLGPGEMGYINAAIKTVADCNVGDTVTLDKRPAEKALPGFKPSIPVVW 301

Query: 306 CGLFPVDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERLE 365
           CGLFP+DA  FE LR ++ KLRLNDASF FE E S ALGFGFRCGFLGLLHLEIIQERL 
Sbjct: 302 CGLFPIDADDFEKLRDSLGKLRLNDASFHFEAETSAALGFGFRCGFLGLLHLEIIQERLS 361

Query: 366 REFSLNLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEYLG 425
           REF+L+LI T+PSVVY+++M DG++++L NP DMPE++KI  + EPWI+ TI+  +EYLG
Sbjct: 362 REFNLDLIATAPSVVYKMHMTDGTVEELHNPADMPELSKIEMIEEPWIKATIMVQDEYLG 421

Query: 426 SILKLCQERRGIQIDMSHLDNRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDYR 485
            +L LC ERRGIQ+D++++ NRAM VY LPLNEV+FDFYDRLKS+S+GYASFDY +  Y 
Sbjct: 422 PVLTLCSERRGIQVDLTYVGNRAMAVYRLPLNEVVFDFYDRLKSISRGYASFDYQMDGYE 481

Query: 486 DSDLVKLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGGRI 545
           +SDLV+++ILVN+E +DALS + HR+V+E+RGR IC KLK+LIP+Q+F+IAIQAAIG ++
Sbjct: 482 ESDLVRISILVNHEPVDALSFISHRTVAEQRGRSICAKLKDLIPKQLFKIAIQAAIGSKV 541

Query: 546 IARETVKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISILKTD 604
           IARET+ A  KDVTAKCYGGDI+RKRKLL+KQKEGKKRMR+FG+V+IPQSAF++ LK D
Sbjct: 542 IARETIGALSKDVTAKCYGGDISRKRKLLDKQKEGKKRMRQFGKVEIPQSAFLAALKMD 600


>gi|163744428|ref|ZP_02151788.1| GTP-binding protein LepA [Oceanibulbus indolifex HEL-45]
 gi|161381246|gb|EDQ05655.1| GTP-binding protein LepA [Oceanibulbus indolifex HEL-45]
          Length = 599

 Score =  855 bits (2208), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 399/600 (66%), Positives = 494/600 (82%), Gaps = 2/600 (0%)

Query: 6   TPLSRIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQT 65
           TPL  IRNFSIVAHIDHGKSTLADR IQ  + + +R+M  Q+LD+MDIERERGITIKAQT
Sbjct: 2   TPLENIRNFSIVAHIDHGKSTLADRLIQSTKTVADRDMKEQMLDSMDIERERGITIKAQT 61

Query: 66  VRLNYTSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQ 125
           VR+NYT+ D +DY LNLIDTPGHVDF YEVSRS+ A EGSLLVVD+TQGVEAQTLANVY 
Sbjct: 62  VRINYTADDGQDYVLNLIDTPGHVDFAYEVSRSMRAVEGSLLVVDSTQGVEAQTLANVYH 121

Query: 126 AIDNNHEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERIVQ 185
           AID +HEI+ VLNK DLP+AD DRV +QIE+ IGI   +A+ VSAKTG GI   LE IV 
Sbjct: 122 AIDADHEIVPVLNKIDLPAADCDRVAEQIEDVIGIDASEAIRVSAKTGIGIKETLEAIVT 181

Query: 186 QLPSPTSPEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVER 245
           +LP+P      +APLKA+L+DSWY+SYLGV+VLVRI++GQL KG  +R+M   + + V+R
Sbjct: 182 RLPAPKG--SLDAPLKAMLVDSWYDSYLGVIVLVRIMDGQLKKGDRVRMMQNGSVHHVDR 239

Query: 246 IGILTPKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVVF 305
           IG+  P M +I+ L PGEIG + ASIK+V  TRVGDTIT +   T  ALPGFKP QPVVF
Sbjct: 240 IGVFRPAMTEIDVLGPGEIGFLTASIKQVRDTRVGDTITHEKKGTDKALPGFKPAQPVVF 299

Query: 306 CGLFPVDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERLE 365
           CGLFPVDA +FE+LR +I KL LNDASFSFE+E S ALGFGFRCGFLGLLHLE+I++R+E
Sbjct: 300 CGLFPVDAAEFEDLRDSIEKLALNDASFSFEMETSAALGFGFRCGFLGLLHLEVIRDRIE 359

Query: 366 REFSLNLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEYLG 425
           RE+ ++LI T+PSV+Y+++M DG++++L NP DMP++T +  + EP I+ TI+ P+EYLG
Sbjct: 360 REYDIDLITTAPSVIYDIHMKDGTVEQLHNPADMPDLTYVDHIEEPRIKATILVPDEYLG 419

Query: 426 SILKLCQERRGIQIDMSHLDNRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDYR 485
            +LKLCQ+RRG+Q+D+++  +RAM+VY+LPLNEV+FDFYDRLKSV+KGYASFDY +I YR
Sbjct: 420 DVLKLCQDRRGMQLDLTYAGSRAMVVYDLPLNEVVFDFYDRLKSVTKGYASFDYAMIGYR 479

Query: 486 DSDLVKLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGGRI 545
              LVK++ILVN+E +DALS +VHR  +E RGR + EKLK+LIP+ MF+I IQAAIGG++
Sbjct: 480 TDALVKMSILVNDEPVDALSTMVHRDRAETRGRAMVEKLKDLIPRHMFKIPIQAAIGGKV 539

Query: 546 IARETVKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISILKTDN 605
           IARET+ A RKDVTAKCYGGD TRK+KLLEKQK GKK+MR+FG+VDIPQ AFIS LK D 
Sbjct: 540 IARETLSAMRKDVTAKCYGGDATRKKKLLEKQKAGKKKMRQFGKVDIPQEAFISALKMDG 599


>gi|83945030|ref|ZP_00957396.1| GTP-binding protein LepA [Oceanicaulis alexandrii HTCC2633]
 gi|83851812|gb|EAP89667.1| GTP-binding protein LepA [Oceanicaulis alexandrii HTCC2633]
          Length = 602

 Score =  855 bits (2208), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 405/598 (67%), Positives = 490/598 (81%), Gaps = 1/598 (0%)

Query: 9   SRIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVRL 68
           S IRNFSIVAHIDHGKSTLADR IQH  GLT+REM  QVLDNM++ERERGITIKAQTVRL
Sbjct: 6   SLIRNFSIVAHIDHGKSTLADRLIQHTGGLTDREMKEQVLDNMELERERGITIKAQTVRL 65

Query: 69  NYTSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQAID 128
            YT+ D   Y LNLIDTPGHVDF YEVSRSL ACEG+LLVVDA QGVEAQTLANVY AID
Sbjct: 66  EYTAKDGNTYALNLIDTPGHVDFAYEVSRSLYACEGALLVVDAAQGVEAQTLANVYAAID 125

Query: 129 NNHEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERIVQQLP 188
            + EI+ VLNK DLP+A+PDRVK QIE+ IGI   DA+ +SAKTG GI  +LE IV +LP
Sbjct: 126 VDLEIVPVLNKIDLPAAEPDRVKAQIEDVIGIDASDAIEISAKTGLGIDNVLEAIVTRLP 185

Query: 189 SPTSPEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVERIGI 248
           +P S +  +APLKALL+DSWY+ YLGV+ LVRII G L KG  +RLMG  A Y V+ +G+
Sbjct: 186 APKSGD-PSAPLKALLVDSWYDPYLGVICLVRIIEGTLKKGMRVRLMGAKASYGVDGVGV 244

Query: 249 LTPKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVVFCGL 308
            TP   + ++L PGEIG + ASIK+V   RVGDTIT++  PT S LPGF+P  PVVFCGL
Sbjct: 245 FTPAKENRDSLGPGEIGFLNASIKQVRDARVGDTITEEKRPTDSMLPGFEPAVPVVFCGL 304

Query: 309 FPVDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERLEREF 368
           FPVDA  FE+LR A+ +L LNDASFSFE+E S ALGFGFRCGFLGLLHLE+I+ERLERE+
Sbjct: 305 FPVDAADFEDLRDAVERLALNDASFSFEMETSAALGFGFRCGFLGLLHLEVIRERLEREY 364

Query: 369 SLNLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEYLGSIL 428
           +++LI T+PSVVY++ + DG+   L NP DMP+  KIA + EPWI+ TI+ P+EYLG +L
Sbjct: 365 NVDLITTAPSVVYKMQLTDGTEIDLHNPADMPDPVKIASIAEPWIKATILVPDEYLGGVL 424

Query: 429 KLCQERRGIQIDMSHLDNRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDYRDSD 488
           KLCQ+RRG+Q+++++   RAM+VYELPLNEV+FDFYDRLKSV+KGYASFDY  I++R+ D
Sbjct: 425 KLCQDRRGVQLELTYAGARAMLVYELPLNEVVFDFYDRLKSVTKGYASFDYQFIEHREED 484

Query: 489 LVKLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGGRIIAR 548
           LVK++ILVN E +DALS++VHRS ++ RGR +CEKLK LIP+ MF+I IQAAIGGR+IAR
Sbjct: 485 LVKMSILVNEEPVDALSMIVHRSRADMRGRAMCEKLKELIPRHMFKIPIQAAIGGRVIAR 544

Query: 549 ETVKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISILKTDNE 606
           ET+ A RKDVTAKCYGGD TRKRKLLEKQK GKK+MR++G V+IPQ AFI+ LK D++
Sbjct: 545 ETLSAMRKDVTAKCYGGDATRKRKLLEKQKAGKKKMRQYGNVEIPQEAFIAALKMDDD 602


>gi|115522852|ref|YP_779763.1| GTP-binding protein LepA [Rhodopseudomonas palustris BisA53]
 gi|122297548|sp|Q07TF1|LEPA_RHOP5 RecName: Full=Elongation factor 4; Short=EF-4; AltName:
           Full=Ribosomal back-translocase LepA
 gi|115516799|gb|ABJ04783.1| GTP-binding protein LepA [Rhodopseudomonas palustris BisA53]
          Length = 603

 Score =  854 bits (2207), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 413/602 (68%), Positives = 501/602 (83%), Gaps = 4/602 (0%)

Query: 6   TPLSRIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSS--QVLDNMDIERERGITIKA 63
            P+  IRNFSIVAHIDHGKSTLADR IQ   G+T+REM+   QVLD+MDIERERGITIKA
Sbjct: 4   APIDNIRNFSIVAHIDHGKSTLADRLIQITGGMTDREMAGKEQVLDSMDIERERGITIKA 63

Query: 64  QTVRLNYTSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANV 123
           QTVRLNY + D KDY  NL+DTPGHVDF YEVSRSL+ACEGSLLVVDA+QGVEAQTLANV
Sbjct: 64  QTVRLNYHAKDGKDYIFNLMDTPGHVDFAYEVSRSLAACEGSLLVVDASQGVEAQTLANV 123

Query: 124 YQAIDNNHEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERI 183
           Y A+D  HEI+ VLNK DLP+A+P+ +K+QIE+ IG+   DA+++SAKTG G+P +LE I
Sbjct: 124 YHALDAGHEIVPVLNKVDLPAAEPEMIKQQIEDVIGLDASDAVMISAKTGFGVPEVLEAI 183

Query: 184 VQQLPSPTSPEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQV 243
           V +LP P     A+  LKALL+DSWY+ YLGV+VLVR+++G + KGQ IR+MGTNA Y +
Sbjct: 184 VTRLPPPKGDRTAS--LKALLVDSWYDVYLGVVVLVRVVDGVMKKGQRIRMMGTNAAYDL 241

Query: 244 ERIGILTPKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPV 303
           ER+G  TPKM  ++ L PGEIG + A+IKEV+ TRVGDTITDD  P T  LPGFKP  PV
Sbjct: 242 ERVGYFTPKMTAVDELGPGEIGFITAAIKEVADTRVGDTITDDRKPITEMLPGFKPAIPV 301

Query: 304 VFCGLFPVDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQER 363
           VFCGLFPVDA  FE LR A+ KLRLNDASFSFE+E S ALGFGFRCGFLGLLHLEIIQER
Sbjct: 302 VFCGLFPVDADDFETLRAAMGKLRLNDASFSFEMETSAALGFGFRCGFLGLLHLEIIQER 361

Query: 364 LEREFSLNLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEY 423
           L REF L+LI T+PSV+Y++ ++DGS  ++ NP+DMP+V +I E+ EPWI+ TI+TP+EY
Sbjct: 362 LSREFDLDLIATAPSVIYKMKLNDGSEIEIHNPVDMPDVVRIQEIDEPWIEATILTPDEY 421

Query: 424 LGSILKLCQERRGIQIDMSHLDNRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVID 483
           LGS+LKLCQ+RRG Q +++++  RAM+ Y+LPLNEV+FDFYDRLKSVSKGYASFDY++ D
Sbjct: 422 LGSVLKLCQDRRGNQKELTYVGARAMVKYDLPLNEVVFDFYDRLKSVSKGYASFDYHLTD 481

Query: 484 YRDSDLVKLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGG 543
           Y+ +DLVK+ ILVN E +DALS+LVHR+ +E RGR + EK+K LIP  MF I IQAAIGG
Sbjct: 482 YKPADLVKMQILVNAEPVDALSMLVHRTRAEGRGRAMVEKMKELIPPHMFVIPIQAAIGG 541

Query: 544 RIIARETVKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISILKT 603
           +IIARETV+A RKDVTAKCYGGD+TRKRKLLEKQKEGKK++R+FG+VDIPQ AFI+ LK 
Sbjct: 542 KIIARETVRALRKDVTAKCYGGDVTRKRKLLEKQKEGKKKLRQFGKVDIPQEAFIAALKV 601

Query: 604 DN 605
           D+
Sbjct: 602 DS 603


>gi|119371364|sp|Q0ATE3|LEPA_MARMM RecName: Full=Elongation factor 4; Short=EF-4; AltName:
           Full=Ribosomal back-translocase LepA
          Length = 602

 Score =  854 bits (2206), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 400/597 (67%), Positives = 494/597 (82%), Gaps = 1/597 (0%)

Query: 9   SRIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVRL 68
           S IRNFSIVAHIDHGKSTLADR IQ   GLT+REM  QVLDNM++ERERGITIKAQTVRL
Sbjct: 6   SLIRNFSIVAHIDHGKSTLADRLIQVTGGLTQREMKEQVLDNMELERERGITIKAQTVRL 65

Query: 69  NYTSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQAID 128
           +YT+ D K Y LNLIDTPGHVDF YEV+RSL+ACEGSLLVVDA+QGVEAQTLANVYQAI+
Sbjct: 66  DYTAKDGKTYVLNLIDTPGHVDFAYEVNRSLAACEGSLLVVDASQGVEAQTLANVYQAIE 125

Query: 129 NNHEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERIVQQLP 188
            NHEI+ VLNK DLP+A+P+RVK+QIE+ IG+   DA+++SAKTG GI  +LE +V +LP
Sbjct: 126 VNHEIVPVLNKIDLPAAEPERVKEQIEDVIGLDASDAVMISAKTGLGIEDVLEAVVTRLP 185

Query: 189 SPTSPEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVERIGI 248
            P + +  N PLKA+L+DSWY+ YLGV+ LVR+I G L KG  +RLMGT A Y V+ +G+
Sbjct: 186 PPAAGD-PNGPLKAMLVDSWYDPYLGVICLVRVIEGTLKKGMKVRLMGTGATYPVDGVGV 244

Query: 249 LTPKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVVFCGL 308
             PK   I++L PGE+G + ASIK+V   RVGDT+TDD  P   AL G+KP QPVVFCGL
Sbjct: 245 FRPKKEAIDSLGPGELGYLNASIKQVRDARVGDTVTDDRRPADKALTGYKPAQPVVFCGL 304

Query: 309 FPVDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERLEREF 368
           FPVD+ +FE+LR AI +L LNDASFS+E+E S ALGFGFRCGFLGLLHLE+I+ERLERE+
Sbjct: 305 FPVDSAEFEDLREAIERLALNDASFSYEMETSAALGFGFRCGFLGLLHLEVIRERLEREY 364

Query: 369 SLNLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEYLGSIL 428
           ++ LI T+PSVVY L+M+DGS   L NP DMP+  KI  + EPWI+ TI+ P+EYLG +L
Sbjct: 365 NIELITTAPSVVYRLHMNDGSEIDLHNPADMPDPVKIDTIAEPWIKATILVPDEYLGGVL 424

Query: 429 KLCQERRGIQIDMSHLDNRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDYRDSD 488
           KLCQ+RRG Q+++++  NRA++VYELPLNEV+FDFYDRLKS+SKGYASFDY  I+ R  D
Sbjct: 425 KLCQDRRGNQVELTYAGNRALVVYELPLNEVVFDFYDRLKSISKGYASFDYQWIEDRVGD 484

Query: 489 LVKLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGGRIIAR 548
           LV+++ILVN+E +DALS++VHR+ +E RGR +CEKLK LIP+ MF+I IQAA+GGRI+AR
Sbjct: 485 LVRMSILVNDEPVDALSMVVHRARAELRGRAMCEKLKELIPRHMFKIPIQAALGGRIVAR 544

Query: 549 ETVKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISILKTDN 605
           ET+ A RKDVTAKCYGGD +RKRKLL+KQK GKK+MR+FG+V+IPQ AFI+ LK D+
Sbjct: 545 ETLSALRKDVTAKCYGGDASRKRKLLDKQKAGKKKMRQFGKVEIPQEAFIAALKMDD 601


>gi|144898653|emb|CAM75517.1| GTP-binding protein LepA [Magnetospirillum gryphiswaldense MSR-1]
          Length = 600

 Score =  854 bits (2206), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 396/601 (65%), Positives = 493/601 (82%), Gaps = 2/601 (0%)

Query: 6   TPLSRIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQT 65
           T L  IRNF+I+AHIDHGKSTLADR IQ C  +  R+M  Q+LD+MDIERERGITIKAQT
Sbjct: 2   TKLEHIRNFAIIAHIDHGKSTLADRLIQQCGAVEARDMKEQMLDSMDIERERGITIKAQT 61

Query: 66  VRLNYTSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQ 125
           VRL Y + D K YQLNL+DTPGHVDF YEVSRSL+ACEGS+LVVDA+QGVEAQTLANVYQ
Sbjct: 62  VRLAYQAKDGKTYQLNLMDTPGHVDFAYEVSRSLAACEGSILVVDASQGVEAQTLANVYQ 121

Query: 126 AIDNNHEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERIVQ 185
           A+D  HEI+ VLNK DLP+A+P+RVK+Q+E+ IG+   DA+++SAK+G GI  +LE +V 
Sbjct: 122 ALDAGHEIVPVLNKIDLPAAEPERVKQQVEDVIGLDASDAVMISAKSGIGIEDVLEALVT 181

Query: 186 QLPSPTSPEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVER 245
           +LP P   E A+  L+ALL+DSWY++YLGV++LVR+ NG L +G  IR+M   + Y+V+ 
Sbjct: 182 RLPCPEGDEKAD--LQALLVDSWYDAYLGVIILVRVKNGVLKRGMKIRMMANGSAYEVDS 239

Query: 246 IGILTPKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVVF 305
           +G  TPKMI  +AL PGE+G + A IK V+ T VGDTITDD  P  +AL GFKP  PVV+
Sbjct: 240 VGYFTPKMIKADALRPGEMGFITAGIKAVADTNVGDTITDDKKPAATALAGFKPSIPVVW 299

Query: 306 CGLFPVDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERLE 365
           CGLFP+DA  +E+LR ++ KLRLNDASF +E E S ALGFGFRCGFLGLLHLEIIQERLE
Sbjct: 300 CGLFPIDAADYEDLRDSLAKLRLNDASFQYEPETSAALGFGFRCGFLGLLHLEIIQERLE 359

Query: 366 REFSLNLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEYLG 425
           REF+L+LI T+PSVVY ++M +GSMQ+L NP DMP+   I  + EPWI+ TI+ P+EYLG
Sbjct: 360 REFNLDLITTAPSVVYHIHMTNGSMQELHNPADMPDQGLIDHVDEPWIKATIMVPDEYLG 419

Query: 426 SILKLCQERRGIQIDMSHLDNRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDYR 485
           SIL+LC ERRG Q+D+++  NRAM VY+LPLNEV+FDFYDRLKS+S+GYASFDY +  Y 
Sbjct: 420 SILQLCTERRGQQLDLTYAGNRAMAVYKLPLNEVVFDFYDRLKSISRGYASFDYEMDCYT 479

Query: 486 DSDLVKLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGGRI 545
           +SDLVK++ILVN E +DAL+ +VHR+ +E RGRGIC +LK LIP+QMFQIAIQAAIGGRI
Sbjct: 480 ESDLVKVSILVNQEPVDALAFIVHRANAESRGRGICTRLKELIPRQMFQIAIQAAIGGRI 539

Query: 546 IARETVKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISILKTDN 605
           +ARE++ A RKDV AKCYGGD++RKRKLL+KQKEGKKRMR+FGRV+IPQSAF++ LK  +
Sbjct: 540 VARESISALRKDVLAKCYGGDVSRKRKLLDKQKEGKKRMRQFGRVEIPQSAFLAALKMGD 599

Query: 606 E 606
           +
Sbjct: 600 D 600


>gi|114568702|ref|YP_755382.1| GTP-binding protein LepA [Maricaulis maris MCS10]
 gi|114339164|gb|ABI64444.1| GTP-binding protein LepA [Maricaulis maris MCS10]
          Length = 608

 Score =  854 bits (2206), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 400/597 (67%), Positives = 494/597 (82%), Gaps = 1/597 (0%)

Query: 9   SRIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVRL 68
           S IRNFSIVAHIDHGKSTLADR IQ   GLT+REM  QVLDNM++ERERGITIKAQTVRL
Sbjct: 12  SLIRNFSIVAHIDHGKSTLADRLIQVTGGLTQREMKEQVLDNMELERERGITIKAQTVRL 71

Query: 69  NYTSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQAID 128
           +YT+ D K Y LNLIDTPGHVDF YEV+RSL+ACEGSLLVVDA+QGVEAQTLANVYQAI+
Sbjct: 72  DYTAKDGKTYVLNLIDTPGHVDFAYEVNRSLAACEGSLLVVDASQGVEAQTLANVYQAIE 131

Query: 129 NNHEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERIVQQLP 188
            NHEI+ VLNK DLP+A+P+RVK+QIE+ IG+   DA+++SAKTG GI  +LE +V +LP
Sbjct: 132 VNHEIVPVLNKIDLPAAEPERVKEQIEDVIGLDASDAVMISAKTGLGIEDVLEAVVTRLP 191

Query: 189 SPTSPEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVERIGI 248
            P + +  N PLKA+L+DSWY+ YLGV+ LVR+I G L KG  +RLMGT A Y V+ +G+
Sbjct: 192 PPAAGD-PNGPLKAMLVDSWYDPYLGVICLVRVIEGTLKKGMKVRLMGTGATYPVDGVGV 250

Query: 249 LTPKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVVFCGL 308
             PK   I++L PGE+G + ASIK+V   RVGDT+TDD  P   AL G+KP QPVVFCGL
Sbjct: 251 FRPKKEAIDSLGPGELGYLNASIKQVRDARVGDTVTDDRRPADKALTGYKPAQPVVFCGL 310

Query: 309 FPVDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERLEREF 368
           FPVD+ +FE+LR AI +L LNDASFS+E+E S ALGFGFRCGFLGLLHLE+I+ERLERE+
Sbjct: 311 FPVDSAEFEDLREAIERLALNDASFSYEMETSAALGFGFRCGFLGLLHLEVIRERLEREY 370

Query: 369 SLNLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEYLGSIL 428
           ++ LI T+PSVVY L+M+DGS   L NP DMP+  KI  + EPWI+ TI+ P+EYLG +L
Sbjct: 371 NIELITTAPSVVYRLHMNDGSEIDLHNPADMPDPVKIDTIAEPWIKATILVPDEYLGGVL 430

Query: 429 KLCQERRGIQIDMSHLDNRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDYRDSD 488
           KLCQ+RRG Q+++++  NRA++VYELPLNEV+FDFYDRLKS+SKGYASFDY  I+ R  D
Sbjct: 431 KLCQDRRGNQVELTYAGNRALVVYELPLNEVVFDFYDRLKSISKGYASFDYQWIEDRVGD 490

Query: 489 LVKLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGGRIIAR 548
           LV+++ILVN+E +DALS++VHR+ +E RGR +CEKLK LIP+ MF+I IQAA+GGRI+AR
Sbjct: 491 LVRMSILVNDEPVDALSMVVHRARAELRGRAMCEKLKELIPRHMFKIPIQAALGGRIVAR 550

Query: 549 ETVKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISILKTDN 605
           ET+ A RKDVTAKCYGGD +RKRKLL+KQK GKK+MR+FG+V+IPQ AFI+ LK D+
Sbjct: 551 ETLSALRKDVTAKCYGGDASRKRKLLDKQKAGKKKMRQFGKVEIPQEAFIAALKMDD 607


>gi|114328171|ref|YP_745328.1| GTP-binding protein LepA [Granulibacter bethesdensis CGDNIH1]
 gi|114316345|gb|ABI62405.1| GTP-binding protein lepA [Granulibacter bethesdensis CGDNIH1]
          Length = 638

 Score =  853 bits (2204), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 400/599 (66%), Positives = 489/599 (81%), Gaps = 2/599 (0%)

Query: 7   PLSRIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTV 66
           P+ RIRNFSI+AHIDHGKSTLADR IQ    L++REM++QVLDNM++ERERGITIKAQTV
Sbjct: 42  PIDRIRNFSIIAHIDHGKSTLADRLIQLTGALSDREMTNQVLDNMELERERGITIKAQTV 101

Query: 67  RLNYTSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQA 126
           RL Y + D   Y LNL+DTPGHVDF YEVSRSL+ACEGSLLVVDA+QGVEAQTLANVYQA
Sbjct: 102 RLTYRAKDGLVYALNLMDTPGHVDFAYEVSRSLAACEGSLLVVDASQGVEAQTLANVYQA 161

Query: 127 IDNNHEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERIVQQ 186
           ID NHEI+ VLNK DLP+A+PDRVKKQIE+ IG+   DAL++SAKTG G+  +LE +V +
Sbjct: 162 IDANHEIVPVLNKVDLPAAEPDRVKKQIEDVIGLDASDALMISAKTGLGVDTVLEALVTR 221

Query: 187 LPSPTSPEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVERI 246
           LP+P     AN  LKALL+DSWY++YLGV++LVR+ +G L +GQ IR+M T A Y V+++
Sbjct: 222 LPAPKG--NANGELKALLVDSWYDAYLGVIILVRVKDGVLRRGQKIRMMSTGATYTVDQV 279

Query: 247 GILTPKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVVFC 306
           G+ +P+M  +E L PGE+G + A+IK V+ T VGDTITDD  P    L GFKP  PVV+C
Sbjct: 280 GVFSPRMTPVETLNPGEMGYINAAIKTVADTNVGDTITDDRVPAAEPLAGFKPSIPVVWC 339

Query: 307 GLFPVDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERLER 366
           GL+P+DA  FE LR ++ KLRLNDASF FE E S ALGFGFRCGFLGLLHLEIIQERL R
Sbjct: 340 GLYPIDADDFEKLRDSLGKLRLNDASFHFEAETSAALGFGFRCGFLGLLHLEIIQERLSR 399

Query: 367 EFSLNLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEYLGS 426
           EF L+LI T+PSVVY+L+  +G   +L NP DMP+ + I ++ EPWI+ TI+ P++YLG+
Sbjct: 400 EFDLDLIATAPSVVYKLHKTNGEHLELHNPADMPDGSVIEKIEEPWIKATIMVPDDYLGA 459

Query: 427 ILKLCQERRGIQIDMSHLDNRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDYRD 486
           IL LC ERRG Q+D++++ NRAM VY LPLNEV+FDFYDRLKSVS+GYASFDY +  Y +
Sbjct: 460 ILTLCSERRGQQVDLTYVGNRAMAVYRLPLNEVVFDFYDRLKSVSRGYASFDYQMDGYEE 519

Query: 487 SDLVKLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGGRII 546
           SDLV+++ILVN E +DALS + HRS +E RGR IC KLK LIP+Q+F+IAIQAAIG RII
Sbjct: 520 SDLVRISILVNAEAVDALSFIAHRSAAENRGRQICAKLKELIPRQLFKIAIQAAIGSRII 579

Query: 547 ARETVKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISILKTDN 605
           ARET+ A  KDVTAKCYGGDI+RKRKLLEKQKEGKKRMR+FG+V+IPQSAF++ LK DN
Sbjct: 580 ARETLGALSKDVTAKCYGGDISRKRKLLEKQKEGKKRMRQFGKVEIPQSAFLAALKMDN 638


>gi|119371354|sp|Q0BRZ7|LEPA_GRABC RecName: Full=Elongation factor 4; Short=EF-4; AltName:
           Full=Ribosomal back-translocase LepA
          Length = 601

 Score =  853 bits (2204), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 400/599 (66%), Positives = 489/599 (81%), Gaps = 2/599 (0%)

Query: 7   PLSRIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTV 66
           P+ RIRNFSI+AHIDHGKSTLADR IQ    L++REM++QVLDNM++ERERGITIKAQTV
Sbjct: 5   PIDRIRNFSIIAHIDHGKSTLADRLIQLTGALSDREMTNQVLDNMELERERGITIKAQTV 64

Query: 67  RLNYTSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQA 126
           RL Y + D   Y LNL+DTPGHVDF YEVSRSL+ACEGSLLVVDA+QGVEAQTLANVYQA
Sbjct: 65  RLTYRAKDGLVYALNLMDTPGHVDFAYEVSRSLAACEGSLLVVDASQGVEAQTLANVYQA 124

Query: 127 IDNNHEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERIVQQ 186
           ID NHEI+ VLNK DLP+A+PDRVKKQIE+ IG+   DAL++SAKTG G+  +LE +V +
Sbjct: 125 IDANHEIVPVLNKVDLPAAEPDRVKKQIEDVIGLDASDALMISAKTGLGVDTVLEALVTR 184

Query: 187 LPSPTSPEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVERI 246
           LP+P     AN  LKALL+DSWY++YLGV++LVR+ +G L +GQ IR+M T A Y V+++
Sbjct: 185 LPAPKG--NANGELKALLVDSWYDAYLGVIILVRVKDGVLRRGQKIRMMSTGATYTVDQV 242

Query: 247 GILTPKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVVFC 306
           G+ +P+M  +E L PGE+G + A+IK V+ T VGDTITDD  P    L GFKP  PVV+C
Sbjct: 243 GVFSPRMTPVETLNPGEMGYINAAIKTVADTNVGDTITDDRVPAAEPLAGFKPSIPVVWC 302

Query: 307 GLFPVDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERLER 366
           GL+P+DA  FE LR ++ KLRLNDASF FE E S ALGFGFRCGFLGLLHLEIIQERL R
Sbjct: 303 GLYPIDADDFEKLRDSLGKLRLNDASFHFEAETSAALGFGFRCGFLGLLHLEIIQERLSR 362

Query: 367 EFSLNLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEYLGS 426
           EF L+LI T+PSVVY+L+  +G   +L NP DMP+ + I ++ EPWI+ TI+ P++YLG+
Sbjct: 363 EFDLDLIATAPSVVYKLHKTNGEHLELHNPADMPDGSVIEKIEEPWIKATIMVPDDYLGA 422

Query: 427 ILKLCQERRGIQIDMSHLDNRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDYRD 486
           IL LC ERRG Q+D++++ NRAM VY LPLNEV+FDFYDRLKSVS+GYASFDY +  Y +
Sbjct: 423 ILTLCSERRGQQVDLTYVGNRAMAVYRLPLNEVVFDFYDRLKSVSRGYASFDYQMDGYEE 482

Query: 487 SDLVKLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGGRII 546
           SDLV+++ILVN E +DALS + HRS +E RGR IC KLK LIP+Q+F+IAIQAAIG RII
Sbjct: 483 SDLVRISILVNAEAVDALSFIAHRSAAENRGRQICAKLKELIPRQLFKIAIQAAIGSRII 542

Query: 547 ARETVKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISILKTDN 605
           ARET+ A  KDVTAKCYGGDI+RKRKLLEKQKEGKKRMR+FG+V+IPQSAF++ LK DN
Sbjct: 543 ARETLGALSKDVTAKCYGGDISRKRKLLEKQKEGKKRMRQFGKVEIPQSAFLAALKMDN 601


>gi|83954626|ref|ZP_00963337.1| GTP-binding protein LepA [Sulfitobacter sp. NAS-14.1]
 gi|83840910|gb|EAP80081.1| GTP-binding protein LepA [Sulfitobacter sp. NAS-14.1]
          Length = 599

 Score =  853 bits (2203), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 397/600 (66%), Positives = 500/600 (83%), Gaps = 2/600 (0%)

Query: 6   TPLSRIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQT 65
           TPLS IRNFSIVAHIDHGKSTLADR IQ    ++ R+M +Q+LD+MDIERERGITIKAQT
Sbjct: 2   TPLSHIRNFSIVAHIDHGKSTLADRLIQETNTVSLRDMKAQMLDSMDIERERGITIKAQT 61

Query: 66  VRLNYTSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQ 125
           VR+NYT+ + ++Y LNLIDTPGHVDF YEVSRS+ A EGSLLVVD+TQGVEAQTLANVY 
Sbjct: 62  VRINYTAQNGEEYILNLIDTPGHVDFAYEVSRSMRAVEGSLLVVDSTQGVEAQTLANVYH 121

Query: 126 AIDNNHEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERIVQ 185
           AID +HEI+ VLNK DLP++D DRV +QIE+ IGI   +A+ VSAKTG+GI   LE IV 
Sbjct: 122 AIDADHEIVPVLNKIDLPASDCDRVAEQIEDVIGIDASEAIRVSAKTGQGIVETLEAIVH 181

Query: 186 QLPSPTSPEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVER 245
           +LP+PT  +  +APLKA+L+DSWY+SYLGV+VLVRI++GQL KG  IR+M   + + V+R
Sbjct: 182 KLPAPTGTQ--DAPLKAMLVDSWYDSYLGVIVLVRIMDGQLKKGDRIRMMQNGSVHHVDR 239

Query: 246 IGILTPKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVVF 305
           IG+  P M +I++L PGEIG + ASIK+V  TRVGDTIT +   T + LPGFKP QPVVF
Sbjct: 240 IGVFRPAMTEIDSLNPGEIGFLTASIKQVRDTRVGDTITHEKKGTETPLPGFKPAQPVVF 299

Query: 306 CGLFPVDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERLE 365
           CGLFPVDA +FE+LR +I KL LNDASFSFE+E S ALGFGFRCGFLGLLHLE+I++R+E
Sbjct: 300 CGLFPVDAAEFEDLRDSIEKLALNDASFSFEMETSAALGFGFRCGFLGLLHLEVIRDRIE 359

Query: 366 REFSLNLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEYLG 425
           RE+ ++LI T+PSV+Y+++M DG++++L NP DMP++T +  + EP I+ TI+ P++YLG
Sbjct: 360 REYDIDLITTAPSVIYDIHMKDGTVEQLHNPADMPDLTFVDHIEEPRIKATILVPDDYLG 419

Query: 426 SILKLCQERRGIQIDMSHLDNRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDYR 485
            +LKLCQ+RRGIQ+D+++  +RAM+VY+LPLNEV+FDFYDRLKSV+KGYASFDY +I YR
Sbjct: 420 DVLKLCQDRRGIQMDLTYAGSRAMVVYDLPLNEVVFDFYDRLKSVTKGYASFDYQMIGYR 479

Query: 486 DSDLVKLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGGRI 545
              LVK++ILVN+E +DALS +VHR  +E RGR + EKLK+LIP+ MF+I IQAAIGG++
Sbjct: 480 QDALVKMSILVNDEPVDALSTMVHRDRAEMRGRAMVEKLKDLIPRHMFKIPIQAAIGGKV 539

Query: 546 IARETVKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISILKTDN 605
           IARET+ A RKDVTAKCYGGD +RKRKLL+KQK GKK+MR+FG+VDIPQ AFIS LK D+
Sbjct: 540 IARETLSAMRKDVTAKCYGGDASRKRKLLDKQKAGKKKMRQFGKVDIPQEAFISALKMDS 599


>gi|99080519|ref|YP_612673.1| GTP-binding protein LepA [Ruegeria sp. TM1040]
 gi|119371396|sp|Q1GIV5|LEPA_SILST RecName: Full=Elongation factor 4; Short=EF-4; AltName:
           Full=Ribosomal back-translocase LepA
 gi|99036799|gb|ABF63411.1| GTP-binding protein LepA [Ruegeria sp. TM1040]
          Length = 599

 Score =  853 bits (2203), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 403/600 (67%), Positives = 495/600 (82%), Gaps = 2/600 (0%)

Query: 6   TPLSRIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQT 65
           T LS+IRNFSIVAHIDHGKSTLADR IQ    + +R+M  Q+LD MDIERERGITIKA T
Sbjct: 2   TELSKIRNFSIVAHIDHGKSTLADRLIQSTGTVQDRDMKEQLLDAMDIERERGITIKANT 61

Query: 66  VRLNYTSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQ 125
           VR++Y + D + Y LNLIDTPGHVDF YEVSRS+ A EGSLLVVD+TQGVEAQTLANVYQ
Sbjct: 62  VRIDYEADDGERYVLNLIDTPGHVDFAYEVSRSMRAVEGSLLVVDSTQGVEAQTLANVYQ 121

Query: 126 AIDNNHEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERIVQ 185
           AID +HEI+ VLNK DLP+AD DRV +QIE+ IGI   DA+ VSAKTG GI   LE IV+
Sbjct: 122 AIDADHEIVPVLNKIDLPAADCDRVAEQIEDVIGIDATDAIRVSAKTGIGIKDTLEAIVK 181

Query: 186 QLPSPTSPEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVER 245
           +LP+PT     NAPLKA+L+DSWY++YLGV+VLVRI++G L KG  I++M TNA+Y V+R
Sbjct: 182 RLPAPTGER--NAPLKAMLVDSWYDAYLGVIVLVRIMDGVLKKGDQIKMMQTNARYGVDR 239

Query: 246 IGILTPKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVVF 305
           IG+  P M  ++ L PGEIG + ASIK+V  T+VGDTIT D     +ALPGFKP  PVVF
Sbjct: 240 IGVFRPAMQVVDELGPGEIGFITASIKQVRDTKVGDTITHDKKGAETALPGFKPSVPVVF 299

Query: 306 CGLFPVDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERLE 365
           CGLFPVD+++FE+LR AI KL LNDASFS+E+E S ALGFGFRCGFLGLLHLE+I++R+E
Sbjct: 300 CGLFPVDSSEFEDLRDAIEKLALNDASFSYEMETSAALGFGFRCGFLGLLHLEVIRDRIE 359

Query: 366 REFSLNLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEYLG 425
           RE+++ LI T+PSVVY ++M DG M +L NP DMP+++K+  L EP I+ TI+ P+EYLG
Sbjct: 360 REYNIELITTAPSVVYHIFMKDGEMLELHNPADMPDLSKVDHLEEPRIKATILVPDEYLG 419

Query: 426 SILKLCQERRGIQIDMSHLDNRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDYR 485
            +LKLCQ+RRGIQ D+S+  +RAM+VY+LPLNEV+FDFYDRLKSV+KGYASFDY +I YR
Sbjct: 420 DVLKLCQDRRGIQQDLSYAGSRAMVVYDLPLNEVVFDFYDRLKSVTKGYASFDYQMIGYR 479

Query: 486 DSDLVKLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGGRI 545
             +LVK+++LVN+E +DALS +VHR  +E+RGR +CEKLK+LIP+ MF+I IQAAIGG++
Sbjct: 480 ADNLVKMSVLVNDEPVDALSTMVHRDRAEQRGRAMCEKLKDLIPRHMFKIPIQAAIGGKV 539

Query: 546 IARETVKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISILKTDN 605
           IARET+ A RKDVTAKCYGGD TRKRKLLEKQK GKK+MR+FGRV+IPQ AFIS LK D+
Sbjct: 540 IARETLSALRKDVTAKCYGGDATRKRKLLEKQKAGKKKMRQFGRVEIPQEAFISALKMDD 599


>gi|83943643|ref|ZP_00956101.1| GTP-binding protein LepA [Sulfitobacter sp. EE-36]
 gi|83845323|gb|EAP83202.1| GTP-binding protein LepA [Sulfitobacter sp. EE-36]
          Length = 599

 Score =  852 bits (2201), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 397/600 (66%), Positives = 499/600 (83%), Gaps = 2/600 (0%)

Query: 6   TPLSRIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQT 65
           TPLS IRNFSIVAHIDHGKSTLADR IQ    ++ R+M +Q+LD+MDIERERGITIKAQT
Sbjct: 2   TPLSHIRNFSIVAHIDHGKSTLADRLIQETNTVSLRDMKAQMLDSMDIERERGITIKAQT 61

Query: 66  VRLNYTSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQ 125
           VR+NYT+ + ++Y LNLIDTPGHVDF YEVSRS+ A EGSLLVVD+TQGVEAQTLANVY 
Sbjct: 62  VRINYTAQNGEEYILNLIDTPGHVDFAYEVSRSMRAVEGSLLVVDSTQGVEAQTLANVYH 121

Query: 126 AIDNNHEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERIVQ 185
           AID +HEI+ VLNK DLP++D DRV +QIE+ IGI   +A+ VSAKTG+GI   LE IV 
Sbjct: 122 AIDADHEIVPVLNKIDLPASDCDRVAEQIEDVIGIDASEAIRVSAKTGQGIVETLEAIVH 181

Query: 186 QLPSPTSPEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVER 245
           +LP+P   +  +APLKA+L+DSWY+SYLGV+VLVRI++GQL KG  IR+M   + + V+R
Sbjct: 182 KLPAPKGTQ--DAPLKAMLVDSWYDSYLGVIVLVRIMDGQLKKGDRIRMMQNGSVHHVDR 239

Query: 246 IGILTPKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVVF 305
           IG+  P M +I++L PGEIG + ASIK+V  TRVGDTIT +   T + LPGFKP QPVVF
Sbjct: 240 IGVFRPAMTEIDSLNPGEIGFLTASIKQVRDTRVGDTITHEKKGTETPLPGFKPAQPVVF 299

Query: 306 CGLFPVDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERLE 365
           CGLFPVDA +FE+LR +I KL LNDASFSFE+E S ALGFGFRCGFLGLLHLE+I++R+E
Sbjct: 300 CGLFPVDAAEFEDLRDSIEKLALNDASFSFEMETSAALGFGFRCGFLGLLHLEVIRDRIE 359

Query: 366 REFSLNLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEYLG 425
           RE+ ++LI T+PSV+Y+++M DG++++L NP DMP++T +  + EP I+ TI+ P+EYLG
Sbjct: 360 REYDIDLITTAPSVIYDIHMKDGTVEQLHNPADMPDLTFVDHIEEPRIKATILVPDEYLG 419

Query: 426 SILKLCQERRGIQIDMSHLDNRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDYR 485
            +LKLCQ+RRGIQ+D+++  +RAM+VY+LPLNEV+FDFYDRLKSV+KGYASFDY +I YR
Sbjct: 420 DVLKLCQDRRGIQMDLTYAGSRAMVVYDLPLNEVVFDFYDRLKSVTKGYASFDYQMIGYR 479

Query: 486 DSDLVKLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGGRI 545
              LVK++ILVN+E +DALS +VHR  +E RGR + EKLK+LIP+ MF+I IQAAIGG++
Sbjct: 480 QDALVKMSILVNDEPVDALSTMVHRDRAEMRGRAMVEKLKDLIPRHMFKIPIQAAIGGKV 539

Query: 546 IARETVKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISILKTDN 605
           IARET+ A RKDVTAKCYGGD +RKRKLL+KQK GKK+MR+FG+VDIPQ AFIS LK D+
Sbjct: 540 IARETLSAMRKDVTAKCYGGDASRKRKLLDKQKAGKKKMRQFGKVDIPQEAFISALKMDS 599


>gi|163732729|ref|ZP_02140174.1| GTP-binding protein LepA [Roseobacter litoralis Och 149]
 gi|161394089|gb|EDQ18413.1| GTP-binding protein LepA [Roseobacter litoralis Och 149]
          Length = 599

 Score =  851 bits (2198), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 401/600 (66%), Positives = 491/600 (81%), Gaps = 2/600 (0%)

Query: 6   TPLSRIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQT 65
           TPLS IRNFSIVAHIDHGKSTLADR IQ    + +R+M  Q+LD+MDIERERGITIKAQT
Sbjct: 2   TPLSHIRNFSIVAHIDHGKSTLADRLIQSTNTVADRDMKEQMLDSMDIERERGITIKAQT 61

Query: 66  VRLNYTSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQ 125
           VR+NYT+ + ++Y LNLIDTPGHVDF YEVSRS+ A EGSLLVVD+TQGVEAQTLANVY 
Sbjct: 62  VRINYTAQNGEEYVLNLIDTPGHVDFAYEVSRSMRAVEGSLLVVDSTQGVEAQTLANVYH 121

Query: 126 AIDNNHEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERIVQ 185
           AID +HEI+ VLNK DLP++D DRV +QIE+ IGI    A+ VSAKTG+GI   LE IVQ
Sbjct: 122 AIDADHEIVPVLNKIDLPASDCDRVAEQIEDVIGIDASGAIQVSAKTGQGIMETLESIVQ 181

Query: 186 QLPSPTSPEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVER 245
            LP+P      +APLKA+L+DSWY+SYLGV+VLVRI++G L KG  IR++  N+ + V+R
Sbjct: 182 NLPAPKGTR--DAPLKAMLVDSWYDSYLGVIVLVRIMDGVLKKGDRIRMLSNNSTHGVDR 239

Query: 246 IGILTPKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVVF 305
           IG+  P M +I+ L PGEIG + ASIK+V  TRVGDTIT +   TT ALPGFKP QPVVF
Sbjct: 240 IGVFRPAMTEIDELGPGEIGFLTASIKQVRDTRVGDTITHEKKGTTDALPGFKPAQPVVF 299

Query: 306 CGLFPVDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERLE 365
           CGLFPVD+++FE LR +I KL LNDASFS+E+E S ALGFGFRCGFLGLLHLE+I++R+E
Sbjct: 300 CGLFPVDSSEFEELRDSIEKLALNDASFSYEMETSAALGFGFRCGFLGLLHLEVIRDRIE 359

Query: 366 REFSLNLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEYLG 425
           RE+ + LI T+PSV+Y +YM DGSM +L NP DMP++T +  L EP I+ TI+ P++YLG
Sbjct: 360 REYDIELITTAPSVIYHVYMKDGSMIELHNPADMPDLTLVDHLEEPRIKATILVPDDYLG 419

Query: 426 SILKLCQERRGIQIDMSHLDNRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDYR 485
            +LKLCQ+RRGIQ D+++  +RAM+VY+LPLNEV+FDFYDRLKSV+KGYASFDY +I YR
Sbjct: 420 DVLKLCQDRRGIQQDLTYAGSRAMVVYDLPLNEVVFDFYDRLKSVTKGYASFDYAMIGYR 479

Query: 486 DSDLVKLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGGRI 545
              LVK++ILVN+E +DALS +VHR  +E RGR + EKLK+LIP+ MF+I IQAAIGG++
Sbjct: 480 TDSLVKMSILVNDEPVDALSTMVHRDRAEGRGRAMVEKLKDLIPRHMFKIPIQAAIGGKV 539

Query: 546 IARETVKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISILKTDN 605
           IARET+ A RKDVTAKCYGGD TRKRKLL+KQK GKK+MR+FG+VDIPQ AFIS LK D 
Sbjct: 540 IARETLSAMRKDVTAKCYGGDATRKRKLLDKQKAGKKKMRQFGKVDIPQEAFISALKMDG 599


>gi|148260281|ref|YP_001234408.1| GTP-binding protein LepA [Acidiphilium cryptum JF-5]
 gi|326403466|ref|YP_004283547.1| GTP-binding protein LepA [Acidiphilium multivorum AIU301]
 gi|166223160|sp|A5FY07|LEPA_ACICJ RecName: Full=Elongation factor 4; Short=EF-4; AltName:
           Full=Ribosomal back-translocase LepA
 gi|146401962|gb|ABQ30489.1| GTP-binding protein LepA [Acidiphilium cryptum JF-5]
 gi|325050327|dbj|BAJ80665.1| GTP-binding protein LepA [Acidiphilium multivorum AIU301]
          Length = 601

 Score =  850 bits (2195), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 399/599 (66%), Positives = 486/599 (81%), Gaps = 2/599 (0%)

Query: 6   TPLSRIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQT 65
           TP   IRNFSI+AHIDHGKSTLADR IQ    L+ REM+ QVLDNMDIE+ERGITIKAQT
Sbjct: 4   TPTELIRNFSIIAHIDHGKSTLADRLIQTTGALSAREMTEQVLDNMDIEKERGITIKAQT 63

Query: 66  VRLNYTSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQ 125
           VRLNY + D K Y LNL+DTPGHVDF YEVSRSL+ACEGSLLVVDA+QGVEAQTLANVYQ
Sbjct: 64  VRLNYKAKDGKTYVLNLMDTPGHVDFAYEVSRSLAACEGSLLVVDASQGVEAQTLANVYQ 123

Query: 126 AIDNNHEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERIVQ 185
           AID NHEI+ VLNK DLP+A+P+RVK+QIE+ IG+   DA+ +SAKTG  I  +LE +V 
Sbjct: 124 AIDANHEIVPVLNKIDLPAAEPERVKQQIEDVIGLDASDAVEISAKTGLNIEAVLEALVT 183

Query: 186 QLPSPTSPEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVER 245
           +LP P   E   APLKA+L+DSWY+SYLGV++LVR+ +G+L KGQ +R+M T A + +++
Sbjct: 184 RLPPPKGDE--TAPLKAMLVDSWYDSYLGVIILVRVRDGRLRKGQRVRMMSTGAVHTIDQ 241

Query: 246 IGILTPKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVVF 305
           +G  +PK+     L PGEIG + A+IK V+   VGDTITDD +P T  LPGFKP  PVV+
Sbjct: 242 VGTFSPKLTPQADLGPGEIGYITAAIKTVADCNVGDTITDDRAPATEPLPGFKPSIPVVW 301

Query: 306 CGLFPVDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERLE 365
           CGL+PVDA  FE LR ++ KLRLNDASF +E E S ALGFGFRCGFLGLLHLEIIQERL 
Sbjct: 302 CGLYPVDADDFEKLRDSLAKLRLNDASFHYEAETSAALGFGFRCGFLGLLHLEIIQERLS 361

Query: 366 REFSLNLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEYLG 425
           REF L+LI T+PSVVY LY   G M +L NP DMP+ + I  + EPWI+ TI+ P++YLG
Sbjct: 362 REFDLDLIATAPSVVYRLYKTSGEMMELHNPADMPDGSVIDHIEEPWIRATIMVPDDYLG 421

Query: 426 SILKLCQERRGIQIDMSHLDNRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDYR 485
           ++L LC ERRG Q+D++++ NRAM VY LPLNEV+FDFYDRLKSVS+GYASFDY + DY 
Sbjct: 422 AVLTLCNERRGQQVDLTYVGNRAMAVYRLPLNEVVFDFYDRLKSVSRGYASFDYQMDDYV 481

Query: 486 DSDLVKLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGGRI 545
           + DLVK++ILVN E +DAL+ + HRSV++ RGR IC KLK+LIP+Q+F+IAIQAAIGGR+
Sbjct: 482 EGDLVKISILVNQEPVDALAFIAHRSVADTRGRAICAKLKDLIPRQLFKIAIQAAIGGRV 541

Query: 546 IARETVKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISILKTD 604
           IARET+ A  KDVTAKCYGGDI+RKRKLLEKQKEGKKRMR+FG+V+IPQ+AF++ LK D
Sbjct: 542 IARETLGALSKDVTAKCYGGDISRKRKLLEKQKEGKKRMRQFGKVEIPQTAFLAALKMD 600


>gi|304320378|ref|YP_003854021.1| GTP-binding protein LepA [Parvularcula bermudensis HTCC2503]
 gi|303299280|gb|ADM08879.1| GTP-binding protein LepA [Parvularcula bermudensis HTCC2503]
          Length = 599

 Score =  850 bits (2195), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 407/600 (67%), Positives = 494/600 (82%), Gaps = 2/600 (0%)

Query: 6   TPLSRIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQT 65
           T LS IRNFSIVAHIDHGKSTLADR IQ   GL++REM  QVLDNM++ERERGITIKAQT
Sbjct: 2   TDLSHIRNFSIVAHIDHGKSTLADRLIQVTGGLSDREMKEQVLDNMELERERGITIKAQT 61

Query: 66  VRLNYTSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQ 125
           V L+YT+ + K YQLNLIDTPGHVDF YEV+RSL+A EGSLLVVDA+QGVEAQTLANVYQ
Sbjct: 62  VSLSYTARNGKTYQLNLIDTPGHVDFAYEVNRSLAAVEGSLLVVDASQGVEAQTLANVYQ 121

Query: 126 AIDNNHEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERIVQ 185
           AI+ +HEI+ VLNK DLP+A+P+R+K+QIE+ IG+   +A+L+SAKTG GI  +LE IV 
Sbjct: 122 AIEVDHEIVPVLNKIDLPAAEPERIKEQIEDVIGLDASEAVLISAKTGLGIEDVLEAIVN 181

Query: 186 QLPSPTSPEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVER 245
           +LP P       A LKA+L+DSWY+ YLGV+VLVR+++G L KGQ IR+M   A Y V+ 
Sbjct: 182 RLPPPEGDR--EAALKAMLVDSWYDPYLGVVVLVRVVDGSLKKGQRIRMMAAKATYTVDN 239

Query: 246 IGILTPKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVVF 305
           +G  TP    +E L PGEIG + ASIKEV+ T VGDTITD+  P  +ALPGF+P QPVVF
Sbjct: 240 VGKFTPHRQMVETLGPGEIGFITASIKEVADTNVGDTITDEKRPAETALPGFRPSQPVVF 299

Query: 306 CGLFPVDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERLE 365
           CGLFPVD+ +FE+LR AI KLRLNDASF FE+E S ALGFGFRCGFLGLLHLEII+ERLE
Sbjct: 300 CGLFPVDSAEFEDLRDAIGKLRLNDASFEFEMETSAALGFGFRCGFLGLLHLEIIRERLE 359

Query: 366 REFSLNLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEYLG 425
           REF+++LI T+PSVVY +Y  DG M++L NP DMP+   I  + EPWI+ TI+ P++YLG
Sbjct: 360 REFNIDLITTAPSVVYHMYRTDGEMEELHNPADMPDPVHIDHIEEPWIKATILVPDDYLG 419

Query: 426 SILKLCQERRGIQIDMSHLDNRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDYR 485
           ++LKLC+ERRGIQ D+++  NRAM+VYELPLNEV+FDFYDRLKS++KGYASFDY +I YR
Sbjct: 420 AVLKLCEERRGIQQDLTYAGNRAMVVYELPLNEVVFDFYDRLKSITKGYASFDYQIIGYR 479

Query: 486 DSDLVKLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGGRI 545
             DLV++ ILVN E +DAL+I+VHRS +E RGR +CEKLK LIP+ +F+I IQAAIGGR+
Sbjct: 480 QDDLVRMQILVNEEPVDALAIIVHRSKAEARGRVMCEKLKELIPRHLFKIPIQAAIGGRV 539

Query: 546 IARETVKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISILKTDN 605
           IARET+ A RKDVTAKCYGGD TRKRKLLEKQK GKK+MR+FGRV+IPQ AFI+ LK D+
Sbjct: 540 IARETIGAMRKDVTAKCYGGDATRKRKLLEKQKAGKKKMRQFGRVEIPQDAFINALKMDS 599


>gi|159043361|ref|YP_001532155.1| GTP-binding protein LepA [Dinoroseobacter shibae DFL 12]
 gi|189046438|sp|A8LR11|LEPA_DINSH RecName: Full=Elongation factor 4; Short=EF-4; AltName:
           Full=Ribosomal back-translocase LepA
 gi|157911121|gb|ABV92554.1| GTP-binding protein LepA [Dinoroseobacter shibae DFL 12]
          Length = 599

 Score =  849 bits (2193), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 397/600 (66%), Positives = 489/600 (81%), Gaps = 2/600 (0%)

Query: 6   TPLSRIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQT 65
           T LSRIRNFSIVAHIDHGKSTLADR IQ    ++ R+M  Q+LD MDIERERGITIKA T
Sbjct: 2   TELSRIRNFSIVAHIDHGKSTLADRLIQETNTVSARDMKEQLLDAMDIERERGITIKANT 61

Query: 66  VRLNYTSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQ 125
           VR++YT+ D +DY LNLIDTPGHVDF YEVSRS+ A EGSLLVVD+TQGVEAQTLANVYQ
Sbjct: 62  VRIDYTADDGQDYVLNLIDTPGHVDFAYEVSRSMRAVEGSLLVVDSTQGVEAQTLANVYQ 121

Query: 126 AIDNNHEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERIVQ 185
           AID +HEI+ VLNK DLP++D DRV +QIE+ IGI    A+ VSAKTG+GI   LE IV 
Sbjct: 122 AIDADHEIVPVLNKIDLPASDCDRVAEQIEDVIGIDASGAIRVSAKTGQGIHETLEAIVH 181

Query: 186 QLPSPTSPEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVER 245
            LP+P      +APLKA+L+DSWY++YLGV+VLVRII+G L KG+ I++M     + V+R
Sbjct: 182 HLPAPKGTR--DAPLKAMLVDSWYDAYLGVIVLVRIIDGTLRKGERIKMMSNGTVHHVDR 239

Query: 246 IGILTPKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVVF 305
           IG+  P M  ++ L PGEIG + ASIK+V  TRVGDTIT +     +ALPGFKP QPVVF
Sbjct: 240 IGVFRPAMQPVDELGPGEIGFLTASIKQVRDTRVGDTITHEKKGAETALPGFKPSQPVVF 299

Query: 306 CGLFPVDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERLE 365
           CGLFPVD+ +FE+LR AI KL LNDASFS+E+E S ALGFGFRCGFLGLLHLE+I++R+E
Sbjct: 300 CGLFPVDSAEFEDLRDAIEKLALNDASFSYEMETSAALGFGFRCGFLGLLHLEVIRDRIE 359

Query: 366 REFSLNLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEYLG 425
           RE+ + LI T+PSV+Y +YM DG+M++L NP DMP++T +  L EP I+ TI+ P++YLG
Sbjct: 360 REYDIELITTAPSVIYHVYMRDGTMRELHNPADMPDLTHVDHLEEPRIKATILVPDDYLG 419

Query: 426 SILKLCQERRGIQIDMSHLDNRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDYR 485
            +LKLCQ+RRGIQ+D+++  +RAM+VY+LPLNEV+FDFYDRLKSV+KGYASFDY +I YR
Sbjct: 420 DVLKLCQDRRGIQMDLTYAGSRAMVVYDLPLNEVVFDFYDRLKSVTKGYASFDYQMIGYR 479

Query: 486 DSDLVKLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGGRI 545
             +LVK+ +LVN+E +DALS +VHR  +E RGR +CEKLK+LIP+ MF+I IQAAIGG++
Sbjct: 480 QDNLVKMQVLVNDEPVDALSTMVHRDRAEARGRAMCEKLKDLIPRHMFKIPIQAAIGGKV 539

Query: 546 IARETVKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISILKTDN 605
           IARET+ A RKDVTAKCYGGD TRKRKLL+KQK GKK+MR+FG+VDIPQ AFIS LK D 
Sbjct: 540 IARETLSALRKDVTAKCYGGDATRKRKLLDKQKAGKKKMRQFGKVDIPQEAFISALKMDG 599


>gi|162147311|ref|YP_001601772.1| GTP-binding protein LepA [Gluconacetobacter diazotrophicus PAl 5]
 gi|209544356|ref|YP_002276585.1| GTP-binding protein LepA [Gluconacetobacter diazotrophicus PAl 5]
 gi|189046443|sp|A9HG78|LEPA_GLUDA RecName: Full=Elongation factor 4; Short=EF-4; AltName:
           Full=Ribosomal back-translocase LepA
 gi|161785888|emb|CAP55459.1| GTP-binding protein lepA [Gluconacetobacter diazotrophicus PAl 5]
 gi|209532033|gb|ACI51970.1| GTP-binding protein LepA [Gluconacetobacter diazotrophicus PAl 5]
          Length = 601

 Score =  848 bits (2191), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 398/600 (66%), Positives = 488/600 (81%), Gaps = 2/600 (0%)

Query: 6   TPLSRIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQT 65
           TPLS IRNFSI+AHIDHGKSTLADR IQ C  LT REM++QVLDNM++ERERGITIKAQT
Sbjct: 4   TPLSLIRNFSIIAHIDHGKSTLADRLIQACGALTAREMTNQVLDNMELERERGITIKAQT 63

Query: 66  VRLNYTSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQ 125
           VRL+Y + D K Y LNL+DTPGHVDF YEVSRSL+ACEGSLLVVDA+QGVEAQTLANVYQ
Sbjct: 64  VRLSYPAKDGKTYVLNLMDTPGHVDFAYEVSRSLAACEGSLLVVDASQGVEAQTLANVYQ 123

Query: 126 AIDNNHEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERIVQ 185
           AID NHEI+ VLNK DLP+A+P+RVK QIEE IGI  +DA+ +SAKTG  I  +LE +V 
Sbjct: 124 AIDANHEIVPVLNKVDLPAAEPERVKAQIEEVIGIPADDAVEISAKTGLNIEGVLEALVT 183

Query: 186 QLPSPTSPEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVER 245
           +LP P   E  + PL+ALL+DSWY+ YLGV++LVRI  G+L KG  IR+M   A Y V++
Sbjct: 184 RLPPPVGDE--SKPLQALLVDSWYDPYLGVIILVRIKEGRLRKGSRIRMMSNGAVYHVDQ 241

Query: 246 IGILTPKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVVF 305
           +G+  P+M+ ++ L PGE+G + A+IK V+   VGDTITDD  P   AL GFKP  PVV+
Sbjct: 242 VGVFAPRMVPVDDLGPGEMGYINAAIKTVADCNVGDTITDDRHPAERALAGFKPSIPVVW 301

Query: 306 CGLFPVDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERLE 365
           CGL+P+DA  FE LR +++KLRLNDASF +E E S ALGFGFRCGFLGLLHLEIIQERL 
Sbjct: 302 CGLYPIDADDFEKLRDSLSKLRLNDASFHYEAETSAALGFGFRCGFLGLLHLEIIQERLS 361

Query: 366 REFSLNLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEYLG 425
           REF+L+LI T+PSVVY LY  +G M++L NP DMP+ + + ++ EPWI  TI+ P++YLG
Sbjct: 362 REFNLDLIATAPSVVYRLYRTNGGMEELHNPADMPDGSVVEKIEEPWITATIMVPDDYLG 421

Query: 426 SILKLCQERRGIQIDMSHLDNRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDYR 485
           ++L LC ERRGIQ D++++  RAM VY LPLNEV+FDFYDRLKSVS+GYASFDY +  Y 
Sbjct: 422 AVLTLCSERRGIQKDLTYVGTRAMAVYRLPLNEVVFDFYDRLKSVSRGYASFDYQMDGYE 481

Query: 486 DSDLVKLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGGRI 545
           +SDLV+++ILVN E +DAL+ + HRS +E RGR IC KLK LIP+Q+F+IAIQAAIG R+
Sbjct: 482 ESDLVRISILVNQEPVDALAFIAHRSAAESRGRSICAKLKELIPRQLFKIAIQAAIGSRV 541

Query: 546 IARETVKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISILKTDN 605
           IARET+ A  KDVTAKCYGGDI+RKRKLLEKQKEGKKRMR+FG+V+IPQSAF++ LK D+
Sbjct: 542 IARETIGALSKDVTAKCYGGDISRKRKLLEKQKEGKKRMRQFGKVEIPQSAFLAALKMDH 601


>gi|110678419|ref|YP_681426.1| GTP-binding protein LepA [Roseobacter denitrificans OCh 114]
 gi|119371389|sp|Q16BA3|LEPA_ROSDO RecName: Full=Elongation factor 4; Short=EF-4; AltName:
           Full=Ribosomal back-translocase LepA
 gi|109454535|gb|ABG30740.1| GTP-binding protein LepA [Roseobacter denitrificans OCh 114]
          Length = 599

 Score =  848 bits (2191), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 400/600 (66%), Positives = 492/600 (82%), Gaps = 2/600 (0%)

Query: 6   TPLSRIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQT 65
           TPLS IRNFSIVAHIDHGKSTLADR IQ    + +R+M  Q+LD+MDIERERGITIKAQT
Sbjct: 2   TPLSHIRNFSIVAHIDHGKSTLADRLIQSTNTVADRDMKEQMLDSMDIERERGITIKAQT 61

Query: 66  VRLNYTSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQ 125
           VR+NYT+ + ++Y LNLIDTPGHVDF YEVSRS+ A EGSLLVVD+TQGVEAQTLANVY 
Sbjct: 62  VRINYTAQNGEEYVLNLIDTPGHVDFAYEVSRSMRAVEGSLLVVDSTQGVEAQTLANVYH 121

Query: 126 AIDNNHEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERIVQ 185
           AID +HEI+ VLNK DLP++D DRV +QIE+ IGI    A+ VSAKTG+GI   LE IVQ
Sbjct: 122 AIDADHEIVPVLNKIDLPASDCDRVAEQIEDVIGIDASGAIQVSAKTGQGIMETLESIVQ 181

Query: 186 QLPSPTSPEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVER 245
            LP+P      +APLKA+L+DSWY+SYLGV+VLVRI++G L KG  IR++  N+ + V+R
Sbjct: 182 NLPAPKGDR--DAPLKAMLVDSWYDSYLGVIVLVRIMDGVLKKGDRIRMLSNNSTHNVDR 239

Query: 246 IGILTPKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVVF 305
           IG+  P+M  I+ L PGEIG + ASIK+V  TRVGDTIT +   T  ALPGFKP QPVVF
Sbjct: 240 IGVFRPEMTAIDELGPGEIGFLTASIKQVRDTRVGDTITHEKKGTEVALPGFKPSQPVVF 299

Query: 306 CGLFPVDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERLE 365
           CGLFPVD+++FE LR +I KL LNDASFS+E+E S ALGFGFRCGFLGLLHLE+I++R+E
Sbjct: 300 CGLFPVDSSEFEELRDSIEKLALNDASFSYEMETSAALGFGFRCGFLGLLHLEVIRDRIE 359

Query: 366 REFSLNLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEYLG 425
           RE+ + LI T+PSV+Y +YM DG+M +L NP DMP++T +  L EP I+ TI+ P++YLG
Sbjct: 360 REYDIELITTAPSVIYHVYMKDGAMIELHNPADMPDLTLVDHLEEPRIKATILVPDDYLG 419

Query: 426 SILKLCQERRGIQIDMSHLDNRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDYR 485
            +LKLCQ+RRGIQ D+++  +RAM+VY+LPLNEV+FDFYDRLKSV+KGYASFDY +I YR
Sbjct: 420 DVLKLCQDRRGIQQDLTYAGSRAMVVYDLPLNEVVFDFYDRLKSVTKGYASFDYAMIGYR 479

Query: 486 DSDLVKLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGGRI 545
             +LVK++ILVN+E +DALSI+VHR  +E RGR + EKLK+LIP+ MF+I IQAAIGG++
Sbjct: 480 TDNLVKMSILVNDEPVDALSIMVHRERAEGRGRAMVEKLKDLIPRHMFKIPIQAAIGGKV 539

Query: 546 IARETVKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISILKTDN 605
           IARET+ A RKDVTAKCYGGD TRKRKLL+KQK GKK+MR+FG+VDIPQ AFIS LK D 
Sbjct: 540 IARETLSAMRKDVTAKCYGGDATRKRKLLDKQKAGKKKMRQFGKVDIPQEAFISALKMDG 599


>gi|310816614|ref|YP_003964578.1| GTP-binding protein LepA [Ketogulonicigenium vulgare Y25]
 gi|308755349|gb|ADO43278.1| GTP-binding protein LepA [Ketogulonicigenium vulgare Y25]
          Length = 617

 Score =  848 bits (2190), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 399/610 (65%), Positives = 494/610 (80%), Gaps = 7/610 (1%)

Query: 1   MQKKP-----TPLSRIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIER 55
           MQ +P     T L  IRNFSIVAHIDHGKSTLADR IQ    +  R+M  Q+LD+MDIER
Sbjct: 10  MQIRPHSSAMTELDHIRNFSIVAHIDHGKSTLADRLIQETGTVAGRDMKEQLLDSMDIER 69

Query: 56  ERGITIKAQTVRLNYTSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGV 115
           ERGITIKA TVR++Y + + ++Y LNLIDTPGHVDF YEVSRS+ A EGSLLVVD+TQGV
Sbjct: 70  ERGITIKANTVRIDYKADNGENYVLNLIDTPGHVDFAYEVSRSMRAVEGSLLVVDSTQGV 129

Query: 116 EAQTLANVYQAIDNNHEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEG 175
           EAQTLANVYQA+D NHEI+ V NK DLP+++P RV  Q+E+ IGI + DA+LVSAKTG G
Sbjct: 130 EAQTLANVYQALDANHEIVPVFNKIDLPASEPARVAAQVEDVIGIDSSDAILVSAKTGVG 189

Query: 176 IPLLLERIVQQLPSPTSPEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLM 235
           I  +LE IV +LP+P      NAPLKA+L+DSWY+SYLGV+VL+R+++G + KG  IR+M
Sbjct: 190 IHEVLEAIVHRLPAPKG--DPNAPLKAMLVDSWYDSYLGVVVLIRVMDGTIKKGDRIRMM 247

Query: 236 GTNAKYQVERIGILTPKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALP 295
            TNA Y V+R+ +L P+M DI  L PGEIGV  ASIK+V  TRVGDTIT +   TT+ALP
Sbjct: 248 ATNAVYGVDRLAVLKPQMTDIAQLGPGEIGVFTASIKQVRDTRVGDTITHEKKGTTAALP 307

Query: 296 GFKPIQPVVFCGLFPVDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLL 355
           GFKP QPVVFCGLFPVD+ +FE+LR AI KL LNDASFS+E+E S ALGFGFRCGFLGLL
Sbjct: 308 GFKPAQPVVFCGLFPVDSAEFEDLRDAIEKLALNDASFSYEMETSAALGFGFRCGFLGLL 367

Query: 356 HLEIIQERLEREFSLNLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQV 415
           HLE+I++RLERE++++LI T+PSVVY L+M DG+   L NP DMP++T +  + EP I+ 
Sbjct: 368 HLEVIRDRLEREYNIDLITTAPSVVYHLFMRDGTQMDLHNPADMPDLTLVDHIEEPRIKA 427

Query: 416 TIITPNEYLGSILKLCQERRGIQIDMSHLDNRAMIVYELPLNEVIFDFYDRLKSVSKGYA 475
           TI+ P++YLG ILKLCQ+RRG+Q+D+S+  NRAM+VY+LPLNEV+FDFYDRLKSV+KGYA
Sbjct: 428 TIMVPDDYLGDILKLCQDRRGVQLDLSYAGNRAMVVYDLPLNEVVFDFYDRLKSVTKGYA 487

Query: 476 SFDYNVIDYRDSDLVKLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQI 535
           SFDY +  Y++  LVK++ILVN E +DALS++VHR  ++ RGR + EKLK LIP+ MF+I
Sbjct: 488 SFDYQLSGYQEDSLVKMSILVNEEPVDALSMMVHRDRADMRGRAMVEKLKELIPRHMFKI 547

Query: 536 AIQAAIGGRIIARETVKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQS 595
            IQAAIG ++IARET+ A RKDVTAKCYGGD TRKRKLL+KQK GKK+MR+FG+VDIPQ 
Sbjct: 548 PIQAAIGSKVIARETLSAMRKDVTAKCYGGDATRKRKLLDKQKAGKKKMRQFGKVDIPQE 607

Query: 596 AFISILKTDN 605
           AFIS LK D+
Sbjct: 608 AFISALKMDS 617


>gi|114769302|ref|ZP_01446928.1| GTP-binding protein LepA [alpha proteobacterium HTCC2255]
 gi|114550219|gb|EAU53100.1| GTP-binding protein LepA [alpha proteobacterium HTCC2255]
          Length = 599

 Score =  847 bits (2189), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 401/600 (66%), Positives = 489/600 (81%), Gaps = 2/600 (0%)

Query: 6   TPLSRIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQT 65
           T +++IRNFSIVAHIDHGKSTLADR IQ    + +R+M++Q+LD MDIERERGITIKA +
Sbjct: 2   TDINKIRNFSIVAHIDHGKSTLADRLIQSTGTVADRDMAAQLLDTMDIERERGITIKANS 61

Query: 66  VRLNYTSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQ 125
           VR+ Y + D + Y LNLIDTPGHVDF YEVSRS+ A EGSLLVVDA+QGVEAQTLANVY 
Sbjct: 62  VRIEYKANDGEIYILNLIDTPGHVDFAYEVSRSMRAVEGSLLVVDASQGVEAQTLANVYH 121

Query: 126 AIDNNHEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERIVQ 185
           A++ +HEI+ VLNK DLP+ADPDRV +QIE+ IGI   DA+ +SAKTG GIP +LE IV 
Sbjct: 122 ALEADHEIVPVLNKVDLPAADPDRVSEQIEDVIGIDATDAIHISAKTGVGIPDVLEAIVT 181

Query: 186 QLPSPTSPEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVER 245
           +LP+P +   A+APLKA+L+DSWY++YLGV+VLVRII+GQL KG  IR+M TNA Y V+R
Sbjct: 182 RLPAPETT--ADAPLKAMLVDSWYDAYLGVVVLVRIIDGQLKKGDKIRMMNTNATYPVDR 239

Query: 246 IGILTPKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVVF 305
           IG+ TPKM  I+ L  GE+G + ASIK+VS TRVGDTIT +      ALPGF P QPVVF
Sbjct: 240 IGVFTPKMTPIDVLSAGEMGFLTASIKQVSDTRVGDTITHEKKGCEKALPGFAPAQPVVF 299

Query: 306 CGLFPVDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERLE 365
           CGLFPVD  QFE+LR AI+KL LNDASFS E+E S ALGFGFRCGFLGLLHLE+I++RLE
Sbjct: 300 CGLFPVDNAQFEDLREAISKLSLNDASFSTEMETSAALGFGFRCGFLGLLHLEVIRDRLE 359

Query: 366 REFSLNLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEYLG 425
           RE+ +NLI T+PSV+Y ++M DGSM +L NP DMP++T +  + EP I+ TI+ P+EYLG
Sbjct: 360 REYDINLITTAPSVIYHIHMRDGSMIELHNPADMPDLTHVEHIEEPRIKATILVPDEYLG 419

Query: 426 SILKLCQERRGIQIDMSHLDNRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDYR 485
            +LKLCQ+RRGIQID+++   RAM+VY+LPLNEV+FDFYDRLKSV+KGYASFDY++  YR
Sbjct: 420 DVLKLCQDRRGIQIDLTYAGTRAMVVYDLPLNEVVFDFYDRLKSVTKGYASFDYSMEGYR 479

Query: 486 DSDLVKLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGGRI 545
           +  L K+ ILVN E +DALS +VH   ++ RGR + EKLK LIPQ  F+I IQAAIGGRI
Sbjct: 480 EDRLQKMQILVNEEPVDALSTMVHTDRADTRGRAMVEKLKELIPQHQFKIPIQAAIGGRI 539

Query: 546 IARETVKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISILKTDN 605
           IARET+ A RKDVTAKCYGGD++RKRKLL+KQK GKKRMR+FG VDIPQ AFIS LK D+
Sbjct: 540 IARETLSALRKDVTAKCYGGDVSRKRKLLDKQKAGKKRMRQFGSVDIPQEAFISALKMDS 599


>gi|259419063|ref|ZP_05742980.1| GTP-binding protein LepA [Silicibacter sp. TrichCH4B]
 gi|259345285|gb|EEW57139.1| GTP-binding protein LepA [Silicibacter sp. TrichCH4B]
          Length = 599

 Score =  846 bits (2186), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 401/600 (66%), Positives = 490/600 (81%), Gaps = 2/600 (0%)

Query: 6   TPLSRIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQT 65
           T LS+IRNFSIVAHIDHGKSTLADR IQ    + +R+M  Q+LD MDIERERGITIKA T
Sbjct: 2   TELSKIRNFSIVAHIDHGKSTLADRLIQSTGTVQDRDMKEQLLDAMDIERERGITIKANT 61

Query: 66  VRLNYTSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQ 125
           VR++Y + D + Y LNLIDTPGHVDF YEVSRS+ A EGSLLVVD+TQGVEAQTLANVYQ
Sbjct: 62  VRIDYEADDGERYVLNLIDTPGHVDFAYEVSRSMRAVEGSLLVVDSTQGVEAQTLANVYQ 121

Query: 126 AIDNNHEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERIVQ 185
           AID +HEI+ VLNK DLP+AD DRV +QIE+ IGI   DA+ VSAKTG GI   LE IVQ
Sbjct: 122 AIDADHEIVPVLNKIDLPAADCDRVAEQIEDVIGIDATDAIQVSAKTGIGIKETLEAIVQ 181

Query: 186 QLPSPTSPEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVER 245
           +LP+P      +APLKA+L+DSWY++YLGV+VLVRI++G L KG  IR+M TNA+Y VER
Sbjct: 182 RLPAPKGER--DAPLKAMLVDSWYDAYLGVIVLVRIMDGVLKKGDQIRMMQTNARYGVER 239

Query: 246 IGILTPKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVVF 305
           IG+  P M  ++ L PGEIG + ASIK+V  T+VGDTIT D      ALPGFKP  PVVF
Sbjct: 240 IGVFRPAMQTVDELGPGEIGFITASIKQVRDTKVGDTITHDKKGAEVALPGFKPSVPVVF 299

Query: 306 CGLFPVDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERLE 365
           CGLFPVD+++FE+LR AI KL LNDASFS+E+E S ALGFGFRCGFLGLLHLE+I++R+E
Sbjct: 300 CGLFPVDSSEFEDLRNAIEKLALNDASFSYEMETSAALGFGFRCGFLGLLHLEVIRDRIE 359

Query: 366 REFSLNLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEYLG 425
           RE+++ LI T+PSVVY ++  DG M +L NP DMP+++ +  + EP I+ TI+ P+EYLG
Sbjct: 360 REYNIELITTAPSVVYHVFGKDGVMSELHNPADMPDLSTVDHVEEPRIKATILVPDEYLG 419

Query: 426 SILKLCQERRGIQIDMSHLDNRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDYR 485
            +LKLCQ+RRGIQ D+S+  +RAM+VY+LPLNEV+FDFYDRLKSV+KGYASFDY +I YR
Sbjct: 420 DVLKLCQDRRGIQEDLSYAGSRAMVVYDLPLNEVVFDFYDRLKSVTKGYASFDYQMIGYR 479

Query: 486 DSDLVKLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGGRI 545
             +LVK+++LVN+E +DALS++VHR  +E RGR +CEKLK LIP+ MF+I IQAAIGG++
Sbjct: 480 IDNLVKMSVLVNDEPVDALSMMVHRDRAEARGRAMCEKLKELIPRHMFKIPIQAAIGGKV 539

Query: 546 IARETVKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISILKTDN 605
           IARET+ A RKDVTAKCYGGD TRKRKLL+KQK GKK+MR+FGRVDIPQ AFIS LK D+
Sbjct: 540 IARETLSAMRKDVTAKCYGGDATRKRKLLDKQKAGKKKMRQFGRVDIPQEAFISALKMDD 599


>gi|294678639|ref|YP_003579254.1| GTP-binding protein LepA [Rhodobacter capsulatus SB 1003]
 gi|294477459|gb|ADE86847.1| GTP-binding protein LepA [Rhodobacter capsulatus SB 1003]
          Length = 599

 Score =  843 bits (2179), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 392/598 (65%), Positives = 491/598 (82%), Gaps = 2/598 (0%)

Query: 8   LSRIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVR 67
           L  IRNFSIVAHIDHGKSTLADR IQ    +  R+M  Q+LD+MDIERERGITIKA TVR
Sbjct: 4   LDHIRNFSIVAHIDHGKSTLADRLIQMTGTVAARDMKEQMLDSMDIERERGITIKANTVR 63

Query: 68  LNYTSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQAI 127
           ++Y + D + Y LNLIDTPGHVDF YEVSRS+ A EGSLLVVDA+QGVEAQTLANVYQAI
Sbjct: 64  IDYPAKDGRTYILNLIDTPGHVDFAYEVSRSMRAVEGSLLVVDASQGVEAQTLANVYQAI 123

Query: 128 DNNHEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERIVQQL 187
           D  HEI+ VLNK DLP+ADPD VKK IE+ IGI   DA+ +SAKTG GIP +LE IV +L
Sbjct: 124 DAGHEIVPVLNKIDLPAADPDAVKKNIEDVIGIDASDAIPISAKTGLGIPDVLEAIVHRL 183

Query: 188 PSPTSPEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVERIG 247
           P+P      +APLKA+L+DSWY+ YLGV+V++R+++G + KG  I++M T A Y+++++ 
Sbjct: 184 PAPVGE--VDAPLKAMLVDSWYDPYLGVVVMIRVMDGVVRKGDQIKMMQTGASYRIDKLA 241

Query: 248 ILTPKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVVFCG 307
           +L P+M+DI  L PGEIGV+ ASIK+V  TRVGDTIT +  P  +ALPGFKP QPVVFCG
Sbjct: 242 VLKPQMVDIAELGPGEIGVLTASIKQVRDTRVGDTITHERKPCDAALPGFKPAQPVVFCG 301

Query: 308 LFPVDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERLERE 367
           LFPVDA  FE LR AI KL LNDASF++E+E S ALGFGFRCGFLGLLHLE++++RLERE
Sbjct: 302 LFPVDANDFEPLRDAIEKLALNDASFTYEMETSAALGFGFRCGFLGLLHLEVVRDRLERE 361

Query: 368 FSLNLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEYLGSI 427
           + L+LI T+PSVV++LYM DG ++ L NP D+P++T +  + EP I+ TI+ P++YLG +
Sbjct: 362 YDLDLITTAPSVVFKLYMKDGEVRDLHNPADLPDLTYVDHIEEPRIKATIMVPDDYLGDV 421

Query: 428 LKLCQERRGIQIDMSHLDNRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDYRDS 487
           LKLCQ+RRGIQ+D+++  +RAM+VY+LPL+EV+FDFYDRLKSV+KGYASFDY + +YR+ 
Sbjct: 422 LKLCQDRRGIQMDLTYAGSRAMVVYDLPLSEVVFDFYDRLKSVTKGYASFDYQLAEYRED 481

Query: 488 DLVKLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGGRIIA 547
            LVK++ILVN+E +DALSI+VHR  +E RGR + EKLK+LIP+ MF+I IQAAIGGR+IA
Sbjct: 482 FLVKMSILVNDEPVDALSIMVHRDRAEGRGRAMVEKLKDLIPRHMFKIPIQAAIGGRVIA 541

Query: 548 RETVKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISILKTDN 605
           RET+ A RKDVTAKCYGGD TRK+KLLEKQK GKK+MR+FG+V+IPQSAFI+ LK D 
Sbjct: 542 RETLSAMRKDVTAKCYGGDATRKKKLLEKQKAGKKKMRQFGKVEIPQSAFIAALKMDE 599


>gi|77462641|ref|YP_352145.1| GTP-binding protein LepA [Rhodobacter sphaeroides 2.4.1]
 gi|90185206|sp|Q3J4P0|LEPA_RHOS4 RecName: Full=Elongation factor 4; Short=EF-4; AltName:
           Full=Ribosomal back-translocase LepA
 gi|77387059|gb|ABA78244.1| GTP-binding protein LepA [Rhodobacter sphaeroides 2.4.1]
          Length = 599

 Score =  843 bits (2178), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 391/600 (65%), Positives = 491/600 (81%), Gaps = 2/600 (0%)

Query: 6   TPLSRIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQT 65
           T L  IRNFSIVAHIDHGKSTLADR IQ    + ER+M +Q+LD+MDIERERGITIKA T
Sbjct: 2   TQLDLIRNFSIVAHIDHGKSTLADRLIQLTGTVAERDMKAQILDSMDIERERGITIKANT 61

Query: 66  VRLNYTSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQ 125
           VR++Y + D + Y LNLIDTPGHVDF YEVSRS+ A EGSLLVVDA+QGVEAQTLANVYQ
Sbjct: 62  VRIDYPAKDGRTYVLNLIDTPGHVDFAYEVSRSMRAVEGSLLVVDASQGVEAQTLANVYQ 121

Query: 126 AIDNNHEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERIVQ 185
           A+D  HEI+ VLNK DLP+A+P+RVK QIE+ IG+   DA+L+SAK+G GIP +LE IV 
Sbjct: 122 ALDAGHEIVPVLNKIDLPAAEPERVKSQIEDVIGLDASDAVLISAKSGLGIPDVLEAIVH 181

Query: 186 QLPSPTSPEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVER 245
           +LP P       APLKA+L+DSWY++YLGV+V++R+++G + KG  +++M T A Y ++R
Sbjct: 182 RLPPPKGDR--EAPLKAMLVDSWYDAYLGVVVMIRVMDGVIRKGDRVKMMQTGAVYGIDR 239

Query: 246 IGILTPKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVVF 305
           + +L P+M+DI  L PGEIGV+ ASIK+V  TRVGDTIT +     + LPGFKP QPVVF
Sbjct: 240 LAVLKPQMVDIAELGPGEIGVLTASIKQVRDTRVGDTITHEKKGCAAPLPGFKPAQPVVF 299

Query: 306 CGLFPVDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERLE 365
           CGLFPVDA  FE LR AI KL LNDASF++E+E S ALGFGFRCGFLGLLHLE++++RLE
Sbjct: 300 CGLFPVDANDFEALREAIEKLALNDASFTYEMETSAALGFGFRCGFLGLLHLEVVRDRLE 359

Query: 366 REFSLNLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEYLG 425
           RE+ L+LI T+PSVVY++YM DG++Q+L NP DMP++T +  + EP I+ TI+ P+EYLG
Sbjct: 360 REYDLDLITTAPSVVYQIYMKDGTLQELHNPTDMPDLTYVDHIEEPRIRATIMVPDEYLG 419

Query: 426 SILKLCQERRGIQIDMSHLDNRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDYR 485
            +LKLCQ+RRGIQ+D+S+   RAM+VY+LPLNEV+FDFYDRLKSV+KGYASFDY +  YR
Sbjct: 420 DVLKLCQDRRGIQLDLSYAGARAMVVYDLPLNEVVFDFYDRLKSVTKGYASFDYQITGYR 479

Query: 486 DSDLVKLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGGRI 545
           +  LVK++ILVN+E +DALS++VHR  ++ RGR + EKLK LIP+ MF+I IQAAIGGR+
Sbjct: 480 EDFLVKMSILVNDEPVDALSMMVHRDRADMRGRAMVEKLKELIPRHMFKIPIQAAIGGRV 539

Query: 546 IARETVKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISILKTDN 605
           IARET+ A RKDVTAKCYGGD TRKRKLL+KQK GKK+MR+FG+V+IPQ AFI+ LK D+
Sbjct: 540 IARETISAMRKDVTAKCYGGDATRKRKLLDKQKAGKKKMRQFGKVEIPQQAFINALKMDS 599


>gi|254512021|ref|ZP_05124088.1| GTP-binding protein LepA [Rhodobacteraceae bacterium KLH11]
 gi|221535732|gb|EEE38720.1| GTP-binding protein LepA [Rhodobacteraceae bacterium KLH11]
          Length = 599

 Score =  843 bits (2178), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 394/600 (65%), Positives = 491/600 (81%), Gaps = 2/600 (0%)

Query: 6   TPLSRIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQT 65
           T L+ IRNFSIVAHIDHGKSTLADR IQ    + +R+M  Q+LD+MDIERERGITIKA T
Sbjct: 2   TDLAHIRNFSIVAHIDHGKSTLADRLIQETGTVKDRDMKEQLLDSMDIERERGITIKANT 61

Query: 66  VRLNYTSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQ 125
           VR++YT+ + + Y LNLIDTPGHVDF YEVSRS+ A EGSLLVVD+TQGVEAQTLANVYQ
Sbjct: 62  VRIDYTADNGEQYVLNLIDTPGHVDFAYEVSRSMRAVEGSLLVVDSTQGVEAQTLANVYQ 121

Query: 126 AIDNNHEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERIVQ 185
           AID +HEI+ VLNK DLP++D DRV +QIE+ IGI   DA+ VSAKTG+GI   LE IVQ
Sbjct: 122 AIDADHEIVPVLNKIDLPASDCDRVAEQIEDVIGIDATDAIQVSAKTGQGIHETLEAIVQ 181

Query: 186 QLPSPTSPEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVER 245
           QLP+P      +APLKA+L+DSWY++YLGV+VLVRI++G L KG  ++ M  N  + V+R
Sbjct: 182 QLPAPQG--NLDAPLKAMLVDSWYDAYLGVIVLVRIMDGTLKKGMRVKFMSNNTLHHVDR 239

Query: 246 IGILTPKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVVF 305
           +G+  P+M  +++L PGEIG + ASIK+V  TRVGDTIT+D + T  AL GFKP QPVVF
Sbjct: 240 VGVFRPEMEMVDSLGPGEIGFLTASIKQVRDTRVGDTITNDRNGTEDALDGFKPAQPVVF 299

Query: 306 CGLFPVDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERLE 365
           CGLFPVD+++FE+LR AI+KL LNDASFSFE+E S ALGFGFRCGFLGLLHLE+I++R+E
Sbjct: 300 CGLFPVDSSEFEDLRDAIDKLALNDASFSFEMETSAALGFGFRCGFLGLLHLEVIRDRIE 359

Query: 366 REFSLNLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEYLG 425
           RE+ + LI T+PSV+Y +YM DG M +L NP DMP+ +K+  + EP I+ TI+ P+EYLG
Sbjct: 360 REYDIELITTAPSVIYHVYMKDGEMIELHNPADMPDPSKVDHIEEPRIKATILVPDEYLG 419

Query: 426 SILKLCQERRGIQIDMSHLDNRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDYR 485
            +LKLCQ+RRGIQ+D+++   RAM+VY+LPLNEV+FDFYDRLKSV+KGYASFDY +  Y 
Sbjct: 420 DVLKLCQDRRGIQLDLTYAGTRAMVVYDLPLNEVVFDFYDRLKSVTKGYASFDYQMTGYT 479

Query: 486 DSDLVKLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGGRI 545
             +LVK+++LVN+E +DALS +VHR  +E RGR +CEKLK+LIP+ MF+I IQAAIGG++
Sbjct: 480 QDNLVKMSVLVNDEPVDALSTMVHRDRAEMRGRAMCEKLKDLIPRHMFKIPIQAAIGGKV 539

Query: 546 IARETVKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISILKTDN 605
           IARET+ A RKDVTAKCYGGD TRKRKLL+KQK GKK+MR+FG+VDIPQ AFIS LK D 
Sbjct: 540 IARETLSALRKDVTAKCYGGDATRKRKLLDKQKAGKKKMRQFGKVDIPQEAFISALKMDG 599


>gi|83951669|ref|ZP_00960401.1| GTP-binding protein LepA [Roseovarius nubinhibens ISM]
 gi|83836675|gb|EAP75972.1| GTP-binding protein LepA [Roseovarius nubinhibens ISM]
          Length = 599

 Score =  843 bits (2178), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 396/599 (66%), Positives = 488/599 (81%), Gaps = 2/599 (0%)

Query: 6   TPLSRIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQT 65
           TPLS IRNFSIVAHIDHGKSTLADR IQ    + ER+M +Q+LD+MDIERERGITIKA T
Sbjct: 2   TPLSHIRNFSIVAHIDHGKSTLADRLIQQTNTVAERDMKAQLLDSMDIERERGITIKANT 61

Query: 66  VRLNYTSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQ 125
           VR++Y + D + Y LNLIDTPGHVDF YEVSRS+ A EGSLLVVD+TQGVEAQTLANVY 
Sbjct: 62  VRIDYLAQDGETYVLNLIDTPGHVDFAYEVSRSMRAVEGSLLVVDSTQGVEAQTLANVYH 121

Query: 126 AIDNNHEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERIVQ 185
           AI+ +H++I VLNK DLP++D DRV +QIE+ IGI    A+ VSAKTG+GI   LE IV+
Sbjct: 122 AIEADHDLIPVLNKIDLPASDCDRVAEQIEDVIGIDASGAIAVSAKTGQGITETLEAIVK 181

Query: 186 QLPSPTSPEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVER 245
            LP+P      +APLKA+L+DSWY+SYLGV+VLVRI++G L KG  IR+M T A+Y V+R
Sbjct: 182 HLPAPKGDR--DAPLKAMLVDSWYDSYLGVVVLVRIMDGVLKKGDQIRMMQTGARYGVDR 239

Query: 246 IGILTPKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVVF 305
           IG+  P M  ++ L PGEIG + ASIK+V  T+VGDTIT D  P    LPGFKP QPVVF
Sbjct: 240 IGVFRPAMQVVDELGPGEIGFINASIKQVRDTKVGDTITHDKKPADKPLPGFKPSQPVVF 299

Query: 306 CGLFPVDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERLE 365
           CGLFPVD+ +FE+LR AI KL LNDASFS+E+E S ALGFGFRCGFLGLLHLE+I++R+E
Sbjct: 300 CGLFPVDSAEFEDLRDAIEKLALNDASFSYEMETSAALGFGFRCGFLGLLHLEVIRDRIE 359

Query: 366 REFSLNLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEYLG 425
           RE+ + LI T+PSV+Y ++M DG+ Q L NP DMP++T +  + EP I+ TI+ P+EYLG
Sbjct: 360 REYDIELITTAPSVIYHVFMKDGTQQDLHNPADMPDLTYVDHIEEPRIKATILVPDEYLG 419

Query: 426 SILKLCQERRGIQIDMSHLDNRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDYR 485
            +LKLCQ+RRGIQ+D+++   RAM+VY+LPLNEV+FDFYDRLKSV+KGYASFDY +  YR
Sbjct: 420 DVLKLCQDRRGIQLDLTYAGARAMVVYDLPLNEVVFDFYDRLKSVTKGYASFDYQMEGYR 479

Query: 486 DSDLVKLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGGRI 545
             +LVK++ILVN+E +DALS++VHR  +E RGR +CEKLK+LIP+ MF+I IQAAIGG++
Sbjct: 480 QDNLVKMSILVNDEPVDALSMMVHRDRAEMRGRAMCEKLKDLIPRHMFKIPIQAAIGGKV 539

Query: 546 IARETVKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISILKTD 604
           IARET+ A RKDVTAKCYGGD TRKRKLLEKQK GKK+MR+FG+V+IPQ AFIS LK D
Sbjct: 540 IARETLSALRKDVTAKCYGGDATRKRKLLEKQKAGKKKMRQFGKVEIPQEAFISALKMD 598


>gi|119387122|ref|YP_918177.1| GTP-binding protein LepA [Paracoccus denitrificans PD1222]
 gi|119377717|gb|ABL72481.1| GTP-binding protein LepA [Paracoccus denitrificans PD1222]
          Length = 614

 Score =  843 bits (2177), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 398/600 (66%), Positives = 489/600 (81%), Gaps = 2/600 (0%)

Query: 6   TPLSRIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQT 65
           T L  IRNFSIVAHIDHGKSTLADR IQ    + ER+M +Q+LD+MDIERERGITIKA T
Sbjct: 17  TDLDLIRNFSIVAHIDHGKSTLADRLIQLTGTVAERDMKAQLLDSMDIERERGITIKANT 76

Query: 66  VRLNYTSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQ 125
           VR+ Y + D + Y LNLIDTPGHVDF YEVSRS+ A EGSLLVVDATQGVEAQTLANVYQ
Sbjct: 77  VRIEYPARDGRTYVLNLIDTPGHVDFAYEVSRSMRAVEGSLLVVDATQGVEAQTLANVYQ 136

Query: 126 AIDNNHEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERIVQ 185
           AID  H+I+ VLNK DLP+A+PDRVK+QIE+ IGI   DA+ +SAKTG GIP +LE IV 
Sbjct: 137 AIDAGHDIVPVLNKIDLPAAEPDRVKEQIEDVIGIDAHDAIEISAKTGLGIPDVLEAIVT 196

Query: 186 QLPSPTSPEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVER 245
           +LP+P      +APLKA+L+DSWY+ YLGV+V++R+++G + KG  IR+M TNA Y +++
Sbjct: 197 RLPAPKGDR--DAPLKAMLVDSWYDPYLGVVVMIRVMDGVIRKGDRIRMMQTNAVYGIDK 254

Query: 246 IGILTPKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVVF 305
           + +L P+M DI  L PGEIGV+ ASIK+V  TRVGDTIT +   T + LPGFKP QPVVF
Sbjct: 255 LAVLRPQMQDIAELGPGEIGVLTASIKQVRDTRVGDTITHERKGTDTPLPGFKPAQPVVF 314

Query: 306 CGLFPVDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERLE 365
           CGLFPVDA  FE LR AI KL LNDASFS+E+E S ALGFGFRCGFLGLLHLE+I++RLE
Sbjct: 315 CGLFPVDANDFEALRDAIEKLALNDASFSYEMETSAALGFGFRCGFLGLLHLEVIRDRLE 374

Query: 366 REFSLNLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEYLG 425
           RE+ L+LI T+PSVV+ L+M DG M++L NP DMP++T +  + EP I+ TI+ P+EYLG
Sbjct: 375 REYDLDLITTAPSVVFRLHMKDGEMRELHNPADMPDLTYVDHIEEPRIKATIMVPDEYLG 434

Query: 426 SILKLCQERRGIQIDMSHLDNRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDYR 485
            +LKLCQ+RRGIQ+D+++  NRAM+VY+LPL EV+FDFYDRLKSV+KGYASFDY + +YR
Sbjct: 435 DVLKLCQDRRGIQMDLTYAGNRAMVVYDLPLAEVVFDFYDRLKSVTKGYASFDYQISEYR 494

Query: 486 DSDLVKLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGGRI 545
           +  LVK++ILVN+E +DALSI+VHR  +E RGR + EKLK LIP+ MF+I IQAAIG R+
Sbjct: 495 EDYLVKMSILVNDEPVDALSIMVHRDRAESRGRAMVEKLKELIPRHMFKIPIQAAIGSRV 554

Query: 546 IARETVKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISILKTDN 605
           IARET+ A RKDVTAKCYGGD TRK+KLLEKQK GKK+MR+FG+V+IPQ+AFI  LK D 
Sbjct: 555 IARETLSAMRKDVTAKCYGGDATRKKKLLEKQKAGKKKMRQFGKVEIPQTAFIQALKMDG 614


>gi|330992987|ref|ZP_08316927.1| GTP-binding protein lepA [Gluconacetobacter sp. SXCC-1]
 gi|329759940|gb|EGG76444.1| GTP-binding protein lepA [Gluconacetobacter sp. SXCC-1]
          Length = 601

 Score =  842 bits (2175), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 395/600 (65%), Positives = 485/600 (80%), Gaps = 2/600 (0%)

Query: 6   TPLSRIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQT 65
           TPLS IRNFSI+AHIDHGKSTLADR IQ C  LT+REM++QVLDNMD+ERERGITIKAQT
Sbjct: 4   TPLSLIRNFSIIAHIDHGKSTLADRLIQACGALTQREMTNQVLDNMDLERERGITIKAQT 63

Query: 66  VRLNYTSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQ 125
           VRL Y + D + Y LNL+DTPGHVDF YEVSRSL+ACEGSLLVVDA+QGVEAQTLANVYQ
Sbjct: 64  VRLTYPAEDGRTYVLNLMDTPGHVDFAYEVSRSLAACEGSLLVVDASQGVEAQTLANVYQ 123

Query: 126 AIDNNHEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERIVQ 185
           AID NHEI+ VLNK DLP+AD  RVK+QIEE +GI  +DA+ VSAKTG  I  +LE +V+
Sbjct: 124 AIDANHEIVPVLNKVDLPAADCPRVKEQIEEVVGIPADDAVEVSAKTGLNIEAVLEALVK 183

Query: 186 QLPSPTSPEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVER 245
           +LP PT    A APLKALL+DSWY+ YLGV+ LVR+  G+L +G  IR+M T   + V++
Sbjct: 184 RLPPPTG--DAEAPLKALLVDSWYDPYLGVITLVRVKEGRLKRGMRIRMMSTGVVHLVDQ 241

Query: 246 IGILTPKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVVF 305
           +G+  P+M ++  L PGEIG + A+IK V+ T VGDTITDD  P  + L GFKP  PVV+
Sbjct: 242 VGVFAPRMTNVAELGPGEIGYINAAIKTVADTNVGDTITDDRRPADAPLAGFKPSIPVVW 301

Query: 306 CGLFPVDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERLE 365
           CG++P+ A  FE LR ++ KLRLNDASF +E E S ALGFGFRCGFLGLLHLEIIQERL 
Sbjct: 302 CGMYPIVADDFEKLRDSLAKLRLNDASFHYEAETSAALGFGFRCGFLGLLHLEIIQERLS 361

Query: 366 REFSLNLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEYLG 425
           REF L+LI T+PSVVY + + +G   +L NP DMP+ + I ++ EPWI+ TI+ P+EYLG
Sbjct: 362 REFDLDLIATAPSVVYRMQLTNGEQAELHNPADMPDQSLIEKIEEPWIRATIMVPDEYLG 421

Query: 426 SILKLCQERRGIQIDMSHLDNRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDYR 485
           ++L LC ERRG+Q+D++++ NRAM VY LPLNEV+FDFYDRLKSV++GYASFDY +  Y 
Sbjct: 422 AVLTLCSERRGMQVDLTYVGNRAMAVYRLPLNEVVFDFYDRLKSVTRGYASFDYQMDGYE 481

Query: 486 DSDLVKLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGGRI 545
           +SDLV+++ILVN E +DALS + HRS +E RGR IC KLK LIP+Q+F+IA+QAAIG RI
Sbjct: 482 ESDLVRISILVNQEPVDALSFIAHRSAAETRGRSICAKLKELIPRQLFKIAVQAAIGSRI 541

Query: 546 IARETVKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISILKTDN 605
           IARET+ A  KDVTAKCYGGDI+RKRKLL+KQKEGKKRMR+FG+V+IPQSAF++ LK D 
Sbjct: 542 IARETIGAMSKDVTAKCYGGDISRKRKLLDKQKEGKKRMRQFGKVEIPQSAFLAALKMDQ 601


>gi|332557523|ref|ZP_08411845.1| GTP-binding protein LepA [Rhodobacter sphaeroides WS8N]
 gi|332275235|gb|EGJ20550.1| GTP-binding protein LepA [Rhodobacter sphaeroides WS8N]
          Length = 599

 Score =  842 bits (2175), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 390/600 (65%), Positives = 491/600 (81%), Gaps = 2/600 (0%)

Query: 6   TPLSRIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQT 65
           T L  IRNFSIVAHIDHGKSTLADR IQ    + ER+M +Q+LD+M+IERERGITIKA T
Sbjct: 2   TQLDLIRNFSIVAHIDHGKSTLADRLIQLTGTVAERDMKAQILDSMEIERERGITIKANT 61

Query: 66  VRLNYTSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQ 125
           VR++Y + D + Y LNLIDTPGHVDF YEVSRS+ A EGSLLVVDA+QGVEAQTLANVYQ
Sbjct: 62  VRIDYPAKDGRTYVLNLIDTPGHVDFAYEVSRSMRAVEGSLLVVDASQGVEAQTLANVYQ 121

Query: 126 AIDNNHEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERIVQ 185
           A+D  HEI+ VLNK DLP+A+P+RVK QIE+ IG+   DA+L+SAK+G GIP +LE IV 
Sbjct: 122 ALDAGHEIVPVLNKIDLPAAEPERVKSQIEDVIGLDASDAVLISAKSGLGIPDVLEAIVH 181

Query: 186 QLPSPTSPEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVER 245
           +LP P       APLKA+L+DSWY++YLGV+V++R+++G + KG  +++M T A Y ++R
Sbjct: 182 RLPPPKGDR--EAPLKAMLVDSWYDAYLGVVVMIRVMDGVIRKGDRVKMMQTGAVYGIDR 239

Query: 246 IGILTPKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVVF 305
           + +L P+M+DI  L PGEIGV+ ASIK+V  TRVGDTIT +     + LPGFKP QPVVF
Sbjct: 240 LAVLKPQMVDIAELGPGEIGVLTASIKQVRDTRVGDTITHEKKGCAAPLPGFKPAQPVVF 299

Query: 306 CGLFPVDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERLE 365
           CGLFPVDA  FE LR AI KL LNDASF++E+E S ALGFGFRCGFLGLLHLE++++RLE
Sbjct: 300 CGLFPVDANDFEALREAIEKLALNDASFTYEMETSAALGFGFRCGFLGLLHLEVVRDRLE 359

Query: 366 REFSLNLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEYLG 425
           RE+ L+LI T+PSVVY++YM DG++Q+L NP DMP++T +  + EP I+ TI+ P+EYLG
Sbjct: 360 REYDLDLITTAPSVVYQIYMKDGTLQELHNPTDMPDLTYVDHIEEPRIRATIMVPDEYLG 419

Query: 426 SILKLCQERRGIQIDMSHLDNRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDYR 485
            +LKLCQ+RRGIQ+D+S+   RAM+VY+LPLNEV+FDFYDRLKSV+KGYASFDY +  YR
Sbjct: 420 DVLKLCQDRRGIQLDLSYAGARAMVVYDLPLNEVVFDFYDRLKSVTKGYASFDYQITGYR 479

Query: 486 DSDLVKLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGGRI 545
           +  LVK++ILVN+E +DALS++VHR  ++ RGR + EKLK LIP+ MF+I IQAAIGGR+
Sbjct: 480 EDFLVKMSILVNDEPVDALSMMVHRDRADMRGRAMVEKLKELIPRHMFKIPIQAAIGGRV 539

Query: 546 IARETVKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISILKTDN 605
           IARET+ A RKDVTAKCYGGD TRKRKLL+KQK GKK+MR+FG+V+IPQ AFI+ LK D+
Sbjct: 540 IARETISAMRKDVTAKCYGGDATRKRKLLDKQKAGKKKMRQFGKVEIPQQAFINALKMDS 599


>gi|126461533|ref|YP_001042647.1| GTP-binding protein LepA [Rhodobacter sphaeroides ATCC 17029]
 gi|229485939|sp|A3PHQ9|LEPA_RHOS1 RecName: Full=Elongation factor 4; Short=EF-4; AltName:
           Full=Ribosomal back-translocase LepA
 gi|126103197|gb|ABN75875.1| GTP-binding protein LepA [Rhodobacter sphaeroides ATCC 17029]
          Length = 602

 Score =  842 bits (2174), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 390/600 (65%), Positives = 491/600 (81%), Gaps = 2/600 (0%)

Query: 6   TPLSRIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQT 65
           T L  IRNFSIVAHIDHGKSTLADR IQ    + ER+M +Q+LD+M+IERERGITIKA T
Sbjct: 5   TQLDLIRNFSIVAHIDHGKSTLADRLIQLTGTVAERDMKAQILDSMEIERERGITIKANT 64

Query: 66  VRLNYTSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQ 125
           VR++Y + D + Y LNLIDTPGHVDF YEVSRS+ A EGSLLVVDA+QGVEAQTLANVYQ
Sbjct: 65  VRIDYPAKDGRTYVLNLIDTPGHVDFAYEVSRSMRAVEGSLLVVDASQGVEAQTLANVYQ 124

Query: 126 AIDNNHEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERIVQ 185
           A+D  HEI+ VLNK DLP+A+P+RVK QIE+ IG+   DA+L+SAK+G GIP +LE IV 
Sbjct: 125 ALDAGHEIVPVLNKIDLPAAEPERVKSQIEDVIGLDASDAVLISAKSGLGIPDVLEAIVH 184

Query: 186 QLPSPTSPEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVER 245
           +LP P       APLKA+L+DSWY++YLGV+V++R+++G + KG  +++M T A Y ++R
Sbjct: 185 RLPPPKGDR--EAPLKAMLVDSWYDAYLGVVVMIRVMDGVIRKGDRVKMMQTGAVYGIDR 242

Query: 246 IGILTPKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVVF 305
           + +L P+M+DI  L PGEIGV+ ASIK+V  TRVGDTIT +     + LPGFKP QPVVF
Sbjct: 243 LAVLKPQMVDIAELGPGEIGVLTASIKQVRDTRVGDTITHEKKGCAAPLPGFKPAQPVVF 302

Query: 306 CGLFPVDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERLE 365
           CGLFPVDA  FE LR AI KL LNDASF++E+E S ALGFGFRCGFLGLLHLE++++RLE
Sbjct: 303 CGLFPVDANDFEALREAIEKLALNDASFTYEMETSAALGFGFRCGFLGLLHLEVVRDRLE 362

Query: 366 REFSLNLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEYLG 425
           RE+ L+LI T+PSVVY++YM DG++Q+L NP DMP++T +  + EP I+ TI+ P+EYLG
Sbjct: 363 REYDLDLITTAPSVVYQIYMKDGTLQELHNPTDMPDLTYVDHIEEPRIRATIMVPDEYLG 422

Query: 426 SILKLCQERRGIQIDMSHLDNRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDYR 485
            +LKLCQ+RRGIQ+D+S+   RAM+VY+LPLNEV+FDFYDRLKSV+KGYASFDY +  YR
Sbjct: 423 DVLKLCQDRRGIQLDLSYAGARAMVVYDLPLNEVVFDFYDRLKSVTKGYASFDYQITGYR 482

Query: 486 DSDLVKLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGGRI 545
           +  LVK++ILVN+E +DALS++VHR  ++ RGR + EKLK LIP+ MF+I IQAAIGGR+
Sbjct: 483 EDFLVKMSILVNDEPVDALSMMVHRDRADMRGRAMVEKLKELIPRHMFKIPIQAAIGGRV 542

Query: 546 IARETVKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISILKTDN 605
           IARET+ A RKDVTAKCYGGD TRKRKLL+KQK GKK+MR+FG+V+IPQ AFI+ LK D+
Sbjct: 543 IARETISAMRKDVTAKCYGGDATRKRKLLDKQKAGKKKMRQFGKVEIPQQAFINALKMDS 602


>gi|260431008|ref|ZP_05784979.1| GTP-binding protein LepA [Silicibacter lacuscaerulensis ITI-1157]
 gi|260414836|gb|EEX08095.1| GTP-binding protein LepA [Silicibacter lacuscaerulensis ITI-1157]
          Length = 599

 Score =  841 bits (2172), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 393/600 (65%), Positives = 489/600 (81%), Gaps = 2/600 (0%)

Query: 6   TPLSRIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQT 65
           T L+ IRNFSIVAHIDHGKSTLADR IQ    + +R+M  Q+LD+MDIERERGITIKA T
Sbjct: 2   TDLAHIRNFSIVAHIDHGKSTLADRLIQETGTVRDRDMKEQLLDSMDIERERGITIKANT 61

Query: 66  VRLNYTSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQ 125
           VR++YT+ + + Y LNLIDTPGHVDF YEVSRS+ A EGSLLVVD+TQGVEAQTLANVYQ
Sbjct: 62  VRIDYTADNGEQYVLNLIDTPGHVDFAYEVSRSMRAVEGSLLVVDSTQGVEAQTLANVYQ 121

Query: 126 AIDNNHEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERIVQ 185
           AID +HEI+ VLNK DLP++D DRV +QIE+ IGI   DA+ VSAKTGEGI   LE IV 
Sbjct: 122 AIDADHEIVPVLNKIDLPASDCDRVAEQIEDVIGIDASDAIRVSAKTGEGIHETLEAIVH 181

Query: 186 QLPSPTSPEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVER 245
           +LP+P      +APLKA+L+DSWY++YLGV+VLVRI++G L KG  ++ M     + V+R
Sbjct: 182 KLPAPKG--NLDAPLKAMLVDSWYDAYLGVIVLVRIVDGVLKKGMRVKFMSNGTLHHVDR 239

Query: 246 IGILTPKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVVF 305
           +G+  P+M  ++ L PGEIG + ASIK+V  TRVGDTIT+D +     LPGFKP QPVVF
Sbjct: 240 VGVFRPEMQMVDQLGPGEIGFLTASIKQVRDTRVGDTITNDRNGCEEPLPGFKPAQPVVF 299

Query: 306 CGLFPVDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERLE 365
           CGLFPVD+ +FE+LR AI KL LNDASFS+E+E S ALGFGFRCGFLGLLHLE+I++R+E
Sbjct: 300 CGLFPVDSAEFEDLRDAIEKLALNDASFSYEMETSAALGFGFRCGFLGLLHLEVIRDRIE 359

Query: 366 REFSLNLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEYLG 425
           RE+ + LI T+PSV+Y +YM DG M +L NP DMP+++K+  L EP I+ TI+ P+EYLG
Sbjct: 360 REYDIELITTAPSVIYHVYMKDGEMIELHNPADMPDMSKVDHLEEPRIKATILVPDEYLG 419

Query: 426 SILKLCQERRGIQIDMSHLDNRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDYR 485
            +LKLCQ+RRGIQ+D+++  +RAM+VY+LPLNEV+FDFYDRLKSV+KGYASFDY +  YR
Sbjct: 420 DVLKLCQDRRGIQMDLTYAGSRAMVVYDLPLNEVVFDFYDRLKSVTKGYASFDYQMTGYR 479

Query: 486 DSDLVKLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGGRI 545
             +LVK++ILVN+E +DALS++VHR  +E RGR +CEKLK LIP+ MF+I IQAAIGG++
Sbjct: 480 QDNLVKMSILVNDEPVDALSVMVHRDRAETRGRAMCEKLKELIPRHMFKIPIQAAIGGKV 539

Query: 546 IARETVKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISILKTDN 605
           IARET+ A RKDVTAKCYGGD TRKRKLL+KQK GKK+MR+FG+VDIPQ AFIS LK D+
Sbjct: 540 IARETLSALRKDVTAKCYGGDATRKRKLLDKQKAGKKKMRQFGKVDIPQEAFISALKMDS 599


>gi|254419637|ref|ZP_05033361.1| GTP-binding protein LepA [Brevundimonas sp. BAL3]
 gi|196185814|gb|EDX80790.1| GTP-binding protein LepA [Brevundimonas sp. BAL3]
          Length = 589

 Score =  841 bits (2172), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 392/591 (66%), Positives = 485/591 (82%), Gaps = 2/591 (0%)

Query: 16  IVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVRLNYTSTDA 75
           +VAHIDHGKSTL+DR IQ   GLT REMS QVLDNMDIE+ERGITIKAQTVRLNY + D 
Sbjct: 1   MVAHIDHGKSTLSDRLIQFTGGLTAREMSEQVLDNMDIEKERGITIKAQTVRLNYRAKDG 60

Query: 76  KDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQAIDNNHEIIT 135
           +DY LNL+DTPGHVDF YEVSRSL+ACEGSLLVVDA+QGVEAQTLANVYQAIDNNHEI+ 
Sbjct: 61  QDYVLNLMDTPGHVDFAYEVSRSLAACEGSLLVVDASQGVEAQTLANVYQAIDNNHEIVP 120

Query: 136 VLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERIVQQLPSPTSPEG 195
           VLNK DLP+A+P+RV+ QIE+ IGI   +A+L SAK+G GI  +LE IV +LP+P     
Sbjct: 121 VLNKVDLPAAEPERVRAQIEDVIGIDASEAVLCSAKSGIGIEDVLEAIVTKLPAPKG--D 178

Query: 196 ANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVERIGILTPKMID 255
            +APLKA+L+D+WY+ YLGV+VLVR+ +G L  G  +++M   + + ++R+G+  PK   
Sbjct: 179 PDAPLKAMLVDAWYDPYLGVVVLVRVFDGVLKTGMRVKMMRNGSTHLIDRVGVFLPKNTP 238

Query: 256 IEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVVFCGLFPVDATQ 315
           ++ L PGE+G + A IKEV+H  VGDTITD+  PT   L GFK +Q VVFCGLFPVDA  
Sbjct: 239 VDQLGPGEVGFITAQIKEVAHAAVGDTITDEKKPTAEPLKGFKEVQSVVFCGLFPVDAAD 298

Query: 316 FENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERLEREFSLNLIGT 375
           FE+LR AI KLRLNDASF++E+E+S ALGFGFRCGFLGLLHLEIIQERL REF+L+LI T
Sbjct: 299 FEDLRAAIGKLRLNDASFTYEMESSAALGFGFRCGFLGLLHLEIIQERLSREFNLDLIAT 358

Query: 376 SPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEYLGSILKLCQERR 435
           +PSVVY++ + DGS   L NP D+P+V +I  + EPWI+ TI+TP+EYLGS++KLCQ+RR
Sbjct: 359 APSVVYKIGLRDGSEIDLHNPADLPDVMQIETISEPWIKATILTPDEYLGSVIKLCQDRR 418

Query: 436 GIQIDMSHLDNRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDYRDSDLVKLTIL 495
           G QI++S++  RAM+VYELPLNEV+FDFYDRLKS+SKGYASFDY + +Y+  DLVK+ IL
Sbjct: 419 GQQIELSYVGARAMVVYELPLNEVVFDFYDRLKSISKGYASFDYEITEYKVGDLVKMNIL 478

Query: 496 VNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGGRIIARETVKARR 555
           VN E +DALS+LVHR+ +E RGRG+ EK+K LIP  +F I IQAAIGG+IIARETV+A R
Sbjct: 479 VNAEPVDALSMLVHRARAETRGRGMVEKMKELIPPHLFVIPIQAAIGGKIIARETVRALR 538

Query: 556 KDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISILKTDNE 606
           KDVT+KCYGGD TRK+KLLEKQK GKK+MR+FG+V+IPQ AFI+ LK D +
Sbjct: 539 KDVTSKCYGGDATRKKKLLEKQKAGKKKMRQFGKVEIPQEAFIAALKMDED 589


>gi|148556081|ref|YP_001263663.1| GTP-binding protein LepA [Sphingomonas wittichii RW1]
 gi|166224528|sp|A5VB59|LEPA_SPHWW RecName: Full=Elongation factor 4; Short=EF-4; AltName:
           Full=Ribosomal back-translocase LepA
 gi|148501271|gb|ABQ69525.1| GTP-binding protein LepA [Sphingomonas wittichii RW1]
          Length = 607

 Score =  841 bits (2172), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 392/606 (64%), Positives = 490/606 (80%), Gaps = 7/606 (1%)

Query: 6   TPLSRIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQT 65
            PL RIRNFSI+AHIDHGKSTLADR IQ   GLT+REMS+QVLDNMDIE+ERGITIKAQT
Sbjct: 3   VPLDRIRNFSIIAHIDHGKSTLADRLIQRTGGLTDREMSAQVLDNMDIEKERGITIKAQT 62

Query: 66  VRLNYTSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQ 125
           VRL+Y + D +DY LNL+DTPGHVDF YEVSRSL+ACEG+LLVVDA QGVEAQTLANVYQ
Sbjct: 63  VRLDYKAKDGQDYVLNLMDTPGHVDFAYEVSRSLAACEGALLVVDAAQGVEAQTLANVYQ 122

Query: 126 AIDNNHEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERIVQ 185
           +I+++HEI+ V+NK DLP+A+PD+VK +IE+ IG+  +DA+L SAK+G GI  +LE IV 
Sbjct: 123 SIEHDHEIVPVINKIDLPAAEPDKVKAEIEDIIGLPADDAVLASAKSGIGIDEILEAIVA 182

Query: 186 QLPSPTSPEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVER 245
           ++P+P     A  PLKA+L+DSWY+ YLGV++L+R++ G + KGQ I+ M  +  + V+R
Sbjct: 183 RIPAPKGDPAA--PLKAMLVDSWYDPYLGVVILIRVVEGTIRKGQQIKFMQADTVHLVDR 240

Query: 246 IGILTPKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVVF 305
           +G   PK+  +  + PGEIG + A IKEVS T VGDTITD   PT   LPGFK +QPVVF
Sbjct: 241 VGCFRPKIEQLGEMGPGEIGFITAQIKEVSQTAVGDTITDARKPTAEPLPGFKEVQPVVF 300

Query: 306 CGLFPVDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERLE 365
           CGLFPVDA  FE LR ++ KLRLNDASFSFE E+S ALGFGFRCGFLGLLHLEIIQERL 
Sbjct: 301 CGLFPVDAADFEKLRESLYKLRLNDASFSFEAESSAALGFGFRCGFLGLLHLEIIQERLT 360

Query: 366 REFSLNLIGTSPSVVYELYM-----HDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITP 420
           RE+ L+LI T+PSVVY L++      D  + +L NP DMP+  +I  + EPWI+ TI  P
Sbjct: 361 REYDLDLITTAPSVVYRLHLSHSKTEDAKVIELHNPADMPDPNRIDMIEEPWIEATIYVP 420

Query: 421 NEYLGSILKLCQERRGIQIDMSHLDNRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYN 480
           +EYLGS+LKLCQ+RRGIQ +++++  RA I YELPLNEV+FDFYDRLKS+S+GYASFDY+
Sbjct: 421 DEYLGSLLKLCQDRRGIQKNLTYVGGRAQITYELPLNEVVFDFYDRLKSISRGYASFDYH 480

Query: 481 VIDYRDSDLVKLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAA 540
            I YR+ DLVK++I+VN E +DALS++VHR+ +E RGR +CE+LK+LIP+ +F+I +QAA
Sbjct: 481 QIGYREGDLVKMSIMVNGEPVDALSMIVHRAAAEARGRHMCERLKDLIPRHLFKIPVQAA 540

Query: 541 IGGRIIARETVKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISI 600
           IGG++IARET+ A RKDVTAKCYGGD TRKRKLLEKQKEGKKRMR +G V+IPQ AFI+ 
Sbjct: 541 IGGKVIARETIAAMRKDVTAKCYGGDATRKRKLLEKQKEGKKRMREYGNVNIPQEAFIAA 600

Query: 601 LKTDNE 606
           L+  +E
Sbjct: 601 LRMGDE 606


>gi|258541732|ref|YP_003187165.1| GTP-binding protein LepA [Acetobacter pasteurianus IFO 3283-01]
 gi|256632810|dbj|BAH98785.1| GTP-binding protein LepA [Acetobacter pasteurianus IFO 3283-01]
 gi|256635867|dbj|BAI01836.1| GTP-binding protein LepA [Acetobacter pasteurianus IFO 3283-03]
 gi|256638922|dbj|BAI04884.1| GTP-binding protein LepA [Acetobacter pasteurianus IFO 3283-07]
 gi|256641976|dbj|BAI07931.1| GTP-binding protein LepA [Acetobacter pasteurianus IFO 3283-22]
 gi|256645031|dbj|BAI10979.1| GTP-binding protein LepA [Acetobacter pasteurianus IFO 3283-26]
 gi|256648086|dbj|BAI14027.1| GTP-binding protein LepA [Acetobacter pasteurianus IFO 3283-32]
 gi|256651139|dbj|BAI17073.1| GTP-binding protein LepA [Acetobacter pasteurianus IFO 3283-01-42C]
 gi|256654130|dbj|BAI20057.1| GTP-binding protein LepA [Acetobacter pasteurianus IFO 3283-12]
          Length = 601

 Score =  840 bits (2171), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 392/600 (65%), Positives = 487/600 (81%), Gaps = 2/600 (0%)

Query: 6   TPLSRIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQT 65
           TPLS IRNFSI+AHIDHGKSTLADR IQ C  LT REM++QVLDNMD+ERERGITIKAQT
Sbjct: 4   TPLSLIRNFSIIAHIDHGKSTLADRLIQACGALTAREMTNQVLDNMDLERERGITIKAQT 63

Query: 66  VRLNYTSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQ 125
           VRL Y + D   Y LNL+DTPGHVDF YEVSRSL+ACEGSLLVVDA+QGVEAQTLANVYQ
Sbjct: 64  VRLTYPAKDGNTYVLNLMDTPGHVDFAYEVSRSLAACEGSLLVVDASQGVEAQTLANVYQ 123

Query: 126 AIDNNHEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERIVQ 185
           AID NHEI+ VLNK DLP+A+P+RVK QIEE IGI  +DA+ +SAKTG  I  +LE +V 
Sbjct: 124 AIDANHEIVPVLNKVDLPAAEPERVKAQIEEVIGIPADDAVEISAKTGLNIEGVLEAVVT 183

Query: 186 QLPSPTSPEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVER 245
           +LP PT    A  PL+A+LIDSWY+ YLGV+VLVRI  G+L +G  +R+M + A +QV++
Sbjct: 184 RLPPPTG--DAEKPLQAMLIDSWYDPYLGVIVLVRIKEGRLKRGMKVRMMSSGAVHQVDQ 241

Query: 246 IGILTPKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVVF 305
           +G+  P+M  +E+L PGE+G + A+IK V+   VGDTITDD  P    LPGFKP  PVV+
Sbjct: 242 VGVFAPRMTSVESLGPGEMGFINAAIKTVADCNVGDTITDDRRPAEKPLPGFKPSIPVVW 301

Query: 306 CGLFPVDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERLE 365
           CGL+PV A  FE LR ++ KLRLNDASF +E E S ALGFGFRCGFLGLLHLEIIQERL 
Sbjct: 302 CGLYPVVADDFEKLRDSLAKLRLNDASFHYEAETSAALGFGFRCGFLGLLHLEIIQERLS 361

Query: 366 REFSLNLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEYLG 425
           REF L+LI T+PSVVY++   +G  ++L NP DMP+ + I  + EPWI+ TI+ P+EYLG
Sbjct: 362 REFDLDLIATAPSVVYKITRTNGEREELHNPADMPDSSLIETIEEPWIKATIMVPDEYLG 421

Query: 426 SILKLCQERRGIQIDMSHLDNRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDYR 485
           ++L LC ERRG+Q+D++++ +RAM VY LPLNEV+FDFYDRLKS+++GYASFDY +  Y 
Sbjct: 422 AVLTLCTERRGVQVDLTYVGSRAMAVYRLPLNEVVFDFYDRLKSLTRGYASFDYQMDGYE 481

Query: 486 DSDLVKLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGGRI 545
           +SDLV+++ILVN E +DALS + HR+ +E RGR IC +LK+LIP+Q+F+IAIQAAIG ++
Sbjct: 482 ESDLVRISILVNQEPVDALSFIAHRTAAESRGRSICARLKDLIPRQLFKIAIQAAIGSKV 541

Query: 546 IARETVKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISILKTDN 605
           IARET+ A  KDVTAKCYGGDI+RKRKLLEKQKEGKKRMR+FG+V+IPQSAF++ LK ++
Sbjct: 542 IARETIGALSKDVTAKCYGGDISRKRKLLEKQKEGKKRMRQFGKVEIPQSAFLAALKMEH 601


>gi|146279148|ref|YP_001169307.1| GTP-binding protein LepA [Rhodobacter sphaeroides ATCC 17025]
 gi|166224516|sp|A4WX88|LEPA_RHOS5 RecName: Full=Elongation factor 4; Short=EF-4; AltName:
           Full=Ribosomal back-translocase LepA
 gi|145557389|gb|ABP72002.1| GTP-binding protein LepA [Rhodobacter sphaeroides ATCC 17025]
          Length = 599

 Score =  840 bits (2171), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 391/600 (65%), Positives = 491/600 (81%), Gaps = 2/600 (0%)

Query: 6   TPLSRIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQT 65
           T L  IRNFSIVAHIDHGKSTLADR IQ    + ER+M +Q+LD+M+IERERGITIKA T
Sbjct: 2   TQLDLIRNFSIVAHIDHGKSTLADRLIQLTGTVAERDMKAQILDSMEIERERGITIKANT 61

Query: 66  VRLNYTSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQ 125
           VR+ Y + D K Y LNLIDTPGHVDF YEVSRS+ A EGSLLVVDA+QGVEAQTLANVYQ
Sbjct: 62  VRIEYPAKDGKTYVLNLIDTPGHVDFAYEVSRSMRAVEGSLLVVDASQGVEAQTLANVYQ 121

Query: 126 AIDNNHEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERIVQ 185
           A+D  HEI+ VLNK DLP+A+PDRV+ QIE+ IG+   DA+L+SAK+G GIP +LE IV 
Sbjct: 122 ALDAGHEIVPVLNKIDLPAAEPDRVRTQIEDVIGLDASDAVLISAKSGLGIPDVLEAIVT 181

Query: 186 QLPSPTSPEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVER 245
           +LP P       APLKA+L+DSWY++YLGV+V++R+++G + KG  +++M T A Y ++R
Sbjct: 182 RLPPPKG--NREAPLKAMLVDSWYDAYLGVVVMIRVMDGVIRKGDRVKMMQTGAVYGIDR 239

Query: 246 IGILTPKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVVF 305
           + +L P+M+DI  L PGEIGV+ ASIK+V  TRVGDTIT +     + LPGFKP QPVVF
Sbjct: 240 LAVLKPQMVDIAELGPGEIGVLTASIKQVRDTRVGDTITHEKKGCEAPLPGFKPAQPVVF 299

Query: 306 CGLFPVDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERLE 365
           CGLFPVDA  FE LR AI KL LNDASF++E+E S ALGFGFRCGFLGLLHLE++++RLE
Sbjct: 300 CGLFPVDANDFEGLREAIEKLALNDASFTYEMETSAALGFGFRCGFLGLLHLEVVRDRLE 359

Query: 366 REFSLNLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEYLG 425
           RE+ L+LI T+PSVVY++YM DG++Q+L NP DMP++T +  + EP I+ TI+ P+EYLG
Sbjct: 360 REYDLDLITTAPSVVYQIYMRDGTVQELHNPTDMPDLTLVDHIEEPRIRATIMVPDEYLG 419

Query: 426 SILKLCQERRGIQIDMSHLDNRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDYR 485
            +LKLCQ+RRGIQ+D+S+  +RAM+VY+LPLNEV+FDFYDRLKSV+KGYASFDY +  YR
Sbjct: 420 DVLKLCQDRRGIQLDLSYAGSRAMVVYDLPLNEVVFDFYDRLKSVTKGYASFDYQITGYR 479

Query: 486 DSDLVKLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGGRI 545
           +  LVK++ILVN+E +DALS++VHR  ++ RGR + EKLK LIP+ MF+I IQAAIGGR+
Sbjct: 480 EDFLVKMSILVNDEPVDALSMMVHRDRADLRGRAMVEKLKELIPRHMFKIPIQAAIGGRV 539

Query: 546 IARETVKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISILKTDN 605
           IARET+ A RKDVTAKCYGGD TRKRKLL+KQK GKK+MR+FG+V+IPQ AFI+ LK D+
Sbjct: 540 IARETISAMRKDVTAKCYGGDATRKRKLLDKQKAGKKKMRQFGKVEIPQQAFINALKMDS 599


>gi|296114601|ref|ZP_06833254.1| GTP-binding protein LepA [Gluconacetobacter hansenii ATCC 23769]
 gi|295978957|gb|EFG85682.1| GTP-binding protein LepA [Gluconacetobacter hansenii ATCC 23769]
          Length = 601

 Score =  840 bits (2171), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 398/600 (66%), Positives = 484/600 (80%), Gaps = 2/600 (0%)

Query: 6   TPLSRIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQT 65
           TPLS IRNFSI+AHIDHGKSTLADR IQ C  LT+REM++QVLDNMD+ERERGITIKAQT
Sbjct: 4   TPLSLIRNFSIIAHIDHGKSTLADRLIQACGALTQREMTNQVLDNMDLERERGITIKAQT 63

Query: 66  VRLNYTSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQ 125
           VRL Y + D K Y LNL+DTPGHVDF YEVSRSL+ACEGSLLVVDA+QGVEAQTLANVYQ
Sbjct: 64  VRLTYPAKDGKTYILNLMDTPGHVDFAYEVSRSLAACEGSLLVVDASQGVEAQTLANVYQ 123

Query: 126 AIDNNHEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERIVQ 185
           AID NHEI+ VLNK DLP+AD +RVK QIEE +GI  EDA+ VSAKTG  I  +LE +V 
Sbjct: 124 AIDANHEIVPVLNKVDLPAADCERVKAQIEEVVGIDAEDAVEVSAKTGLNIEAVLEALVT 183

Query: 186 QLPSPTSPEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVER 245
           +LP P     A APLKALL+DSWY+ YLGV+ LVR+  G+L KG  IR+M T   + V++
Sbjct: 184 RLPPPKG--DAEAPLKALLVDSWYDPYLGVITLVRVKEGRLKKGMRIRMMSTGVVHNVDQ 241

Query: 246 IGILTPKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVVF 305
           +G+  P++  ++ L PGEIG + A+IK V+   VGDT+TDD  P    L GFKP  PVV+
Sbjct: 242 VGVFAPRLTPMDELGPGEIGYINAAIKTVADCNVGDTLTDDRRPADMPLAGFKPSVPVVW 301

Query: 306 CGLFPVDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERLE 365
           CGL+P+ A  FE LR ++ KLRLNDASF +E E S ALGFGFRCGFLGLLHLEIIQERL 
Sbjct: 302 CGLYPIVADDFEKLRDSLAKLRLNDASFHYEAETSAALGFGFRCGFLGLLHLEIIQERLS 361

Query: 366 REFSLNLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEYLG 425
           REF+L+LI T+PSVVY L+  +G+M++L NP DMP+ + I  + EPWI+ TI+ P+EYLG
Sbjct: 362 REFNLDLIATAPSVVYRLWRTNGAMEELHNPADMPDGSLIERIEEPWIKATIMVPDEYLG 421

Query: 426 SILKLCQERRGIQIDMSHLDNRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDYR 485
           ++L LC ERRGIQ D++++ NRAM VY LPLNEV+FDFYDRLKSVS+GYASFDY +  Y 
Sbjct: 422 AVLTLCTERRGIQQDLTYVGNRAMAVYRLPLNEVVFDFYDRLKSVSRGYASFDYQMDTYE 481

Query: 486 DSDLVKLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGGRI 545
           +S+LV+++ILVN E +DALS + HRS +E RGR IC KLK LIP+Q+F+IAIQA+IG RI
Sbjct: 482 ESELVRISILVNQEPVDALSFIAHRSAAETRGRAICAKLKELIPRQLFKIAIQASIGSRI 541

Query: 546 IARETVKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISILKTDN 605
           IARET+ A  KDVTAKCYGGDI+RKRKLL+KQKEGKKRMR+FG+V+IPQSAF++ LK D+
Sbjct: 542 IARETLGAMSKDVTAKCYGGDISRKRKLLDKQKEGKKRMRQFGKVEIPQSAFLAALKMDH 601


>gi|56695884|ref|YP_166235.1| GTP-binding protein LepA [Ruegeria pomeroyi DSS-3]
 gi|81558662|sp|Q5LUS0|LEPA_SILPO RecName: Full=Elongation factor 4; Short=EF-4; AltName:
           Full=Ribosomal back-translocase LepA
 gi|56677621|gb|AAV94287.1| GTP-binding protein LepA [Ruegeria pomeroyi DSS-3]
          Length = 599

 Score =  840 bits (2171), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 396/600 (66%), Positives = 488/600 (81%), Gaps = 2/600 (0%)

Query: 6   TPLSRIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQT 65
           T L+ IRNFSIVAHIDHGKSTLADR IQ    + +R+M  Q+LD MDIERERGITIKA T
Sbjct: 2   TDLAHIRNFSIVAHIDHGKSTLADRLIQETGTVQDRDMKEQLLDAMDIERERGITIKANT 61

Query: 66  VRLNYTSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQ 125
           VR++YT+ D + Y LNLIDTPGHVDF YEVSRS+ A EGSLLVVD+TQGVEAQTLANVYQ
Sbjct: 62  VRIDYTADDGQAYVLNLIDTPGHVDFAYEVSRSMRAVEGSLLVVDSTQGVEAQTLANVYQ 121

Query: 126 AIDNNHEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERIVQ 185
           AID +HEI+ +LNK DLP+++ DRV +QIE+ IGI    A+ VSAKTG GI   LE IV+
Sbjct: 122 AIDADHEIVPILNKIDLPASECDRVAEQIEDVIGIDASGAIRVSAKTGVGIHETLEAIVK 181

Query: 186 QLPSPTSPEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVER 245
            LP+P      +APLKA+L+DSWY+SYLGV+VLVRI++G L KG  ++ M     + V+R
Sbjct: 182 HLPAPKGTR--DAPLKAMLVDSWYDSYLGVIVLVRIMDGVLKKGMRVKFMSNGTLHHVDR 239

Query: 246 IGILTPKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVVF 305
           IG+  P M  I++L PGEIG + ASIK+V  TRVGDTIT+D + T  ALPGFKP QPVVF
Sbjct: 240 IGVFRPAMQMIDSLGPGEIGFLTASIKQVRDTRVGDTITNDRNGTEVALPGFKPAQPVVF 299

Query: 306 CGLFPVDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERLE 365
           CGLFPVD+ +FE+LR AI KL LNDASFS+E+E S ALGFGFRCGFLGLLHLE+I++RLE
Sbjct: 300 CGLFPVDSAEFEDLRDAIEKLALNDASFSYEMETSAALGFGFRCGFLGLLHLEVIRDRLE 359

Query: 366 REFSLNLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEYLG 425
           RE+ + LI T+PSVVY ++M DG M++L NP DMP+++K+  + EP I+ TI+ P+EYLG
Sbjct: 360 REYDIELITTAPSVVYHVFMKDGEMRELHNPADMPDLSKVDHIEEPRIKATILVPDEYLG 419

Query: 426 SILKLCQERRGIQIDMSHLDNRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDYR 485
            +LKLCQ+RRGIQ D+S+  +RAM+VY+LPLNEV+FDFYDRLKSV+KGYASFDY +  YR
Sbjct: 420 DVLKLCQDRRGIQQDLSYAGSRAMVVYDLPLNEVVFDFYDRLKSVTKGYASFDYQLTGYR 479

Query: 486 DSDLVKLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGGRI 545
           +  LVK++ILVN+E +DALS +VHR  +E RGR +CEKLK+LIP+ MF+I IQAAIGG++
Sbjct: 480 EDSLVKMSILVNDEPVDALSTMVHRDRAEARGRAMCEKLKDLIPRHMFKIPIQAAIGGKV 539

Query: 546 IARETVKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISILKTDN 605
           IARET+ A RKDVTAKCYGGD TRKRKLL+KQK GKK+MR+FG+VDIPQ AFIS LK D+
Sbjct: 540 IARETLSALRKDVTAKCYGGDATRKRKLLDKQKAGKKKMRQFGKVDIPQEAFISALKMDS 599


>gi|221638496|ref|YP_002524758.1| GTP-binding protein LepA [Rhodobacter sphaeroides KD131]
 gi|254808746|sp|B9KNH9|LEPA_RHOSK RecName: Full=Elongation factor 4; Short=EF-4; AltName:
           Full=Ribosomal back-translocase LepA
 gi|221159277|gb|ACM00257.1| GTP-binding protein lepA [Rhodobacter sphaeroides KD131]
          Length = 602

 Score =  840 bits (2170), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 389/600 (64%), Positives = 491/600 (81%), Gaps = 2/600 (0%)

Query: 6   TPLSRIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQT 65
           T L  IRNFSIVAHIDHGKSTLADR IQ    + ER+M +Q+LD+M+IERERGITIKA T
Sbjct: 5   TQLDLIRNFSIVAHIDHGKSTLADRLIQLTGTVAERDMKAQILDSMEIERERGITIKANT 64

Query: 66  VRLNYTSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQ 125
           VR++Y + D + Y LNLIDTPGHVDF YEVSRS+ A EGSLLVVDA+QGVEAQTLANVYQ
Sbjct: 65  VRIDYPAKDGRTYVLNLIDTPGHVDFAYEVSRSMRAVEGSLLVVDASQGVEAQTLANVYQ 124

Query: 126 AIDNNHEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERIVQ 185
           A+D  HEI+ VLNK DLP+A+P+RVK QIE+ IG+   DA+L+SAK+G GIP +LE IV 
Sbjct: 125 ALDAGHEIVPVLNKIDLPAAEPERVKSQIEDVIGLDASDAVLISAKSGLGIPDVLEAIVH 184

Query: 186 QLPSPTSPEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVER 245
           +LP P       APLKA+L+DSWY++YLGV+V++R+++G + KG  +++M T A Y ++R
Sbjct: 185 RLPPPKGDR--EAPLKAMLVDSWYDAYLGVVVMIRVMDGVIRKGDRVKMMQTGAVYGIDR 242

Query: 246 IGILTPKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVVF 305
           + +L P+M+DI  L PGEIGV+ ASIK+V  TRVGDTIT +     + LPGFKP QPVVF
Sbjct: 243 LAVLKPQMVDIAELGPGEIGVLTASIKQVRDTRVGDTITHEKKGCAAPLPGFKPAQPVVF 302

Query: 306 CGLFPVDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERLE 365
           CGLFPVDA  FE LR A+ KL LNDASF++E+E S ALGFGFRCGFLGLLHLE++++RLE
Sbjct: 303 CGLFPVDANDFEALREAMEKLALNDASFTYEMETSAALGFGFRCGFLGLLHLEVVRDRLE 362

Query: 366 REFSLNLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEYLG 425
           RE+ L+LI T+PSVVY++YM DG++Q+L NP DMP++T +  + EP I+ TI+ P+EYLG
Sbjct: 363 REYDLDLITTAPSVVYQIYMKDGTLQELHNPTDMPDLTYVDHIEEPRIRATIMVPDEYLG 422

Query: 426 SILKLCQERRGIQIDMSHLDNRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDYR 485
            +LKLCQ+RRGIQ+D+S+   RAM+VY+LPLNEV+FDFYDRLKSV+KGYASFDY +  YR
Sbjct: 423 DVLKLCQDRRGIQLDLSYAGARAMVVYDLPLNEVVFDFYDRLKSVTKGYASFDYQITGYR 482

Query: 486 DSDLVKLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGGRI 545
           +  LVK++ILVN+E +DALS++VHR  ++ RGR + EKLK LIP+ MF+I IQAAIGGR+
Sbjct: 483 EDFLVKMSILVNDEPVDALSMMVHRDRADMRGRAMVEKLKELIPRHMFKIPIQAAIGGRV 542

Query: 546 IARETVKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISILKTDN 605
           IARET+ A RKDVTAKCYGGD TRKRKLL+KQK GKK+MR+FG+V+IPQ AFI+ LK D+
Sbjct: 543 IARETISAMRKDVTAKCYGGDATRKRKLLDKQKAGKKKMRQFGKVEIPQQAFINALKMDS 602


>gi|94498500|ref|ZP_01305056.1| Small GTP-binding protein domain protein [Sphingomonas sp. SKA58]
 gi|94422043|gb|EAT07088.1| Small GTP-binding protein domain protein [Sphingomonas sp. SKA58]
          Length = 601

 Score =  840 bits (2170), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 390/601 (64%), Positives = 493/601 (82%), Gaps = 2/601 (0%)

Query: 6   TPLSRIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQT 65
           T LS+IRNFSI+AHIDHGKSTLADR IQ   GLT+REMS+QVLDNMDIE+ERGITIKAQT
Sbjct: 2   TDLSQIRNFSIIAHIDHGKSTLADRLIQRTGGLTDREMSAQVLDNMDIEKERGITIKAQT 61

Query: 66  VRLNYTSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQ 125
           VRL+Y + D + Y LNL+DTPGHVDF YEVSRSL+ACEG+LLVVDA QGVEAQTLANVYQ
Sbjct: 62  VRLDYVAKDGQTYALNLMDTPGHVDFAYEVSRSLAACEGALLVVDAAQGVEAQTLANVYQ 121

Query: 126 AIDNNHEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERIVQ 185
           +I+++HEI+ V+NK DLP+A+P++VK +IEE IG+   +A+L SAK+G GI  +LE IV 
Sbjct: 122 SIEHDHEIVPVINKIDLPAAEPEKVKAEIEEVIGLDASEAVLASAKSGIGIDDILEAIVT 181

Query: 186 QLPSPTSPEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVER 245
           ++P+P      +APL+A+L+DSWY+ YLGV++LVR++NG + KGQ+I+ M    ++ ++R
Sbjct: 182 KIPAPKGDR--DAPLEAMLVDSWYDPYLGVVILVRVMNGVIKKGQNIKFMIGGTEHLIDR 239

Query: 246 IGILTPKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVVF 305
           +G   PK+  +  L PGEIG + A IK++S TRVGDTIT   +P T  LPGFK +Q VVF
Sbjct: 240 VGCFRPKIEQLAELGPGEIGFITAQIKDISQTRVGDTITTVKNPATKPLPGFKEVQSVVF 299

Query: 306 CGLFPVDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERLE 365
           CGLFPVDA  FE LR +I KLRLNDASFSFE+E S ALGFGFRCGFLGLLHLEIIQERL 
Sbjct: 300 CGLFPVDANDFEKLRDSIGKLRLNDASFSFEMETSAALGFGFRCGFLGLLHLEIIQERLT 359

Query: 366 REFSLNLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEYLG 425
           RE+ L+LI T+PSVVY+++M DG+++ L NP DMP+   I  + EPWI+  I  P+EYLG
Sbjct: 360 REYDLDLITTAPSVVYDMHMKDGTVRHLHNPADMPDPNHIEMIEEPWIEAVIYCPDEYLG 419

Query: 426 SILKLCQERRGIQIDMSHLDNRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDYR 485
           SILKLCQ+RRGIQ +++++  RA + YELPLNEV+FDFYDRLKS+S+GYASFDY+ I  R
Sbjct: 420 SILKLCQDRRGIQKNLTYVGGRAQVTYELPLNEVVFDFYDRLKSISRGYASFDYHQIGTR 479

Query: 486 DSDLVKLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGGRI 545
           + DLVK++ILVNNE +DALS++VHRS +E RGR +CE+LK+LIP+ +F+I IQAAIGG++
Sbjct: 480 EGDLVKMSILVNNEPVDALSMIVHRSAAEARGRHMCERLKDLIPRHLFKIPIQAAIGGKV 539

Query: 546 IARETVKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISILKTDN 605
           IARET+ A RKDVTAKCYGGDI+RK+KLL+KQKEGKKRMR +G V IPQ AFI+ L+  +
Sbjct: 540 IARETIAAMRKDVTAKCYGGDISRKKKLLDKQKEGKKRMREYGSVQIPQEAFIAALRMGD 599

Query: 606 E 606
           E
Sbjct: 600 E 600


>gi|149915960|ref|ZP_01904484.1| GTP-binding protein LepA [Roseobacter sp. AzwK-3b]
 gi|149810283|gb|EDM70129.1| GTP-binding protein LepA [Roseobacter sp. AzwK-3b]
          Length = 599

 Score =  840 bits (2169), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 396/600 (66%), Positives = 491/600 (81%), Gaps = 2/600 (0%)

Query: 6   TPLSRIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQT 65
           TPLS IRNFSIVAHIDHGKSTLADR IQ    + ER+M  Q+LD+MDIERERGITIKA T
Sbjct: 2   TPLSHIRNFSIVAHIDHGKSTLADRLIQMTDTVAERDMKEQLLDSMDIERERGITIKANT 61

Query: 66  VRLNYTSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQ 125
           VR+++T+ D + Y LNLIDTPGHVDF+YEVSRS+ A EGSLLVVD+TQGVEAQTLANVYQ
Sbjct: 62  VRIDFTAEDGQQYVLNLIDTPGHVDFSYEVSRSMRAVEGSLLVVDSTQGVEAQTLANVYQ 121

Query: 126 AIDNNHEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERIVQ 185
           AID NHE+I VLNK DLP++D DRV +QIEE IGI    A+ VSAKTG+GI  +LE IV 
Sbjct: 122 AIDANHELIPVLNKIDLPASDLDRVAEQIEEVIGIDASGAIPVSAKTGQGIREVLEAIVA 181

Query: 186 QLPSPTSPEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVER 245
            LP+P      +APLKA+L+DS Y+ YLGV+VLVRI++G + KG  I ++ T A Y V+R
Sbjct: 182 HLPAPKGHR--DAPLKAMLVDSKYDPYLGVVVLVRIMDGVMKKGDRIHMLQTAATYNVDR 239

Query: 246 IGILTPKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVVF 305
           IG+  P M  ++ L PGEIG + ASIK+V  T+VGDTIT D     +ALPGFKP  PVVF
Sbjct: 240 IGVFRPAMTVVDELGPGEIGFITASIKQVRDTKVGDTITHDRRRCETALPGFKPSVPVVF 299

Query: 306 CGLFPVDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERLE 365
           CGLFPVD+ +FE+LR AI KL LNDASFS+E+ENS ALGFGFRCGFLGLLHLE+I++R+E
Sbjct: 300 CGLFPVDSAEFESLRDAIEKLALNDASFSYEMENSAALGFGFRCGFLGLLHLEVIRDRIE 359

Query: 366 REFSLNLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEYLG 425
           RE+ + LI T+PSVVY ++M DGSM++L NP DMP++T +  + EP I+ TI+ P+EYLG
Sbjct: 360 REYDIELITTAPSVVYHIFMKDGSMKELHNPADMPDLTYVDHIEEPRIKATILVPDEYLG 419

Query: 426 SILKLCQERRGIQIDMSHLDNRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDYR 485
            +LKLCQ+RRGIQ+D+++  +RAM VY+LPLNEV+FDFYDRLKSV+KGYASFDY ++ YR
Sbjct: 420 DVLKLCQDRRGIQMDLTYAGSRAMAVYDLPLNEVVFDFYDRLKSVTKGYASFDYEIMGYR 479

Query: 486 DSDLVKLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGGRI 545
              LVK+++LVN+E +DALS++VHR  +E RGR +CEKLK+LIP+ MF+I IQAAIGG++
Sbjct: 480 QDYLVKMSVLVNDEPVDALSMMVHRDRAEMRGRAMCEKLKDLIPRHMFKIPIQAAIGGKV 539

Query: 546 IARETVKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISILKTDN 605
           IARET+ A RKDVTAKCYGGD+TRK+KLLEKQK GKK+MR+FG+V+IPQ AFIS LK D+
Sbjct: 540 IARETLSAMRKDVTAKCYGGDVTRKKKLLEKQKAGKKKMRQFGKVEIPQQAFISALKMDD 599


>gi|296532405|ref|ZP_06895132.1| GTP-binding protein LepA [Roseomonas cervicalis ATCC 49957]
 gi|296267248|gb|EFH13146.1| GTP-binding protein LepA [Roseomonas cervicalis ATCC 49957]
          Length = 601

 Score =  839 bits (2168), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 397/601 (66%), Positives = 486/601 (80%), Gaps = 4/601 (0%)

Query: 6   TPLSRIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQT 65
           TPLSRIRNFSI+AHIDHGKSTLADR IQ    ++ REM  Q+LD+M++E+ERGITIKA +
Sbjct: 4   TPLSRIRNFSIIAHIDHGKSTLADRLIQATGAISAREMKEQMLDSMELEQERGITIKAAS 63

Query: 66  VRLNYTSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQ 125
           VRL+Y + D +DY LNL+DTPGHVDF YEVSRSL+ACEGSLLVVDA+QGVEAQTLANVYQ
Sbjct: 64  VRLDYKAKDGQDYVLNLMDTPGHVDFAYEVSRSLAACEGSLLVVDASQGVEAQTLANVYQ 123

Query: 126 AIDNNHEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERIVQ 185
           AID  HEI+ VLNK DLP+A+P+RVK+QIE+ IG+   DA+ +SAK+G  I  +LE IV 
Sbjct: 124 AIDAGHEIVPVLNKIDLPAAEPERVKQQIEDVIGLDASDAVEISAKSGLNIEGVLEAIVT 183

Query: 186 QLPSPTSPEG-ANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVE 244
           +LP+P   EG  NAPLKALL+DSWY+ YLGV++L+R+ +G + KGQ IR M       V+
Sbjct: 184 RLPAP---EGDPNAPLKALLVDSWYDPYLGVIILIRVKDGTIRKGQKIRFMAEGTTQTVD 240

Query: 245 RIGILTPKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVV 304
            +G+  PKM  ++ L PGE+G + A+IK V+ T VGDTITDD +P    LPGFKP  PVV
Sbjct: 241 SVGVFRPKMTPVDHLGPGEMGYLNAAIKTVAETNVGDTITDDRNPAAEPLPGFKPSIPVV 300

Query: 305 FCGLFPVDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERL 364
           +CGL+PVDA  FE LR ++ KLRLNDASF FE E+S ALGFGFRCGFLGLLHLEIIQERL
Sbjct: 301 WCGLYPVDADDFEKLRDSLGKLRLNDASFHFEAESSAALGFGFRCGFLGLLHLEIIQERL 360

Query: 365 EREFSLNLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEYL 424
            REF L+LI T+PSVVY+L  + G    L NP DMP+ T I  ++EPWI+ TI+ P+E+L
Sbjct: 361 SREFDLDLIATAPSVVYKLTNNKGETFDLHNPADMPDPTMIESIQEPWIKATIMVPDEHL 420

Query: 425 GSILKLCQERRGIQIDMSHLDNRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDY 484
           GSIL LC ERRG Q++++++ NRAM VY LPLNEV+FDFYDRLKSVS+GYASFDY +  Y
Sbjct: 421 GSILTLCSERRGQQVELTYVGNRAMAVYRLPLNEVVFDFYDRLKSVSRGYASFDYQMDGY 480

Query: 485 RDSDLVKLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGGR 544
            + DLVK++ILVNNE +DALS + HRS +E+RGR ICEKLK LIP+Q+F+I IQAAIGGR
Sbjct: 481 DEGDLVKISILVNNEPVDALSFMAHRSQAERRGRSICEKLKELIPRQLFKIPIQAAIGGR 540

Query: 545 IIARETVKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISILKTD 604
           +IARET+ A  KDVTAKCYGGDI+RKRKLLEKQKEGKKRMR+FG+V+IPQSAFI+ LK D
Sbjct: 541 VIARETISAMSKDVTAKCYGGDISRKRKLLEKQKEGKKRMRQFGKVEIPQSAFIAALKMD 600

Query: 605 N 605
           +
Sbjct: 601 S 601


>gi|126731515|ref|ZP_01747321.1| GTP-binding protein LepA [Sagittula stellata E-37]
 gi|126708051|gb|EBA07111.1| GTP-binding protein LepA [Sagittula stellata E-37]
          Length = 601

 Score =  839 bits (2168), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 394/601 (65%), Positives = 488/601 (81%), Gaps = 3/601 (0%)

Query: 6   TPLSRIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQT 65
           TP + IRNFSIVAHIDHGKSTLADR IQ    + ER+M  Q+LD MDIERERGITIKA T
Sbjct: 3   TPQNLIRNFSIVAHIDHGKSTLADRLIQLTGTVAERDMKEQMLDAMDIERERGITIKANT 62

Query: 66  VRLNYTSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQ 125
           VR++Y + D   Y LNLIDTPGHVDF YEVSRS+ ACEGSLLVVDA+QGVEAQTLANVY 
Sbjct: 63  VRIDYPAKDGNTYVLNLIDTPGHVDFAYEVSRSMRACEGSLLVVDASQGVEAQTLANVYT 122

Query: 126 AIDNNHEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERIVQ 185
           AID +HEI+ VLNK DLP+A+P+RV +QIE+ IGI   +A L+SAKTG GIP +LE IV 
Sbjct: 123 AIDADHEIVPVLNKVDLPAAEPERVAEQIEDVIGIDASNACLISAKTGVGIPDVLEAIVT 182

Query: 186 QLPSPTSPE-GANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVE 244
           +LP+P  PE  A+APLKA+LIDSWY+ YLGV+VL+R++ G + KG +IR+M T  KY V+
Sbjct: 183 RLPAP--PERDADAPLKAMLIDSWYDPYLGVVVLIRVMEGTIRKGDNIRMMKTGGKYGVD 240

Query: 245 RIGILTPKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVV 304
           ++G+  P M D++ L PGEIG    SIK+V  TRVGDTIT +     + LPGFKP  PVV
Sbjct: 241 KLGVFRPAMQDVKELGPGEIGFFTGSIKQVRDTRVGDTITTEKKGAETPLPGFKPSIPVV 300

Query: 305 FCGLFPVDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERL 364
           FCGLFPVDA  FE++R AI KL LNDASF++E+E S ALGFGFRCGFLGLLHLE+I++RL
Sbjct: 301 FCGLFPVDANDFEDMRDAIEKLALNDASFTYEMETSAALGFGFRCGFLGLLHLEVIRDRL 360

Query: 365 EREFSLNLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEYL 424
           ERE+ ++LI T+PSV+Y LYM DG    L NP DMP++TK+  + EP I+ TI+ P++YL
Sbjct: 361 EREYDIDLITTAPSVIYHLYMKDGEKIDLHNPADMPDMTKVDHIEEPRIKATILVPDDYL 420

Query: 425 GSILKLCQERRGIQIDMSHLDNRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDY 484
           G +LKLCQ+RRGIQ+D+++  +RAM+VY+LPLNEV+FDFYDRLKSV+KGYASFDY ++ Y
Sbjct: 421 GDVLKLCQDRRGIQLDLTYAGSRAMVVYDLPLNEVVFDFYDRLKSVTKGYASFDYQLVGY 480

Query: 485 RDSDLVKLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGGR 544
           R+  LVK+ ILVN+E +DALS++VHR  +E RGR +CEKLK+LIP+ MF+I IQAAIGG+
Sbjct: 481 REDALVKMQILVNDEPVDALSMMVHRDRAEMRGRAMCEKLKDLIPRHMFKIPIQAAIGGK 540

Query: 545 IIARETVKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISILKTD 604
           +IARET+ A RKDVTAKCYGGD TRK+KLLEKQK GKK+MR+FG+V+IPQ AFIS LK D
Sbjct: 541 VIARETLSALRKDVTAKCYGGDATRKKKLLEKQKAGKKKMRQFGKVEIPQEAFISALKMD 600

Query: 605 N 605
           +
Sbjct: 601 D 601


>gi|254464965|ref|ZP_05078376.1| GTP-binding protein LepA [Rhodobacterales bacterium Y4I]
 gi|206685873|gb|EDZ46355.1| GTP-binding protein LepA [Rhodobacterales bacterium Y4I]
          Length = 599

 Score =  839 bits (2168), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 394/600 (65%), Positives = 487/600 (81%), Gaps = 2/600 (0%)

Query: 6   TPLSRIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQT 65
           T L+ IRNFSIVAHIDHGKSTLADR IQ    + +R+M  Q+LD MDIERERGITIKA T
Sbjct: 2   TDLAHIRNFSIVAHIDHGKSTLADRLIQETGTVKDRDMKEQLLDAMDIERERGITIKANT 61

Query: 66  VRLNYTSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQ 125
           VR++YT+ + + Y LNLIDTPGHVDF YEVSRS+ A EGSLLVVD+TQGVEAQTLANVYQ
Sbjct: 62  VRIDYTAQNGETYVLNLIDTPGHVDFAYEVSRSMRAVEGSLLVVDSTQGVEAQTLANVYQ 121

Query: 126 AIDNNHEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERIVQ 185
           AI+ +HEI+ VLNK DLP++D DRV +QIE+ IGI    A+ VSAKTG+GI   LE IVQ
Sbjct: 122 AIEADHEIVPVLNKIDLPASDCDRVAEQIEDVIGIDASGAIQVSAKTGQGIRETLEAIVQ 181

Query: 186 QLPSPTSPEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVER 245
            LP+P      +APLKA+L+DSWY+SYLGV+VLVRI++G L KG  ++ M     + V+R
Sbjct: 182 HLPAPKGTR--DAPLKAMLVDSWYDSYLGVIVLVRIMDGVLKKGMRVKFMSNGTLHHVDR 239

Query: 246 IGILTPKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVVF 305
           IG+  P M  ++ L PGEIG + ASIK+V  TRVGDTIT+D +    ALPGFKP QPVVF
Sbjct: 240 IGVFRPAMQAVDELGPGEIGFLTASIKQVRDTRVGDTITNDRNGAEKALPGFKPAQPVVF 299

Query: 306 CGLFPVDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERLE 365
           CGLFPVD+ +FE+LR AI+KL LNDASFSFE+E S ALGFGFRCGFLGLLHLE+I++R+E
Sbjct: 300 CGLFPVDSAEFEDLRDAIDKLALNDASFSFEMETSAALGFGFRCGFLGLLHLEVIRDRIE 359

Query: 366 REFSLNLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEYLG 425
           RE+ + LI T+PSV+Y ++M DG   +L NP DMP+++K+  + EP I+ TI+ P+EYLG
Sbjct: 360 REYDIELITTAPSVIYHVFMKDGEQIELHNPADMPDLSKVDHMEEPRIKATILVPDEYLG 419

Query: 426 SILKLCQERRGIQIDMSHLDNRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDYR 485
            +LKLCQ+RRGIQ+D+S+  +RAM+VY+LPLNEV+FDFYDRLKSV+KGYASFDY +I YR
Sbjct: 420 DVLKLCQDRRGIQMDLSYAGSRAMVVYDLPLNEVVFDFYDRLKSVTKGYASFDYQMIGYR 479

Query: 486 DSDLVKLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGGRI 545
             +LVK++ILVN+E +DALS +VHR  +E RGR +CEKLK LIP+ MF+I IQAAIGG++
Sbjct: 480 QDNLVKMSILVNDEPVDALSTMVHRDRAEMRGRAMCEKLKELIPRHMFKIPIQAAIGGKV 539

Query: 546 IARETVKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISILKTDN 605
           IARET+ A RKDVTAKCYGGD TRKRKLL+KQK GKK+MR+FG+VDIPQ AFIS LK D+
Sbjct: 540 IARETLSALRKDVTAKCYGGDATRKRKLLDKQKAGKKKMRQFGKVDIPQEAFISALKMDS 599


>gi|254439727|ref|ZP_05053221.1| GTP-binding protein LepA [Octadecabacter antarcticus 307]
 gi|198255173|gb|EDY79487.1| GTP-binding protein LepA [Octadecabacter antarcticus 307]
          Length = 598

 Score =  839 bits (2167), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 395/600 (65%), Positives = 492/600 (82%), Gaps = 3/600 (0%)

Query: 6   TPLSRIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQT 65
           T LS IRNFSIVAHIDHGKSTLADR IQ    + ER+M +Q+LD+MDIERERGITIKAQT
Sbjct: 2   TALSHIRNFSIVAHIDHGKSTLADRLIQSTNTVAERDMKAQMLDSMDIERERGITIKAQT 61

Query: 66  VRLNYTSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQ 125
           VR+NYT+ + +DY LNLIDTPGHVDF YEVSRS+ A EGSLLVVD+TQGVEAQTLANVY 
Sbjct: 62  VRINYTAKNGEDYVLNLIDTPGHVDFAYEVSRSMRAVEGSLLVVDSTQGVEAQTLANVYH 121

Query: 126 AIDNNHEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERIVQ 185
           AID NHEI+ + NK DLP++D  RV +Q+E+ IGI    A+ VSAKTGEGI   LE IV 
Sbjct: 122 AIDANHEIVPIFNKIDLPASDVSRVAEQVEDVIGIDASGAIAVSAKTGEGIVETLEAIVH 181

Query: 186 QLPSPTSPEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVER 245
           QLP+P      +APL+A+L+DSWY+SYLGV+VLVRII+G+L KG+ I+ +     + VER
Sbjct: 182 QLPAPKG--DPDAPLRAMLVDSWYDSYLGVIVLVRIIDGKLRKGEKIKFISNGTLHHVER 239

Query: 246 IGILTPKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVVF 305
           IG+  PKM +++ L PGEIG + ASIK+V  TRVGDTIT   S  T  LPGFKP QPVVF
Sbjct: 240 IGVFRPKMENVDELGPGEIGFLTASIKQVRDTRVGDTITHQKSEVTP-LPGFKPAQPVVF 298

Query: 306 CGLFPVDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERLE 365
           CGLFPVD+  FE+LR AI+KL LNDASFSFE+E+S ALGFGFRCGFLGLLHLE+I++R+E
Sbjct: 299 CGLFPVDSALFEDLREAIDKLALNDASFSFEMESSAALGFGFRCGFLGLLHLEVIRDRIE 358

Query: 366 REFSLNLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEYLG 425
           RE+ ++LI T+PSVVY ++M DG+M +L NP DMP++T I  + EP I+ TI+ P+EYLG
Sbjct: 359 REYDIDLITTAPSVVYHVHMRDGTMTELHNPADMPDMTLIDHIEEPRIKATILVPDEYLG 418

Query: 426 SILKLCQERRGIQIDMSHLDNRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDYR 485
            +LKLCQ+RRGIQ D+++  +RA++VY+LPLNEV+FDFYDRLKSV+KGYASFDY+++ YR
Sbjct: 419 DVLKLCQDRRGIQSDLTYAGSRALVVYDLPLNEVVFDFYDRLKSVTKGYASFDYSLMGYR 478

Query: 486 DSDLVKLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGGRI 545
           +  LVK+++LVN+E +DALS++VHR  +E RGR + EKLK+LIP+ MF+I IQAAIGG++
Sbjct: 479 EDALVKMSVLVNDEPVDALSMMVHRDRAEVRGRAMVEKLKDLIPRHMFKIPIQAAIGGKV 538

Query: 546 IARETVKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISILKTDN 605
           IARET+ A RKDVTAKCYGGD +RKRKLL+KQK GKK+MR+FG V+IPQ AFIS LK D+
Sbjct: 539 IARETLSAMRKDVTAKCYGGDASRKRKLLDKQKAGKKKMRQFGSVNIPQEAFISALKMDS 598


>gi|85707161|ref|ZP_01038248.1| GTP-binding protein LepA [Roseovarius sp. 217]
 gi|85668320|gb|EAQ23194.1| GTP-binding protein LepA [Roseovarius sp. 217]
          Length = 599

 Score =  839 bits (2167), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 394/600 (65%), Positives = 487/600 (81%), Gaps = 2/600 (0%)

Query: 6   TPLSRIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQT 65
           T L+ IRNFSIVAHIDHGKSTLADR IQ    + +R+M  Q+LD MDIERERGITIKA T
Sbjct: 2   TDLAHIRNFSIVAHIDHGKSTLADRLIQSTGTVQDRDMKEQMLDAMDIERERGITIKANT 61

Query: 66  VRLNYTSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQ 125
           VR++Y + D + Y LNLIDTPGHVDF YEVSRS+ A EGSLLVVD+TQGVEAQTLANVYQ
Sbjct: 62  VRIDYKAQDGEIYVLNLIDTPGHVDFAYEVSRSMRAVEGSLLVVDSTQGVEAQTLANVYQ 121

Query: 126 AIDNNHEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERIVQ 185
           AID  HEI+ +LNK DLP+++ DRV +QIE+ IGI    A+ VSAKTG GI   LE IV+
Sbjct: 122 AIDAGHEIVPILNKIDLPASECDRVAEQIEDVIGIDASGAIRVSAKTGVGIAETLEAIVK 181

Query: 186 QLPSPTSPEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVER 245
            LP+P   E A  PLKA+L+DSWY++YLGV+VLVRI++G++ KG  I +M T A Y VER
Sbjct: 182 HLPAPKGDEAA--PLKAMLVDSWYDAYLGVVVLVRIMDGRMKKGDRIHMMQTEATYNVER 239

Query: 246 IGILTPKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVVF 305
           IG+  P+M  +E+L PGEIG + ASIK+V  T+VGDTIT +  P   ALPGFKP  PVVF
Sbjct: 240 IGVFRPQMEKVESLGPGEIGFITASIKQVRDTKVGDTITHEKRPCAKALPGFKPSVPVVF 299

Query: 306 CGLFPVDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERLE 365
           CGLFPVD+ +FE+LR AI KL LNDASFS+E+E S ALGFGFRCGFLGLLHLE+I++R+E
Sbjct: 300 CGLFPVDSNEFEDLRNAIEKLALNDASFSYEMETSAALGFGFRCGFLGLLHLEVIRDRIE 359

Query: 366 REFSLNLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEYLG 425
           RE+ ++LI T+PSV+Y L+M DG+   L NP DMP++T ++ + EP I+ TI+ P+EYLG
Sbjct: 360 REYDIDLITTAPSVIYHLFMKDGTRADLHNPADMPDLTYVSHIEEPRIKATILVPDEYLG 419

Query: 426 SILKLCQERRGIQIDMSHLDNRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDYR 485
            +LKLCQ+RRGIQ+D+++  NRAM+VY+LPLNEV+FDFYDRLKSV+KGYASFDY +  YR
Sbjct: 420 DVLKLCQDRRGIQMDLTYAGNRAMVVYDLPLNEVVFDFYDRLKSVTKGYASFDYQLQGYR 479

Query: 486 DSDLVKLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGGRI 545
           +  LVK++ILVN+E +DALS++VHR  +E RGR + EKLK+LIP+ MF+I IQAAIGG++
Sbjct: 480 EDSLVKMSILVNDEPVDALSMMVHRDRAEMRGRAMVEKLKDLIPRHMFKIPIQAAIGGKV 539

Query: 546 IARETVKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISILKTDN 605
           IARET+ A RKDVTAKCYGGD TRK+KLLEKQK GKKRMR+FG+VDIPQ AFIS LK D+
Sbjct: 540 IARETLSAMRKDVTAKCYGGDATRKKKLLEKQKAGKKRMRQFGKVDIPQEAFISALKMDS 599


>gi|254459676|ref|ZP_05073092.1| GTP-binding protein LepA [Rhodobacterales bacterium HTCC2083]
 gi|206676265|gb|EDZ40752.1| GTP-binding protein LepA [Rhodobacteraceae bacterium HTCC2083]
          Length = 599

 Score =  837 bits (2162), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 389/600 (64%), Positives = 493/600 (82%), Gaps = 2/600 (0%)

Query: 6   TPLSRIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQT 65
           T L++IRNFSIVAHIDHGKSTLADR IQ    + +R+M  Q+LD+MDIERERGITIKA T
Sbjct: 2   TELNKIRNFSIVAHIDHGKSTLADRLIQETGTVKDRDMQEQMLDSMDIERERGITIKANT 61

Query: 66  VRLNYTSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQ 125
           VR++Y + D +DY LNLIDTPGHVDF YEVSRS+ A EGSLLVVD++QGVEAQTLANVY 
Sbjct: 62  VRIDYKADDGEDYVLNLIDTPGHVDFAYEVSRSMRAVEGSLLVVDSSQGVEAQTLANVYH 121

Query: 126 AIDNNHEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERIVQ 185
           A+D +HEI+++LNK DLP++D DRV +QIE+ IG+   DA+ VSAKTG+GI   LE IV 
Sbjct: 122 AMDADHEIVSILNKIDLPASDCDRVAEQIEDVIGLDATDAIQVSAKTGQGIRETLEAIVT 181

Query: 186 QLPSPTSPEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVER 245
           +LP+P      +APLKA+L+DSWY++YLGV+VLVRII+G L KG+ I+++  ++ + V+R
Sbjct: 182 RLPAPVGER--DAPLKAMLVDSWYDAYLGVIVLVRIIDGVLKKGERIKMLSNSSVHHVDR 239

Query: 246 IGILTPKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVVF 305
           IG+  P+  +I  L PGE+G + ASIK+V  TRVGDTIT +   T  ALPGFKP QPVVF
Sbjct: 240 IGVFKPQREEIAELGPGEMGFLTASIKQVRDTRVGDTITHEKKGTDEALPGFKPAQPVVF 299

Query: 306 CGLFPVDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERLE 365
           CGLFPVD+ +FE+LR AI+KL LNDASFSFE+E S ALGFGFRCGFLGLLHLE+I++R+E
Sbjct: 300 CGLFPVDSAEFEDLRDAIDKLALNDASFSFEMETSAALGFGFRCGFLGLLHLEVIRDRIE 359

Query: 366 REFSLNLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEYLG 425
           RE+++ LI T+PSV+Y ++M DG+MQ+L NP DMP++T +  ++EP I+ TI+ P+EYLG
Sbjct: 360 REYNIELITTAPSVIYHIHMKDGTMQELHNPADMPDLTFVDHMQEPRIKATILVPDEYLG 419

Query: 426 SILKLCQERRGIQIDMSHLDNRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDYR 485
            +LKLCQ+RRGIQ D+++   RAM+VY+LPLNEV+FDFYDRLKSV+KGYASFDY +  YR
Sbjct: 420 DVLKLCQDRRGIQEDLTYAGTRAMVVYDLPLNEVVFDFYDRLKSVTKGYASFDYQMTGYR 479

Query: 486 DSDLVKLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGGRI 545
              LVK++ILVN+E +DALS +VHR  +E RGR + EKLK+LIP+ MF+I IQAAIGG++
Sbjct: 480 QDHLVKMSILVNDEPVDALSTMVHRDRAEMRGRAMVEKLKDLIPRHMFKIPIQAAIGGKV 539

Query: 546 IARETVKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISILKTDN 605
           IARET+ A RKDVTAKCYGGD TRK+KLLEKQK GKK+MR+FG+VDIPQ AFIS LK D+
Sbjct: 540 IARETLSAMRKDVTAKCYGGDATRKKKLLEKQKAGKKKMRQFGKVDIPQEAFISALKMDS 599


>gi|163740713|ref|ZP_02148106.1| GTP-binding protein LepA [Phaeobacter gallaeciensis 2.10]
 gi|161385704|gb|EDQ10080.1| GTP-binding protein LepA [Phaeobacter gallaeciensis 2.10]
          Length = 604

 Score =  836 bits (2160), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 394/605 (65%), Positives = 493/605 (81%), Gaps = 7/605 (1%)

Query: 6   TPLSRIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQT 65
           T L+ IRNFSIVAHIDHGKSTLADR IQ    + +R+M  Q+LD+MDIERERGITIKA T
Sbjct: 2   TDLAHIRNFSIVAHIDHGKSTLADRLIQETGTVEDRDMKEQLLDSMDIERERGITIKANT 61

Query: 66  VRLNYTSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQ 125
           VR++Y + D + Y LNLIDTPGHVDF YEVSRS+ A EGSLLVVD++QGVEAQTLANVY 
Sbjct: 62  VRIDYKADDGETYVLNLIDTPGHVDFAYEVSRSMRAVEGSLLVVDSSQGVEAQTLANVYH 121

Query: 126 AIDNNHEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERIVQ 185
           A+D +HEI+ VLNK DLP++D DRV +QIE+ IGI   +A+ VSAKTG+GI   LE IVQ
Sbjct: 122 ALDADHEIVPVLNKIDLPASDCDRVAEQIEDVIGIDASEAIRVSAKTGQGIRETLEAIVQ 181

Query: 186 QLPSPTSPEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVER 245
            LP+PT     +APLKA+L+DSWY++YLGV+VLVRI++G L KG  ++ M  N  + V+R
Sbjct: 182 HLPAPTGTR--DAPLKAMLVDSWYDAYLGVIVLVRIMDGVLKKGMRVKFMSNNTLHHVDR 239

Query: 246 IGILTPKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVVF 305
           IG+  P M  ++ L PGEIG + ASIK+V  TRVGDTIT+D + T  ALPGFKP QPVVF
Sbjct: 240 IGVFRPAMQVVDQLEPGEIGFLTASIKQVRDTRVGDTITNDRNGTEVALPGFKPAQPVVF 299

Query: 306 CGLFPVDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERLE 365
           CGLFPVD+ +FE+LR AI+KL LNDASFSFE+E S ALGFGFRCGFLGLLHLE+I++R+E
Sbjct: 300 CGLFPVDSAEFEDLRDAIDKLALNDASFSFEMETSAALGFGFRCGFLGLLHLEVIRDRIE 359

Query: 366 REFSLNLIGTSPSVVYELYMH-----DGSMQKLSNPIDMPEVTKIAELREPWIQVTIITP 420
           RE+++ LI T+PSVVY +YM      +G M +L NP DMP+++K+  L+EP I+ TI+ P
Sbjct: 360 REYNIELITTAPSVVYHVYMKGKEGVEGEMIELHNPADMPDMSKVDHLQEPRIKATILVP 419

Query: 421 NEYLGSILKLCQERRGIQIDMSHLDNRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYN 480
           +EYLG +LKLCQ+RRGIQ D+++  +RAM+VY+LPLNEV+FDFYDRLKSV+KGYASFDY 
Sbjct: 420 DEYLGDVLKLCQDRRGIQEDLTYAGSRAMVVYDLPLNEVVFDFYDRLKSVTKGYASFDYQ 479

Query: 481 VIDYRDSDLVKLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAA 540
           +  YR+  LVK+++LVN+E +DALS++VHR  +E RGR +CEKLK+LIP+ MF+I IQAA
Sbjct: 480 MTGYREDALVKMSVLVNDEPVDALSMMVHRDRAEMRGRAMCEKLKDLIPRHMFKIPIQAA 539

Query: 541 IGGRIIARETVKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISI 600
           IGG++IARET+ A RKDVTAKCYGGD TRKRKLL+KQK GKK+MR+FG+VDIPQ AFIS 
Sbjct: 540 IGGKVIARETLSALRKDVTAKCYGGDATRKRKLLDKQKAGKKKMRQFGKVDIPQEAFISA 599

Query: 601 LKTDN 605
           LK D+
Sbjct: 600 LKMDS 604


>gi|260575327|ref|ZP_05843327.1| GTP-binding protein LepA [Rhodobacter sp. SW2]
 gi|259022587|gb|EEW25883.1| GTP-binding protein LepA [Rhodobacter sp. SW2]
          Length = 599

 Score =  836 bits (2160), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 396/600 (66%), Positives = 486/600 (81%), Gaps = 2/600 (0%)

Query: 6   TPLSRIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQT 65
           T L  IRNFSIVAHIDHGKSTLADR IQ    + +R+M +Q+LD+MDIERERGITIKA T
Sbjct: 2   TQLDLIRNFSIVAHIDHGKSTLADRLIQSTGTVKDRDMKAQLLDSMDIERERGITIKANT 61

Query: 66  VRLNYTSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQ 125
           VR+ Y + D K Y LNLIDTPGHVDF YEVSRS+ A EGSLLVVDA+QGVEAQTLANVYQ
Sbjct: 62  VRIEYPAKDGKTYILNLIDTPGHVDFAYEVSRSMRAVEGSLLVVDASQGVEAQTLANVYQ 121

Query: 126 AIDNNHEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERIVQ 185
           A+D  HEI+ VLNK DLP+A+P+R+K+QIE+ IG+  +DA+L+SAK+G GIP +LE IV 
Sbjct: 122 ALDAGHEIVPVLNKIDLPAAEPERIKQQIEDVIGLDAKDAILISAKSGLGIPDVLEAIVT 181

Query: 186 QLPSPTSPEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVER 245
           +LP+P       APLKA+L+DSWY++YLGV+V+VRI++G + KG  IR+M TNA Y ++ 
Sbjct: 182 RLPAPKGDR--EAPLKAMLVDSWYDAYLGVVVMVRIMDGVMKKGDRIRMMQTNAVYGIDT 239

Query: 246 IGILTPKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVVF 305
           + +L P+M+DI  L PGEIGV  ASIK+V  TRVGDTIT +     + LPGFKP QPVVF
Sbjct: 240 LAVLKPQMVDIAELGPGEIGVFTASIKQVRDTRVGDTITHERKGCETPLPGFKPAQPVVF 299

Query: 306 CGLFPVDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERLE 365
           CGLFPVDA  FE LR AI KL LNDASFS E+E S ALGFGFRCGFLGLLHLE+I++RLE
Sbjct: 300 CGLFPVDAADFEALRDAIEKLSLNDASFSSEMETSAALGFGFRCGFLGLLHLEVIRDRLE 359

Query: 366 REFSLNLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEYLG 425
           RE+ L+LI T+PSVV++LYM DG ++ L NP DMP++T +  + EP I+ TI+ P++YLG
Sbjct: 360 REYDLDLITTAPSVVFKLYMKDGEVRDLHNPADMPDLTFVDHIEEPRIKATIMVPDDYLG 419

Query: 426 SILKLCQERRGIQIDMSHLDNRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDYR 485
            ILKLCQ+RRGIQ+D+S+  +RAM+VY+LPL EV+FDFYDRLKSV+KGYASFDY +  YR
Sbjct: 420 DILKLCQDRRGIQLDLSYAGSRAMVVYDLPLAEVVFDFYDRLKSVTKGYASFDYTISGYR 479

Query: 486 DSDLVKLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGGRI 545
           +  LVK++ILVN E +DALS++VHR  +E RGR + EKLK LIP+ MF+I IQAAIG R+
Sbjct: 480 EDFLVKMSILVNEEPVDALSMMVHRDRAEARGRAMVEKLKELIPRHMFKIPIQAAIGSRV 539

Query: 546 IARETVKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISILKTDN 605
           IARET+ A RKDVTAKCYGGD TRKRKLL+KQK GKKRMR+FG+V+IPQ AFIS LK D 
Sbjct: 540 IARETLSAMRKDVTAKCYGGDATRKRKLLDKQKAGKKRMRQFGKVEIPQEAFISALKMDG 599


>gi|260426818|ref|ZP_05780797.1| GTP-binding protein LepA [Citreicella sp. SE45]
 gi|260421310|gb|EEX14561.1| GTP-binding protein LepA [Citreicella sp. SE45]
          Length = 609

 Score =  836 bits (2159), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 396/606 (65%), Positives = 488/606 (80%), Gaps = 3/606 (0%)

Query: 1   MQKKPTPLSRIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGIT 60
           +Q+  T L+ IRNFSIVAHIDHGKSTLADR IQ    + ER+M  Q+LD+MDIERERGIT
Sbjct: 6   IQQIMTDLAHIRNFSIVAHIDHGKSTLADRLIQLTGTVAERDMQEQMLDSMDIERERGIT 65

Query: 61  IKAQTVRLNYTSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTL 120
           IKA TVR+ Y + D + Y LNLIDTPGHVDF YEV+RS+ A EGSLLVVDATQGVEAQTL
Sbjct: 66  IKANTVRIEYPAQDGETYVLNLIDTPGHVDFAYEVARSMHAVEGSLLVVDATQGVEAQTL 125

Query: 121 ANVYQAIDNNHEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLL 180
           ANVY AID +HEI+ VLNK DLP+A+P+RVK QIE+ IGI ++DA L+SAKTG GIP +L
Sbjct: 126 ANVYTAIDADHEIVPVLNKVDLPAAEPERVKTQIEDVIGIDSQDACLISAKTGVGIPDVL 185

Query: 181 ERIVQQLPSPTSPEG-ANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNA 239
           E IV++LP+P  PEG  N PLKA+L+DS Y+ YLGV+ +VRII+G L KG  IR+M T  
Sbjct: 186 EAIVKRLPAP--PEGDRNKPLKAMLVDSKYDQYLGVICIVRIIDGVLKKGDRIRMMKTGG 243

Query: 240 KYQVERIGILTPKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKP 299
            Y V+ +G+  P M +++ L PGEIG + ASIK+V  TRVGDTIT +  P    LPGFKP
Sbjct: 244 TYDVDDVGVYRPAMTNVKELGPGEIGYLNASIKQVRDTRVGDTITHEKKPCAEPLPGFKP 303

Query: 300 IQPVVFCGLFPVDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEI 359
             PVVFCGLFPVDA  FE++R AI KL LNDASF+FE+E S ALGFGFRCGFLGLLHLE+
Sbjct: 304 SVPVVFCGLFPVDANDFEDMRDAIEKLALNDASFTFEMETSAALGFGFRCGFLGLLHLEV 363

Query: 360 IQERLEREFSLNLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIIT 419
           I++RLERE+++ LI T+PSV+Y L+  DG  + L NP DMP+ + +  + EP I+ TI+ 
Sbjct: 364 IRDRLEREYNIELITTAPSVIYHLFTKDGERRDLHNPADMPDASTVDHIEEPRIKATIMV 423

Query: 420 PNEYLGSILKLCQERRGIQIDMSHLDNRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDY 479
           P+EYLG +LKLCQERRGIQ+D++++  RAM VY+LPLNEV+FDFYDRLKSV+KGYASFDY
Sbjct: 424 PDEYLGDVLKLCQERRGIQMDLTYVGGRAMTVYDLPLNEVVFDFYDRLKSVTKGYASFDY 483

Query: 480 NVIDYRDSDLVKLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQA 539
            +I YR+  LVK++ILVN+E +DAL+++VHR  +E RGR +CEKLK LIP+ MF+I IQA
Sbjct: 484 EMIGYREDSLVKMSILVNDEPVDALAMMVHRDRAEMRGRAMCEKLKELIPRHMFKIPIQA 543

Query: 540 AIGGRIIARETVKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFIS 599
           AIGG++IARET+ A RKDVTAKCYGGD TRK+KLLEKQK GKK+MR+FG+VDIPQ AFIS
Sbjct: 544 AIGGKVIARETLSAMRKDVTAKCYGGDATRKKKLLEKQKAGKKKMRQFGKVDIPQEAFIS 603

Query: 600 ILKTDN 605
            LK D+
Sbjct: 604 ALKMDS 609


>gi|149203597|ref|ZP_01880566.1| GTP-binding protein LepA [Roseovarius sp. TM1035]
 gi|149142714|gb|EDM30756.1| GTP-binding protein LepA [Roseovarius sp. TM1035]
          Length = 599

 Score =  835 bits (2158), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 392/600 (65%), Positives = 489/600 (81%), Gaps = 2/600 (0%)

Query: 6   TPLSRIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQT 65
           T L+ IRNFSIVAHIDHGKSTLADR IQ    + +R+M +Q+LD MDIERERGITIKA T
Sbjct: 2   TDLAHIRNFSIVAHIDHGKSTLADRLIQSTGTVQDRDMKAQMLDAMDIERERGITIKANT 61

Query: 66  VRLNYTSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQ 125
           VR++Y + + + Y LNLIDTPGHVDF YEVSRS+ A EGSLLVVD+TQGVEAQTLANVYQ
Sbjct: 62  VRIDYKAQNGELYVLNLIDTPGHVDFAYEVSRSMRAVEGSLLVVDSTQGVEAQTLANVYQ 121

Query: 126 AIDNNHEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERIVQ 185
           AID  HEI+ +LNK DLP+++ DRV +QIE+ IGI    A+ VSAKTG GI   LE IV+
Sbjct: 122 AIDAGHEIVPILNKIDLPASECDRVAEQIEDVIGIDASGAIRVSAKTGVGIAETLEAIVK 181

Query: 186 QLPSPTSPEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVER 245
            LP+P   E  NAPLKA+L+DSWY++YLGV+VLVRI++G++ +G  I ++ T A Y VER
Sbjct: 182 HLPAPKGDE--NAPLKAMLVDSWYDAYLGVVVLVRIMDGRMKRGDRIHMIQTEATYNVER 239

Query: 246 IGILTPKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVVF 305
           IG+  P+M  +E+L PGEIG + ASIK+V  T+VGDTIT +  P   ALPGFKP  PVVF
Sbjct: 240 IGVFRPQMEKVESLGPGEIGFITASIKQVRDTKVGDTITHEKRPCDKALPGFKPSVPVVF 299

Query: 306 CGLFPVDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERLE 365
           CGLFPVD+ +FE+LR AI KL LNDASFS+E+E S ALGFGFRCGFLGLLHLE+I++R+E
Sbjct: 300 CGLFPVDSNEFEDLRDAIEKLALNDASFSYEMETSAALGFGFRCGFLGLLHLEVIRDRIE 359

Query: 366 REFSLNLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEYLG 425
           RE+++ LI T+PSV+Y LYM DGS + L NP DMP++T +  + EP I+ TI+ P+EYLG
Sbjct: 360 REYNIELITTAPSVIYHLYMKDGSRRDLHNPADMPDLTYVGHIEEPRIKATILVPDEYLG 419

Query: 426 SILKLCQERRGIQIDMSHLDNRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDYR 485
            +LKLCQ+RRGIQ+D+++   RAM+VY+LPLNEV+FDFYDRLKSV+KGYASFDY++  YR
Sbjct: 420 DVLKLCQDRRGIQMDLTYAGARAMVVYDLPLNEVVFDFYDRLKSVTKGYASFDYHLEGYR 479

Query: 486 DSDLVKLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGGRI 545
           +  LVK+ +LVN+E +DALS++VHR  +E RGR +CEKLK+LIP+ MF+I IQAAIGG++
Sbjct: 480 EDSLVKMQVLVNDEPVDALSMMVHRDRAEMRGRAMCEKLKDLIPRHMFKIPIQAAIGGKV 539

Query: 546 IARETVKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISILKTDN 605
           IARET+ A RKDVTAKCYGGD TRK+KLLEKQK GKK+MR+FG+VDIPQ AFIS LK D+
Sbjct: 540 IARETLSALRKDVTAKCYGGDATRKKKLLEKQKAGKKKMRQFGKVDIPQEAFISALKMDS 599


>gi|209965686|ref|YP_002298601.1| GTP-binding protein LepA [Rhodospirillum centenum SW]
 gi|238057818|sp|B6IUG3|LEPA_RHOCS RecName: Full=Elongation factor 4; Short=EF-4; AltName:
           Full=Ribosomal back-translocase LepA
 gi|209959152|gb|ACI99788.1| GTP-binding protein LepA [Rhodospirillum centenum SW]
          Length = 600

 Score =  834 bits (2154), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 396/601 (65%), Positives = 496/601 (82%), Gaps = 2/601 (0%)

Query: 6   TPLSRIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQT 65
           T LSRIRNFSI+AHIDHGKSTLADR I+ C  +  REM +Q+LDNMDIERERGITIKAQT
Sbjct: 2   TDLSRIRNFSIIAHIDHGKSTLADRLIEFCGAIEAREMKAQLLDNMDIERERGITIKAQT 61

Query: 66  VRLNYTSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQ 125
           VRLNY + D + YQLNL+DTPGHVDF YEVSRSL+ACEGS+LVVDA+QGVEAQTLANVYQ
Sbjct: 62  VRLNYKAKDGEIYQLNLMDTPGHVDFAYEVSRSLAACEGSILVVDASQGVEAQTLANVYQ 121

Query: 126 AIDNNHEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERIVQ 185
           AID NHEI+ VLNK DLP+AD  RVK+QIE+ IG+   DA+ VSAK+G  I  +LE IV 
Sbjct: 122 AIDANHEIVPVLNKIDLPAADVPRVKQQIEDVIGLDASDAVEVSAKSGINIDGVLEAIVT 181

Query: 186 QLPSPTSPEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVER 245
           +LP P     A APL+AL++DSWY++YLGV+VLVR++NG+L  GQ +R M T A  +++R
Sbjct: 182 RLPPPKG--DAAAPLQALIVDSWYDAYLGVVVLVRVVNGELRTGQKVRFMATGATRELDR 239

Query: 246 IGILTPKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVVF 305
           +GI  PK + ++ L PGE+G + A+IK++  T+VGDTIT++     + LPGFKP  PVVF
Sbjct: 240 VGIFGPKKMLVDRLGPGEMGFVTAAIKDIRDTKVGDTITEEKRLAPTPLPGFKPSIPVVF 299

Query: 306 CGLFPVDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERLE 365
           CGLFP DA  FE+LR ++ KL LNDASF FE+E+S ALGFGFRCGFLGLLHLEIIQERLE
Sbjct: 300 CGLFPTDAADFEDLRESLGKLALNDASFQFEMESSAALGFGFRCGFLGLLHLEIIQERLE 359

Query: 366 REFSLNLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEYLG 425
           REF+L+LI T+PSVVY ++M+DG+M+++ NP DMP+  KI  + EPWI+  I+ P+EYLG
Sbjct: 360 REFNLDLITTAPSVVYRMHMNDGTMKEMHNPADMPDPVKIDRIEEPWIKANIMLPDEYLG 419

Query: 426 SILKLCQERRGIQIDMSHLDNRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDYR 485
            +L+LC ERRGIQ D++++  RAM+VYELPLNEV+FDFYDRLKS+S+GYASFDY +  YR
Sbjct: 420 GVLQLCTERRGIQKDLTYVGGRAMLVYELPLNEVVFDFYDRLKSISRGYASFDYVLEGYR 479

Query: 486 DSDLVKLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGGRI 545
           + DLVK++ILVNNE +DAL+++VHR+ +E RGR +CE+LK+LIP+ +F+I IQAAIGGR+
Sbjct: 480 EGDLVKMSILVNNEPVDALAMIVHRTQAEYRGRQLCERLKDLIPRHLFKIPIQAAIGGRV 539

Query: 546 IARETVKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISILKTDN 605
           IARET+ A RKDV AKCYGGDI+RKRKLL+KQKEGKKRMR+FG V+IPQSAFI+ L+   
Sbjct: 540 IARETIAALRKDVLAKCYGGDISRKRKLLDKQKEGKKRMRQFGEVEIPQSAFIAALRMGQ 599

Query: 606 E 606
           E
Sbjct: 600 E 600


>gi|332186183|ref|ZP_08387929.1| GTP-binding protein LepA [Sphingomonas sp. S17]
 gi|332013998|gb|EGI56057.1| GTP-binding protein LepA [Sphingomonas sp. S17]
          Length = 603

 Score =  834 bits (2154), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 391/602 (64%), Positives = 482/602 (80%), Gaps = 3/602 (0%)

Query: 6   TPLSRIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQT 65
           TPL +IRNFSI+AHIDHGKSTLADR IQ   GLT+REMS QVLDNM+IE+ERGITIKAQT
Sbjct: 3   TPLDKIRNFSIIAHIDHGKSTLADRLIQFTGGLTDREMSEQVLDNMEIEKERGITIKAQT 62

Query: 66  VRLNYTSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQ 125
           VRL Y + D + Y LNL+DTPGHVDF YEVSRSL+ACEG+LLVVDA QGVEAQTLANVYQ
Sbjct: 63  VRLAYKAQDGETYTLNLMDTPGHVDFAYEVSRSLAACEGALLVVDAAQGVEAQTLANVYQ 122

Query: 126 AIDNNHEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERIVQ 185
           +I+++HEI+ V+NK DLP+A+P++V+ +IE+ IGI    A+L SAK+G GI  +LE IV+
Sbjct: 123 SIEHDHEIVPVINKIDLPAAEPEKVRAEIEDVIGIDASGAVLASAKSGIGIGDILEAIVK 182

Query: 186 QLPSPTSPEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVER 245
            +P+P     A APLKA+L+DSWY+ YLGV++LVR++ G L KGQ I+ M     + ++R
Sbjct: 183 NIPAPKGD--ATAPLKAMLVDSWYDPYLGVVILVRVMEGTLKKGQQIKFMQAGTTHLIDR 240

Query: 246 IGILTPKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVVF 305
           +G   PK+  +  L  GEIG + A IK+V+  RVGDT+TD   PT  ALPGFK +QPVVF
Sbjct: 241 VGCFRPKIEQLTELGVGEIGFITAQIKDVAQARVGDTLTDAKKPTEQALPGFKEVQPVVF 300

Query: 306 CGLFPVDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERLE 365
           CGLFPVDA  FE LR +I+KLRLNDASFSFE+E S ALGFGFRCGFLGLLHLEIIQERL 
Sbjct: 301 CGLFPVDANDFEKLRESISKLRLNDASFSFEMETSAALGFGFRCGFLGLLHLEIIQERLT 360

Query: 366 REFSLNLIGTSPSVVYELYM-HDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEYL 424
           RE+ L+LI T+PSVVY++ + H G    L NP DMP+  KI  + EPWI+ TI  P+EYL
Sbjct: 361 REYDLDLITTAPSVVYQIELTHGGGQIDLHNPADMPDPNKIESISEPWIEATIYVPDEYL 420

Query: 425 GSILKLCQERRGIQIDMSHLDNRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDY 484
           GSILKLCQ+RRGIQ +++++  RA   YELPLNEV+FDFYDRLKS+SKGYASFDY+ I Y
Sbjct: 421 GSILKLCQDRRGIQKNLTYVGGRAQATYELPLNEVVFDFYDRLKSLSKGYASFDYHQIGY 480

Query: 485 RDSDLVKLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGGR 544
           R+ DLVK++ILVN E +DALS++VHR  +E RGRG+CE+LK LIP+ +F+I IQAAIGG+
Sbjct: 481 REGDLVKMSILVNEEPVDALSMIVHRGTAETRGRGMCERLKELIPRHLFKIPIQAAIGGK 540

Query: 545 IIARETVKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISILKTD 604
           +IARET+ A RKDVTAKCYGGD TRKRKLLEKQK+GK +MR +G V IPQ AFI+ L+  
Sbjct: 541 VIARETISAMRKDVTAKCYGGDATRKRKLLEKQKKGKAKMREYGSVSIPQEAFIAALRMG 600

Query: 605 NE 606
           +E
Sbjct: 601 DE 602


>gi|254454379|ref|ZP_05067816.1| GTP-binding protein LepA [Octadecabacter antarcticus 238]
 gi|198268785|gb|EDY93055.1| GTP-binding protein LepA [Octadecabacter antarcticus 238]
          Length = 598

 Score =  834 bits (2154), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 392/601 (65%), Positives = 492/601 (81%), Gaps = 5/601 (0%)

Query: 6   TPLSRIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQT 65
           T LS IRNFSIVAHIDHGKSTLADR IQ    + ER+M +Q+LD+MDIERERGITIKA T
Sbjct: 2   TALSHIRNFSIVAHIDHGKSTLADRLIQSTNTVAERDMKAQMLDSMDIERERGITIKANT 61

Query: 66  VRLNYTSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQ 125
           VR++YT+ + + Y LNLIDTPGHVDF YEVSRS+ A EGSLLVVD+TQGVEAQTLANVY 
Sbjct: 62  VRIDYTAKNGESYVLNLIDTPGHVDFAYEVSRSMRAVEGSLLVVDSTQGVEAQTLANVYH 121

Query: 126 AIDNNHEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERIVQ 185
           A+D +HEI+ + NK DLP++D  RV +Q+E+ IG+    A+ VSAKTGEGI   LE IV 
Sbjct: 122 ALDADHEIVPIFNKIDLPASDVSRVAQQVEDVIGLDASGAIAVSAKTGEGIIETLEAIVH 181

Query: 186 QLPSPTS-PEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVE 244
           QLP+P   P+G   PLKA+L+DSWY+SYLGV+VLVRII+G+L KG+ ++ +     +QVE
Sbjct: 182 QLPAPKGDPDG---PLKAMLVDSWYDSYLGVIVLVRIIDGKLRKGEKVKFISNGTIHQVE 238

Query: 245 RIGILTPKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVV 304
           RIG+  PKM +++ L PGEIG + ASIK+V  TRVGDTIT   S  T  LPGFKP QPVV
Sbjct: 239 RIGVFRPKMENVDELGPGEIGFLTASIKQVRDTRVGDTITHQKSEVTP-LPGFKPAQPVV 297

Query: 305 FCGLFPVDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERL 364
           FCGLFPVD+  FE+LR AI+KL LNDASFSFE+E+S ALGFGFRCGFLGLLHLE+I++R+
Sbjct: 298 FCGLFPVDSALFEDLRDAIDKLALNDASFSFEMESSAALGFGFRCGFLGLLHLEVIRDRI 357

Query: 365 EREFSLNLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEYL 424
           ERE+ ++LI T+PSVVYE+YM DG+M +L NP DMP++T +  + EP I+ TI+ P+EYL
Sbjct: 358 EREYDIDLITTAPSVVYEVYMRDGTMSELHNPADMPDMTLVDHIEEPRIKATILVPDEYL 417

Query: 425 GSILKLCQERRGIQIDMSHLDNRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDY 484
           G +LKLCQ+RRGIQ D+++  +RA++VY+LPLNEV+FDFYDRLKSV+KGYASFDY ++ Y
Sbjct: 418 GDVLKLCQDRRGIQSDLTYAGSRALVVYDLPLNEVVFDFYDRLKSVTKGYASFDYTLMGY 477

Query: 485 RDSDLVKLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGGR 544
           R+  LVK+++LVN+E +DALS++VHR  +E RGR + EKLK+LIP+ MF+I IQAAIGG+
Sbjct: 478 REDALVKMSVLVNDEPVDALSMMVHRDRAEVRGRAMVEKLKDLIPRHMFKIPIQAAIGGK 537

Query: 545 IIARETVKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISILKTD 604
           +IARET+ A RKDVTAKCYGGD +RKRKLL+KQK GKK+MR+FG V+IPQ AFIS LK D
Sbjct: 538 VIARETLSAMRKDVTAKCYGGDASRKRKLLDKQKAGKKKMRQFGSVNIPQEAFISALKMD 597

Query: 605 N 605
           +
Sbjct: 598 S 598


>gi|89055922|ref|YP_511373.1| GTP-binding protein LepA [Jannaschia sp. CCS1]
 gi|119371359|sp|Q28LR4|LEPA_JANSC RecName: Full=Elongation factor 4; Short=EF-4; AltName:
           Full=Ribosomal back-translocase LepA
 gi|88865471|gb|ABD56348.1| GTP-binding protein LepA [Jannaschia sp. CCS1]
          Length = 599

 Score =  833 bits (2153), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 395/600 (65%), Positives = 484/600 (80%), Gaps = 2/600 (0%)

Query: 6   TPLSRIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQT 65
           T L+RIRNFSIVAHIDHGKSTLADR IQ    +  R+M +Q+LD MDIERERGITIKA T
Sbjct: 2   TDLNRIRNFSIVAHIDHGKSTLADRLIQLTGTVAARDMQAQLLDQMDIERERGITIKANT 61

Query: 66  VRLNYTSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQ 125
           VR+ Y + D   Y LNLIDTPGHVDF YEVSRS+ A EGSLLVVDA+QGVEAQTLANVYQ
Sbjct: 62  VRIEYPAKDGHTYILNLIDTPGHVDFAYEVSRSMQAVEGSLLVVDASQGVEAQTLANVYQ 121

Query: 126 AIDNNHEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERIVQ 185
           AID +HEI+ VLNK DLP+A+PDRV++QIE+ IGI   +A+ +SAKTG GIP +LE IV 
Sbjct: 122 AIDADHEIVPVLNKVDLPAAEPDRVREQIEDVIGIDASEAVEISAKTGIGIPDVLEAIVT 181

Query: 186 QLPSPTSPEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVER 245
           +LP+P      +APLKA+L+DS+Y+SYLGV+VL+R+I+G + KG  I++M T  +Y V+R
Sbjct: 182 RLPAPKGDR--DAPLKAMLVDSYYDSYLGVVVLIRVIDGVIKKGDKIKMMRTGGQYPVDR 239

Query: 246 IGILTPKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVVF 305
           +G+ TPKM DI  L PGE+G + ASIK+V  TRVGDTIT D       L GFKP QPVVF
Sbjct: 240 LGVFTPKMKDIGELGPGEMGFLTASIKQVRDTRVGDTITHDKHGAEQPLAGFKPSQPVVF 299

Query: 306 CGLFPVDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERLE 365
           CGLFPVD  QFE+LR AI KL LNDASFS E+E S ALGFGFRCGFLGLLHLE+I++RLE
Sbjct: 300 CGLFPVDTNQFEDLRDAIEKLALNDASFSHEMETSAALGFGFRCGFLGLLHLEVIRDRLE 359

Query: 366 REFSLNLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEYLG 425
           RE+ ++LI T+PSV+Y ++M D +M  L NP DMP+   I  + EP I+ TI+ P++YLG
Sbjct: 360 REYDIDLITTAPSVIYHVHMRDETMVDLHNPADMPDPAAIDRIEEPRIKATILVPDDYLG 419

Query: 426 SILKLCQERRGIQIDMSHLDNRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDYR 485
            +LKLCQ+RRGIQID+++   RAM+VY+LPLNEV+FDFYDRLKSV+KGYASFDY +I YR
Sbjct: 420 DVLKLCQDRRGIQIDLTYAGTRAMVVYDLPLNEVVFDFYDRLKSVTKGYASFDYQMIGYR 479

Query: 486 DSDLVKLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGGRI 545
           +  LVK+ +LVN+E +DALSI+VHR  +E RGR + EKLK+LIP+ MF+I IQAAIGGR+
Sbjct: 480 EDALVKMQVLVNDEPVDALSIMVHRDRAETRGRAMVEKLKDLIPRHMFKIPIQAAIGGRV 539

Query: 546 IARETVKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISILKTDN 605
           IARET+ A RKDVTAKCYGGD +RKRKLL+KQK GKK+MR+FG+V+IPQSAFIS LK D 
Sbjct: 540 IARETLSAMRKDVTAKCYGGDASRKRKLLDKQKAGKKKMRQFGKVEIPQSAFISALKMDG 599


>gi|254474866|ref|ZP_05088252.1| GTP-binding protein LepA [Ruegeria sp. R11]
 gi|214029109|gb|EEB69944.1| GTP-binding protein LepA [Ruegeria sp. R11]
          Length = 604

 Score =  833 bits (2152), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 391/605 (64%), Positives = 493/605 (81%), Gaps = 7/605 (1%)

Query: 6   TPLSRIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQT 65
           T L +IRNFSIVAHIDHGKSTLADR IQ    + +R+M  Q+LD+MDIERERGITIKA T
Sbjct: 2   TELDKIRNFSIVAHIDHGKSTLADRLIQETGTVEDRDMKEQLLDSMDIERERGITIKANT 61

Query: 66  VRLNYTSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQ 125
           VR++Y + + + Y LNLIDTPGHVDF YEVSRS+ A EGSLLVVD+TQGVEAQTLANVYQ
Sbjct: 62  VRIDYKAENGETYVLNLIDTPGHVDFAYEVSRSMRAVEGSLLVVDSTQGVEAQTLANVYQ 121

Query: 126 AIDNNHEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERIVQ 185
           AID +HEI+ VLNK DLP++D DRV +QIE+ IGI   DA+ VSAKTG+GI   LE IV 
Sbjct: 122 AIDADHEIVPVLNKIDLPASDCDRVAEQIEDVIGIDATDAIQVSAKTGQGIRETLEAIVH 181

Query: 186 QLPSPTSPEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVER 245
           +LP+P+     +APLKA+L+DSWY++YLGV+VLVRI++G L KG  ++ M     + V+R
Sbjct: 182 KLPAPSGDR--DAPLKAMLVDSWYDAYLGVIVLVRIMDGTLKKGMRVKFMSNGTLHHVDR 239

Query: 246 IGILTPKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVVF 305
           IG+  P M  ++ L PGEIG + ASIK+V  TRVGDTIT+D + T  ALPG+KP QPVVF
Sbjct: 240 IGVFRPAMQAVDVLGPGEIGFLTASIKQVRDTRVGDTITNDRNGTELALPGYKPAQPVVF 299

Query: 306 CGLFPVDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERLE 365
           CGLFPVD+ +FE+LR AI+KL LNDASFS+E+E S ALGFGFRCGFLGLLHLE+I++R+E
Sbjct: 300 CGLFPVDSAEFEDLRDAIDKLALNDASFSYEMETSAALGFGFRCGFLGLLHLEVIRDRIE 359

Query: 366 REFSLNLIGTSPSVVYELYMH-----DGSMQKLSNPIDMPEVTKIAELREPWIQVTIITP 420
           RE+++ LI T+PSVVY +YM      +G M +L NP DMP+++K+  + EP I+ TI+ P
Sbjct: 360 REYNIELITTAPSVVYHVYMKGKEGIEGEMIELHNPADMPDMSKVDHIEEPRIKATILVP 419

Query: 421 NEYLGSILKLCQERRGIQIDMSHLDNRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYN 480
           +EYLG +LKLCQ+RRGIQ D+++  +RAM+VY+LPLNEV+FDFYDRLKSV+KGYASFDY 
Sbjct: 420 DEYLGDVLKLCQDRRGIQEDLTYAGSRAMVVYDLPLNEVVFDFYDRLKSVTKGYASFDYQ 479

Query: 481 VIDYRDSDLVKLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAA 540
           +  YR+ +LVK+++LVN+E +DALS++VHR  +E RGR +CEKLK+LIP+ MF+I IQAA
Sbjct: 480 MTGYREDNLVKMSVLVNDEPVDALSMMVHRDRAEMRGRAMCEKLKDLIPRHMFKIPIQAA 539

Query: 541 IGGRIIARETVKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISI 600
           IGG++IARET+ A RKDVTAKCYGGD TRKRKLL+KQK GKK+MR+FG+VDIPQ AFIS 
Sbjct: 540 IGGKVIARETLSALRKDVTAKCYGGDATRKRKLLDKQKAGKKKMRQFGKVDIPQEAFISA 599

Query: 601 LKTDN 605
           LK D+
Sbjct: 600 LKMDS 604


>gi|163737702|ref|ZP_02145119.1| GTP-binding protein LepA [Phaeobacter gallaeciensis BS107]
 gi|161389228|gb|EDQ13580.1| GTP-binding protein LepA [Phaeobacter gallaeciensis BS107]
          Length = 604

 Score =  833 bits (2152), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 393/605 (64%), Positives = 492/605 (81%), Gaps = 7/605 (1%)

Query: 6   TPLSRIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQT 65
           T L+ IRNFSIVAHIDHGKSTLADR IQ    + +R+M  Q+LD+MDIERERGITIKA T
Sbjct: 2   TDLAHIRNFSIVAHIDHGKSTLADRLIQETGTVEDRDMKEQLLDSMDIERERGITIKANT 61

Query: 66  VRLNYTSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQ 125
           VR++Y + D + Y LNLIDTPGHVDF YEVSRS+ A EGSLLVVD++QGVEAQTLANVY 
Sbjct: 62  VRIDYKADDGETYVLNLIDTPGHVDFAYEVSRSMRAVEGSLLVVDSSQGVEAQTLANVYH 121

Query: 126 AIDNNHEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERIVQ 185
           A+D +HEI+ VLNK DLP++D DRV +QIE+ IGI   +A+ VSAKTG+GI   LE IV+
Sbjct: 122 ALDADHEIVPVLNKIDLPASDCDRVAEQIEDVIGIDASEAIRVSAKTGQGIRETLEAIVK 181

Query: 186 QLPSPTSPEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVER 245
            LP+PT     +APLKA+L+DSWY++YLGV+VLVRI++G L KG  ++ M  N  + V+R
Sbjct: 182 TLPAPTGTR--DAPLKAMLVDSWYDAYLGVIVLVRIMDGVLKKGMRVKFMSNNTLHHVDR 239

Query: 246 IGILTPKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVVF 305
           IG+  P M  ++ L PGEIG + ASIK+V  TRVGDTIT+D + T  ALPGFKP QPVVF
Sbjct: 240 IGVFRPAMQVVDQLEPGEIGFLTASIKQVRDTRVGDTITNDRNGTEVALPGFKPAQPVVF 299

Query: 306 CGLFPVDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERLE 365
           CGLFPVD+ +FE+LR AI+KL LNDASFSFE+E S ALGFGFRCGFLGLLHLE+I++R+E
Sbjct: 300 CGLFPVDSAEFEDLRDAIDKLALNDASFSFEMETSAALGFGFRCGFLGLLHLEVIRDRIE 359

Query: 366 REFSLNLIGTSPSVVYELYMHD-----GSMQKLSNPIDMPEVTKIAELREPWIQVTIITP 420
           RE+++ LI T+PSVVY +YM       G M +L NP DMP+++K+  L+EP I+ TI+ P
Sbjct: 360 REYNIELITTAPSVVYHVYMKGKDGEAGEMIELHNPADMPDMSKVDHLQEPRIKATILVP 419

Query: 421 NEYLGSILKLCQERRGIQIDMSHLDNRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYN 480
           +EYLG +LKLCQ+RRGIQ D+++  +RAM+VY+LPLNEV+FDFYDRLKSV+KGYASFDY 
Sbjct: 420 DEYLGDVLKLCQDRRGIQEDLTYAGSRAMVVYDLPLNEVVFDFYDRLKSVTKGYASFDYQ 479

Query: 481 VIDYRDSDLVKLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAA 540
           +  YR+  LVK+++LVN+E +DALS++VHR  +E RGR +CEKLK+LIP+ MF+I IQAA
Sbjct: 480 MTGYREDALVKMSVLVNDEPVDALSMMVHRDRAEMRGRAMCEKLKDLIPRHMFKIPIQAA 539

Query: 541 IGGRIIARETVKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISI 600
           IGG++IARET+ A RKDVTAKCYGGD TRKRKLL+KQK GKK+MR+FG+VDIPQ AFIS 
Sbjct: 540 IGGKVIARETLSALRKDVTAKCYGGDATRKRKLLDKQKAGKKKMRQFGKVDIPQEAFISA 599

Query: 601 LKTDN 605
           LK D+
Sbjct: 600 LKMDS 604


>gi|89068542|ref|ZP_01155939.1| GTP-binding protein LepA [Oceanicola granulosus HTCC2516]
 gi|89045961|gb|EAR52021.1| GTP-binding protein LepA [Oceanicola granulosus HTCC2516]
          Length = 600

 Score =  833 bits (2151), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 395/598 (66%), Positives = 487/598 (81%), Gaps = 1/598 (0%)

Query: 8   LSRIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVR 67
           L+ IRNFSIVAHIDHGKSTLADR IQ    + ER+M +Q+LD+MDIERERGITIKA TVR
Sbjct: 4   LAHIRNFSIVAHIDHGKSTLADRLIQLTGTVAERDMKAQLLDSMDIERERGITIKANTVR 63

Query: 68  LNYTSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQAI 127
           ++Y + D   Y LNLIDTPGHVDF YEVSRS+ A EGSLLVVDATQGVEAQTLANVY AI
Sbjct: 64  IDYPAKDGHTYVLNLIDTPGHVDFGYEVSRSMQAVEGSLLVVDATQGVEAQTLANVYTAI 123

Query: 128 DNNHEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERIVQQL 187
           + +HEI+ VLNK DLP+A+P+R+ +QIE+ IGI   DA ++SAKTG GIP +LE IV +L
Sbjct: 124 EADHEIVPVLNKIDLPAAEPERIIEQIEDVIGIEAHDACMISAKTGLGIPDVLEAIVTRL 183

Query: 188 PSPTSPEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVERIG 247
           P P       APLKALL+DS Y+ YLGV+V+VRII+G L KGQ IR+M T   Y V+R+G
Sbjct: 184 PPPKG-GSREAPLKALLVDSKYDPYLGVVVIVRIIDGVLKKGQRIRMMKTGGTYDVDRVG 242

Query: 248 ILTPKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVVFCG 307
           +  P M D+  L PGEIG + ASIK+V  TRVGDTIT +   T + LPGFKP  PVVFCG
Sbjct: 243 VYRPAMQDVAELGPGEIGFLTASIKQVRDTRVGDTITTEKKGTDTPLPGFKPSIPVVFCG 302

Query: 308 LFPVDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERLERE 367
           LFPVD ++FE+LR AI KL LNDASFSFE+E S ALGFGFRCGFLGLLHLE+I++R+ERE
Sbjct: 303 LFPVDTSEFEDLRDAIEKLALNDASFSFEMETSAALGFGFRCGFLGLLHLEVIRDRIERE 362

Query: 368 FSLNLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEYLGSI 427
           +++ LI T+PSVVY LYM DG M++L NP DMP+ T +A + EP I+ TI+ P++YLG +
Sbjct: 363 YNIELITTAPSVVYHLYMKDGEMRELHNPADMPDPTYVAHIEEPRIKATILVPDDYLGDV 422

Query: 428 LKLCQERRGIQIDMSHLDNRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDYRDS 487
           LKLCQ+RRGIQ ++++  +R ++VY+LPLNEV+FDFYDRLKSV+KGYASFDY +I YR+ 
Sbjct: 423 LKLCQDRRGIQQELTYAGSRPLVVYDLPLNEVVFDFYDRLKSVTKGYASFDYQMIGYRED 482

Query: 488 DLVKLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGGRIIA 547
           +LVK++ILVN+E +DALS++VHR  +E+RGR +CEKLK LIP+ MF+I IQAAIGG++IA
Sbjct: 483 NLVKMSILVNDEPVDALSMMVHRDRAEQRGRAMCEKLKELIPRHMFKIPIQAAIGGKVIA 542

Query: 548 RETVKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISILKTDN 605
           RET+ A RKDVTAKCYGGD TRKRKLL+KQK GKK+MR+FG+VDIPQ AFIS LK D+
Sbjct: 543 RETLSALRKDVTAKCYGGDATRKRKLLDKQKAGKKKMRQFGKVDIPQEAFISALKMDS 600


>gi|163798276|ref|ZP_02192206.1| Elongation factor G, C-terminal:Elongation factor,
           GTP-binding:ATP/GTP-binding site motif A (P-loop):Ras
           [alpha proteobacterium BAL199]
 gi|159176439|gb|EDP61024.1| Elongation factor G, C-terminal:Elongation factor,
           GTP-binding:ATP/GTP-binding site motif A (P-loop):Ras
           [alpha proteobacterium BAL199]
          Length = 599

 Score =  832 bits (2150), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 401/600 (66%), Positives = 494/600 (82%), Gaps = 2/600 (0%)

Query: 6   TPLSRIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQT 65
           T LS IRNF+I+AHIDHGKSTLADR IQ C GLT REM  QVLD+MDIERERGITIKAQT
Sbjct: 2   TDLSHIRNFAIIAHIDHGKSTLADRLIQMCGGLTNREMKEQVLDSMDIERERGITIKAQT 61

Query: 66  VRLNYTSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQ 125
           VRL Y + D K Y LNLIDTPGHVDF YEVSRSL+ACEGS+LVVDA+QGVEAQTLANVY+
Sbjct: 62  VRLIYDAADGKRYTLNLIDTPGHVDFAYEVSRSLAACEGSILVVDASQGVEAQTLANVYK 121

Query: 126 AIDNNHEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERIVQ 185
           AI+ NHEII VLNK DLP+AD  RVK+QIE+ IG+   DA+ +SAK+G G+  LLE IV+
Sbjct: 122 AIEANHEIIPVLNKIDLPAADVARVKEQIEDVIGLDASDAIEISAKSGLGMEALLEAIVK 181

Query: 186 QLPSPTSPEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVER 245
           +LP P       AP KA+++DSWY+ YLGV  LVR+ +G L KGQ +++M T A + VER
Sbjct: 182 RLPPPKGDR--EAPTKAMMVDSWYDPYLGVTCLVRVHDGVLKKGQRVKMMQTGAVHPVER 239

Query: 246 IGILTPKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVVF 305
           +G+LTPK +++E L PGE+G + A IK V+ T+VGDTITD+    T+ALPGF+P   VVF
Sbjct: 240 VGVLTPKGLEVEVLGPGEVGFLNAGIKTVADTKVGDTITDERRQATTALPGFQPSISVVF 299

Query: 306 CGLFPVDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERLE 365
           CGLFPVDA+ F++LR ++ KLRLNDASFSFE+E S ALGFGFRCGFLGLLHLEI+QERLE
Sbjct: 300 CGLFPVDASDFDHLRDSLEKLRLNDASFSFEMETSAALGFGFRCGFLGLLHLEIVQERLE 359

Query: 366 REFSLNLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEYLG 425
           REF L+LI T+PSV+Y++++ DG   +L NP DMP+V KI  + EPWI+ TI  P++YLG
Sbjct: 360 REFDLDLITTAPSVIYKIHLTDGRTIELHNPADMPDVMKIQSIEEPWIKATIFVPDDYLG 419

Query: 426 SILKLCQERRGIQIDMSHLDNRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDYR 485
           ++L LC ERRG Q+D+++  +RA++VY LPLNEV+FDFYDRLKS+S+GYASFDY +  YR
Sbjct: 420 AVLGLCTERRGEQVDLTYAGSRAVVVYRLPLNEVVFDFYDRLKSISRGYASFDYQLDSYR 479

Query: 486 DSDLVKLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGGRI 545
           +SDLVKL+I+VN E +DALS++VHR  ++ RGR +C KLK LIP+Q+F+IAIQAAIGG++
Sbjct: 480 ESDLVKLSIMVNQEPVDALSMIVHRGQADPRGRTMCAKLKELIPRQLFKIAIQAAIGGKV 539

Query: 546 IARETVKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISILKTDN 605
           IARETV A RKDVTAKCYGGDITRK+KLLEKQKEGKKRMR+FG+V+IPQSAFI+ LK D 
Sbjct: 540 IARETVSALRKDVTAKCYGGDITRKKKLLEKQKEGKKRMRQFGQVEIPQSAFIAALKMDG 599


>gi|254487052|ref|ZP_05100257.1| GTP-binding protein LepA [Roseobacter sp. GAI101]
 gi|214043921|gb|EEB84559.1| GTP-binding protein LepA [Roseobacter sp. GAI101]
          Length = 599

 Score =  831 bits (2147), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 390/600 (65%), Positives = 488/600 (81%), Gaps = 2/600 (0%)

Query: 6   TPLSRIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQT 65
           T LS IRNFSIVAHIDHGKSTLADR IQ    +  R+M  Q+LD+MDIERERGITIKAQT
Sbjct: 2   TALSHIRNFSIVAHIDHGKSTLADRLIQETNTVALRDMKEQMLDSMDIERERGITIKAQT 61

Query: 66  VRLNYTSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQ 125
           VR++YT+ + ++Y LNLIDTPGHVDF YEVSRS+ A EGSLLVVD+TQGVEAQTLANVY 
Sbjct: 62  VRIDYTALNGENYVLNLIDTPGHVDFAYEVSRSMRAVEGSLLVVDSTQGVEAQTLANVYH 121

Query: 126 AIDNNHEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERIVQ 185
           A+D +HEI+ VLNK DLP+ D DRV +QIE+ IGI   +A+ VSAKTG GI   LE +V 
Sbjct: 122 ALDADHEIVPVLNKIDLPATDCDRVAEQIEDVIGIDASEAIRVSAKTGVGIIETLEAVVH 181

Query: 186 QLPSPTSPEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVER 245
           +LP P      +APLKA+L+DSWY+SYLGV+VLVRI++GQL KG  IR+M   + + V+R
Sbjct: 182 RLPPPKGT--LDAPLKAMLVDSWYDSYLGVIVLVRIMDGQLKKGDRIRMMQNGSVHHVDR 239

Query: 246 IGILTPKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVVF 305
           IG+  P M +I+ L PG+IG + ASIK+V  TRVGDTIT +      ALPGFKP QPVVF
Sbjct: 240 IGVFRPAMTEIDVLGPGDIGFLTASIKQVRDTRVGDTITHEKKGCDKALPGFKPAQPVVF 299

Query: 306 CGLFPVDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERLE 365
           CGLFPVDA +FE+LR +I KL LNDASFSFE+E S ALGFGFRCGFLGLLHLE+I++R+E
Sbjct: 300 CGLFPVDAAEFEDLRDSIEKLALNDASFSFEMETSAALGFGFRCGFLGLLHLEVIRDRIE 359

Query: 366 REFSLNLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEYLG 425
           RE+ ++LI T+PSV+Y+++M DG++ +L NP DM ++T +  + EP I+ TI+ P++YLG
Sbjct: 360 REYDIDLITTAPSVIYDIHMKDGTVTQLHNPADMVDLTFVDHIEEPRIKATILVPDDYLG 419

Query: 426 SILKLCQERRGIQIDMSHLDNRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDYR 485
            +LKLCQ+RRGIQ+D+++  +RAM+VY+LPLNEV+FDFYDRLKSV+KGYASFDY +I YR
Sbjct: 420 DVLKLCQDRRGIQLDLTYAGSRAMVVYDLPLNEVVFDFYDRLKSVTKGYASFDYQMIGYR 479

Query: 486 DSDLVKLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGGRI 545
             +LVK++ILVN+E +DALS +VHR  +E RGR + EKLK+LIP+ MF+I IQAAIGG++
Sbjct: 480 QDNLVKMSILVNDEPVDALSTMVHRDRAETRGRAMVEKLKDLIPRHMFKIPIQAAIGGKV 539

Query: 546 IARETVKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISILKTDN 605
           IARET+ A RKDVTAKCYGGD +RKRKLL+KQK GKK+MR+FG+VDIPQ AFIS LK D 
Sbjct: 540 IARETLSAMRKDVTAKCYGGDASRKRKLLDKQKAGKKKMRQFGKVDIPQEAFISALKMDG 599


>gi|84499539|ref|ZP_00997827.1| GTP-binding protein LepA [Oceanicola batsensis HTCC2597]
 gi|84392683|gb|EAQ04894.1| GTP-binding protein LepA [Oceanicola batsensis HTCC2597]
          Length = 599

 Score =  831 bits (2146), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 394/601 (65%), Positives = 485/601 (80%), Gaps = 4/601 (0%)

Query: 6   TPLSRIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQT 65
           T L+ IRNFSIVAHIDHGKSTLADR IQ    ++ REM  Q+LD MDIERERGITIKA T
Sbjct: 2   TDLAHIRNFSIVAHIDHGKSTLADRLIQSTNTVSAREMKEQLLDAMDIERERGITIKANT 61

Query: 66  VRLNYTSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQ 125
           VR+ Y + D + Y LNLIDTPGHVDF YEVSRS+ A EGSLLVVD+TQGVEAQTLANVYQ
Sbjct: 62  VRIEYIAKDGETYVLNLIDTPGHVDFAYEVSRSMRAVEGSLLVVDSTQGVEAQTLANVYQ 121

Query: 126 AIDNNHEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERIVQ 185
           AID +HEI+ VLNK DLP+++PDRVK+QIE+ IGI   +ALLVSAK+G GI   LE I+ 
Sbjct: 122 AIDADHEIVPVLNKIDLPASEPDRVKEQIEDVIGIDASEALLVSAKSGIGIEETLEAIIA 181

Query: 186 QLPSPTSPEGA-NAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVE 244
           +LP+P   EG  +APLKA+L+DSWY+ YLGV+VLVRI++G L KG  I++M T AKY V+
Sbjct: 182 RLPAP---EGERDAPLKAMLVDSWYDPYLGVVVLVRIMDGVLKKGDQIKMMQTGAKYSVD 238

Query: 245 RIGILTPKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVV 304
           RIG+  P M  ++ L PGEIG + A IK+V  T+VGDTIT +     + LPGFKP  PVV
Sbjct: 239 RIGVFRPAMQVVDELAPGEIGFLTAQIKQVRDTKVGDTITTEKKGCETPLPGFKPSVPVV 298

Query: 305 FCGLFPVDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERL 364
           FCGLFPVD+ +FE+LR AI KL LNDASFS+E+E S ALGFGFRCGFLGLLHLE+I++R+
Sbjct: 299 FCGLFPVDSAEFEDLRDAIEKLALNDASFSYEMETSAALGFGFRCGFLGLLHLEVIRDRI 358

Query: 365 EREFSLNLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEYL 424
           ERE+++ LI T+PSV+Y +YM DG    L NP DMP+ T +  + EP I+ TI+ P++YL
Sbjct: 359 EREYAIELITTAPSVIYHVYMRDGEKIDLHNPADMPDPTHVDHVEEPRIKATIMVPDDYL 418

Query: 425 GSILKLCQERRGIQIDMSHLDNRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDY 484
           G +LKLCQ+RRGIQ+D++++  RAM VY+LPLNEV+FDFYDRLKSV+KGYASFDY +  Y
Sbjct: 419 GDVLKLCQDRRGIQLDLTYVGGRAMAVYDLPLNEVVFDFYDRLKSVTKGYASFDYQLEGY 478

Query: 485 RDSDLVKLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGGR 544
           R  +LVK+ ILVN+E +DALS++VHR  +E RGR +CEKLK+LIP+ MF+I IQAAIGG+
Sbjct: 479 RQDNLVKMQILVNDEPVDALSMMVHRDRAEMRGRAMCEKLKDLIPRHMFKIPIQAAIGGK 538

Query: 545 IIARETVKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISILKTD 604
           +IARET+ A RKDVTAKCYGGD TRKRKLL+KQK GKK+MR+FG+VDIPQ AFIS LK D
Sbjct: 539 VIARETLAALRKDVTAKCYGGDATRKRKLLDKQKAGKKKMRQFGKVDIPQEAFISALKMD 598

Query: 605 N 605
           +
Sbjct: 599 S 599


>gi|85708866|ref|ZP_01039932.1| GTP-binding protein LepA [Erythrobacter sp. NAP1]
 gi|85690400|gb|EAQ30403.1| GTP-binding protein LepA [Erythrobacter sp. NAP1]
          Length = 609

 Score =  830 bits (2145), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 405/611 (66%), Positives = 496/611 (81%), Gaps = 7/611 (1%)

Query: 1   MQKKPTPLSRIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGIT 60
           M+ + T LS+IRNFSI+AHIDHGKSTLADR IQ   GLTEREMS QVLDNMDIE+ERGIT
Sbjct: 1   MRIQMTDLSKIRNFSIIAHIDHGKSTLADRLIQFTGGLTEREMSEQVLDNMDIEKERGIT 60

Query: 61  IKAQTVRLNYTSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTL 120
           IKAQTVRLNYT+ D + YQLNL+DTPGHVDF YEVSRSL+ACEG+LLVVDA QGVEAQTL
Sbjct: 61  IKAQTVRLNYTAKDGETYQLNLMDTPGHVDFAYEVSRSLAACEGALLVVDAAQGVEAQTL 120

Query: 121 ANVYQAIDNNHEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLL 180
           ANVYQ+I+++HEI++V+NK DLP+A+P+RVK++IEE IG+   DA+L SAKTG GI  +L
Sbjct: 121 ANVYQSIEHDHEIVSVINKVDLPAAEPERVKEEIEEVIGLDASDAVLTSAKTGIGIEEVL 180

Query: 181 ERIVQQLPSPTSPEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAK 240
           E +V ++P P      + PLKA L+DSWY+ YLGV++LVR+I G LTK Q+I+ M    +
Sbjct: 181 EAVVAKIPPPKGER--DKPLKASLVDSWYDPYLGVVILVRVIEGVLTKSQNIKFMQGGTQ 238

Query: 241 YQVERIGILTPKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPI 300
           + V+R+G  TPK  D+  L PGEIG + A IKEV   RVGDTIT   +  T ALPG+K +
Sbjct: 239 HLVDRVGCFTPKRTDLPELGPGEIGFITAQIKEVEQARVGDTITTVKNGATEALPGYKEV 298

Query: 301 QPVVFCGLFPVDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEII 360
           QPVVFCGLFPVDA  FE LR +I KLRLNDASFSFE+E+S ALGFGFRCGFLGLLHLEII
Sbjct: 299 QPVVFCGLFPVDAADFEKLRESIGKLRLNDASFSFEMESSAALGFGFRCGFLGLLHLEII 358

Query: 361 QERLEREFSLNLIGTSPSVVYELYMH-----DGSMQKLSNPIDMPEVTKIAELREPWIQV 415
           QERL RE+ L+LI T+PSVVY ++++     D +   + NP D P+VT+IA + EPWI+ 
Sbjct: 359 QERLSREYDLDLITTAPSVVYRVHLNKSKTEDATTIDIHNPADWPDVTRIATIEEPWIKA 418

Query: 416 TIITPNEYLGSILKLCQERRGIQIDMSHLDNRAMIVYELPLNEVIFDFYDRLKSVSKGYA 475
            I TP++YLGSILKLCQERRGIQ D++++  RA + YELPLNEV+FDFYDRLKS+S+GYA
Sbjct: 419 VIYTPDDYLGSILKLCQERRGIQTDLTYVGGRAQVTYELPLNEVVFDFYDRLKSISRGYA 478

Query: 476 SFDYNVIDYRDSDLVKLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQI 535
           SFDY  I  R+ DLVK+ ILVNNE +DALS++VHRSV+E+RGRG+CE+LK+LIP+ +F+I
Sbjct: 479 SFDYEQIGLREGDLVKMNILVNNEPVDALSLIVHRSVAEERGRGMCERLKDLIPRHLFKI 538

Query: 536 AIQAAIGGRIIARETVKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQS 595
            IQAAIGG+IIARET+ A RKDVTAKCYGGDITRK+KLLEKQK+GK RMR +G V IPQ 
Sbjct: 539 PIQAAIGGKIIARETIAALRKDVTAKCYGGDITRKKKLLEKQKKGKARMREYGNVSIPQE 598

Query: 596 AFISILKTDNE 606
           AFI+ L+   E
Sbjct: 599 AFIAALRMGEE 609


>gi|114763051|ref|ZP_01442481.1| GTP-binding protein LepA [Pelagibaca bermudensis HTCC2601]
 gi|114544375|gb|EAU47383.1| GTP-binding protein LepA [Roseovarius sp. HTCC2601]
          Length = 600

 Score =  830 bits (2143), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 390/600 (65%), Positives = 486/600 (81%), Gaps = 1/600 (0%)

Query: 6   TPLSRIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQT 65
           T L+ IRNFSIVAHIDHGKSTLADR IQ    + ER+M  Q+LD+MDIERERGITIKA T
Sbjct: 2   TDLAHIRNFSIVAHIDHGKSTLADRLIQLTGTVAERDMQEQLLDSMDIERERGITIKANT 61

Query: 66  VRLNYTSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQ 125
           VR+ Y + D + Y LNLIDTPGHVDF YEV+RS+ A EGSLLVVDATQGVEAQTLANVY 
Sbjct: 62  VRIEYPAQDGQTYVLNLIDTPGHVDFAYEVARSMHAVEGSLLVVDATQGVEAQTLANVYT 121

Query: 126 AIDNNHEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERIVQ 185
           AID +HEI+ VLNK DLP+A+PDRVK+QIE+ IGI ++DA L+SAKTG GIP +LE IV+
Sbjct: 122 AIDADHEIVPVLNKVDLPAAEPDRVKEQIEDVIGIDSQDACLISAKTGVGIPDVLEAIVK 181

Query: 186 QLPSPTSPEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVER 245
           +LP+PT  +  + PLKA+L+DS Y+ YLGV+ +VRII+G L KG  IR+M T   Y V+ 
Sbjct: 182 RLPAPTEGD-RDKPLKAMLVDSKYDQYLGVICIVRIIDGVLKKGDRIRMMKTGGTYDVDD 240

Query: 246 IGILTPKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVVF 305
           +G+  P M +++ L PGEIG + ASIK+V  TRVGDTIT +       LPGFKP  PVVF
Sbjct: 241 VGVYRPAMTNVKELGPGEIGYLNASIKQVRDTRVGDTITHEKKQCAEPLPGFKPSVPVVF 300

Query: 306 CGLFPVDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERLE 365
           CGLFPVDA  FE++R AI KL LNDASF+FE+E S ALGFGFRCGFLGLLHLE+I++RLE
Sbjct: 301 CGLFPVDANDFEDMRDAIEKLALNDASFTFEMETSAALGFGFRCGFLGLLHLEVIRDRLE 360

Query: 366 REFSLNLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEYLG 425
           RE+++ LI T+PSV+Y LY  DG  + L NP DMP+++ +  + EP I+ TI+ P+EYLG
Sbjct: 361 REYNIELITTAPSVIYHLYTKDGERRDLHNPADMPDMSTVDHIEEPRIKATIMVPDEYLG 420

Query: 426 SILKLCQERRGIQIDMSHLDNRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDYR 485
            +LKLCQERRG+Q+D++++  RAM VY+LPLNEV+FDFYDRLKSV+KGYASFDY +I YR
Sbjct: 421 DVLKLCQERRGLQLDLTYVGGRAMTVYDLPLNEVVFDFYDRLKSVTKGYASFDYEMIGYR 480

Query: 486 DSDLVKLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGGRI 545
           + +LVK++ILVN+E +DAL+++VHR  +E RGR +CEKLK LIP+ MF+I IQAAIGG++
Sbjct: 481 EDNLVKMSILVNDEPVDALAMMVHRDRAEMRGRAMCEKLKELIPRHMFKIPIQAAIGGKV 540

Query: 546 IARETVKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISILKTDN 605
           IARET+ A RKDVTAKCYGGD +RK+KLLEKQK GKK+MR+FG+V+IPQ AFIS LK D+
Sbjct: 541 IARETLSAMRKDVTAKCYGGDASRKKKLLEKQKAGKKKMRQFGKVEIPQEAFISALKMDS 600


>gi|294013284|ref|YP_003546744.1| GTP-binding protein LepA [Sphingobium japonicum UT26S]
 gi|292676614|dbj|BAI98132.1| GTP-binding protein LepA [Sphingobium japonicum UT26S]
          Length = 608

 Score =  829 bits (2141), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 393/601 (65%), Positives = 496/601 (82%), Gaps = 2/601 (0%)

Query: 6   TPLSRIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQT 65
           T LS IRNFSI+AHIDHGKSTLADR IQ   GLT+REMS+QVLDNMDIE+ERGITIKAQT
Sbjct: 9   TDLSHIRNFSIIAHIDHGKSTLADRLIQRTGGLTDREMSAQVLDNMDIEKERGITIKAQT 68

Query: 66  VRLNYTSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQ 125
           VRL+Y + + + Y+LNL+DTPGHVDF YEVSRSL+ACEG+LLVVDA QGVEAQTLANVYQ
Sbjct: 69  VRLDYVAKNGETYELNLMDTPGHVDFAYEVSRSLAACEGALLVVDAAQGVEAQTLANVYQ 128

Query: 126 AIDNNHEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERIVQ 185
           +I+++HEI+ V+NK DLP+A+P++VK +IEE IG+   +A+L SAK G GI  +LE +V 
Sbjct: 129 SIEHDHEIVPVINKIDLPAAEPEKVKAEIEEVIGLDASEAVLASAKAGIGIDDILEAVVA 188

Query: 186 QLPSPTSPEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVER 245
           ++P+PT     +APL+A+L+DSWY+ YLGV++LVR++NG + KGQSI+ M    ++ ++R
Sbjct: 189 KIPAPTGDR--DAPLEAMLVDSWYDPYLGVVILVRVVNGVIKKGQSIKFMIGGTEHLIDR 246

Query: 246 IGILTPKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVVF 305
           +G   PK+  +  L PGEIG + A IK++S TRVGDTIT   +P  + LPGFK +QPVVF
Sbjct: 247 VGCFRPKIEQLGELGPGEIGFITAQIKDISQTRVGDTITTVKNPAKAPLPGFKEVQPVVF 306

Query: 306 CGLFPVDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERLE 365
           CGLFPVDA  FE LR +I+KLRLNDASFSFE+E S ALGFGFRCGFLGLLHLEIIQERL 
Sbjct: 307 CGLFPVDANDFEKLRESISKLRLNDASFSFEMETSAALGFGFRCGFLGLLHLEIIQERLS 366

Query: 366 REFSLNLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEYLG 425
           RE+ L+LI T+PSVVYE++M+DG+++ L NP DMP+   I  + EPWI+  I  P+EYLG
Sbjct: 367 REYDLDLITTAPSVVYEIHMNDGTVRHLHNPADMPDANHIDYIEEPWIEAVIYCPDEYLG 426

Query: 426 SILKLCQERRGIQIDMSHLDNRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDYR 485
           SILKLCQ+RRGIQ +++++  RA + YELPLNEV+FDFYDRLKS+S+GYASFDY+ I  R
Sbjct: 427 SILKLCQDRRGIQKNLTYVGGRAQVTYELPLNEVVFDFYDRLKSISRGYASFDYHQIGAR 486

Query: 486 DSDLVKLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGGRI 545
           + DLVK++ILVNNE +DALS++VHR  +E RGRG+CE+LK+LIP+ +F+I IQAAIGG++
Sbjct: 487 EGDLVKMSILVNNEPVDALSMIVHRGSAESRGRGMCERLKDLIPRHLFKIPIQAAIGGKV 546

Query: 546 IARETVKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISILKTDN 605
           IARET+ A RKDVTAKCYGGDITRK+KLLEKQKEGKKRMR +G V IPQ AFI+ L+  +
Sbjct: 547 IARETIAAMRKDVTAKCYGGDITRKKKLLEKQKEGKKRMREYGSVQIPQEAFIAALRMGD 606

Query: 606 E 606
           E
Sbjct: 607 E 607


>gi|255262128|ref|ZP_05341470.1| GTP-binding protein LepA [Thalassiobium sp. R2A62]
 gi|255104463|gb|EET47137.1| GTP-binding protein LepA [Thalassiobium sp. R2A62]
          Length = 598

 Score =  828 bits (2139), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 394/600 (65%), Positives = 486/600 (81%), Gaps = 3/600 (0%)

Query: 6   TPLSRIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQT 65
           T L++IRNFSIVAHIDHGKSTLADR IQ    + +R+M +Q+LD+MDIERERGITIKA T
Sbjct: 2   TDLAKIRNFSIVAHIDHGKSTLADRLIQETGTVMDRDMKAQLLDSMDIERERGITIKANT 61

Query: 66  VRLNYTSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQ 125
           VR++YT+ D + Y LNLIDTPGHVDF YEVSRS+ A EGSLLVVD+TQGVEAQTLANVYQ
Sbjct: 62  VRIDYTADDGEAYVLNLIDTPGHVDFAYEVSRSMRAVEGSLLVVDSTQGVEAQTLANVYQ 121

Query: 126 AIDNNHEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERIVQ 185
           AID +H+I+ VLNK DLP++D DRV +QIE+ IGI    A+ VSAKTG+GI   LE IV 
Sbjct: 122 AIDADHDIVPVLNKIDLPASDLDRVAEQIEDVIGIDASGAIAVSAKTGQGIHETLEAIVN 181

Query: 186 QLPSPTSPEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVER 245
           +LP+P      +APLKA+L+DSWY++YLGV+VLVRII+GQL KG  I+ +     + V+R
Sbjct: 182 ELPAPLG--DVDAPLKAMLVDSWYDAYLGVIVLVRIIDGQLRKGDKIKFVSNGTVHPVDR 239

Query: 246 IGILTPKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVVF 305
           IG+  P+M  I+ L PGEIG + ASIK+V  TRVGDT+T   +  T  L GFKP QPVVF
Sbjct: 240 IGVFRPEMESIDVLGPGEIGFLTASIKQVRDTRVGDTVTHQKNEVTP-LDGFKPAQPVVF 298

Query: 306 CGLFPVDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERLE 365
           CGLFPVD  QFE+LR AI KL LNDASFSFE+E S ALGFGFRCGFLGLLHLE+I++R+E
Sbjct: 299 CGLFPVDNAQFEDLRDAIEKLALNDASFSFEMETSAALGFGFRCGFLGLLHLEVIRDRIE 358

Query: 366 REFSLNLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEYLG 425
           RE+++ LI T+PSV+Y +YM DG M +L NP DMP++T +  L EP I+ TI+ P+EYLG
Sbjct: 359 REYNIELITTAPSVIYHVYMRDGEMIELHNPADMPDLTLVDHLEEPRIKATILVPDEYLG 418

Query: 426 SILKLCQERRGIQIDMSHLDNRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDYR 485
            +LKLCQ+RRGIQ D+++  +RAM+VY+LPLNEV+FDFYDRLKSV+KGYASFDY +I YR
Sbjct: 419 DVLKLCQDRRGIQEDLTYAGSRAMVVYDLPLNEVVFDFYDRLKSVTKGYASFDYQMIGYR 478

Query: 486 DSDLVKLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGGRI 545
           +  LVK+++LVN E +DALS +VH   +E+RGR + EKLK+LIP+ MF+I IQAAIGGR+
Sbjct: 479 EDRLVKMSVLVNEEPVDALSTMVHYDRAEQRGRAMVEKLKDLIPRHMFKIPIQAAIGGRV 538

Query: 546 IARETVKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISILKTDN 605
           IARET+ A RKDVTAKCYGGD TRK+KLLEKQK GKK+MR+FG+VDIPQ AFIS LK D+
Sbjct: 539 IARETLSAMRKDVTAKCYGGDATRKKKLLEKQKAGKKKMRQFGKVDIPQEAFISALKMDS 598


>gi|56552637|ref|YP_163476.1| GTP-binding protein LepA [Zymomonas mobilis subsp. mobilis ZM4]
 gi|241762120|ref|ZP_04760203.1| GTP-binding protein LepA [Zymomonas mobilis subsp. mobilis ATCC
           10988]
 gi|260753711|ref|YP_003226604.1| GTP-binding protein LepA [Zymomonas mobilis subsp. mobilis NCIMB
           11163]
 gi|81598158|sp|Q5NLP5|LEPA_ZYMMO RecName: Full=Elongation factor 4; Short=EF-4; AltName:
           Full=Ribosomal back-translocase LepA
 gi|56544211|gb|AAV90365.1| GTP-binding protein LepA [Zymomonas mobilis subsp. mobilis ZM4]
 gi|241373370|gb|EER62970.1| GTP-binding protein LepA [Zymomonas mobilis subsp. mobilis ATCC
           10988]
 gi|258553074|gb|ACV76020.1| GTP-binding protein LepA [Zymomonas mobilis subsp. mobilis NCIMB
           11163]
          Length = 602

 Score =  828 bits (2139), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 396/602 (65%), Positives = 496/602 (82%), Gaps = 3/602 (0%)

Query: 6   TPLSRIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQT 65
           TPL  IRNFSI+AHIDHGKSTLADR IQ   GLT REMS QVLDNMDIE+ERGITIKAQT
Sbjct: 2   TPLDHIRNFSIIAHIDHGKSTLADRLIQTTGGLTAREMSEQVLDNMDIEKERGITIKAQT 61

Query: 66  VRLNYTSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQ 125
           VRL+YT+ D + Y LNL+DTPGHVDF YEVSRSL+ACEG+LLVVDA+QGVEAQTLANVYQ
Sbjct: 62  VRLDYTAKDGQKYVLNLMDTPGHVDFAYEVSRSLAACEGALLVVDASQGVEAQTLANVYQ 121

Query: 126 AIDNNHEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERIVQ 185
           +I+ +HEI+ V+NK DLP+A+P++VK++IEE IG+  +DA+L SAK+G GI  +LE +V+
Sbjct: 122 SIEYDHEIVPVINKIDLPAAEPEKVKQEIEEIIGLPADDAVLASAKSGIGIDDILEALVK 181

Query: 186 QLPSPTSPEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVER 245
           ++P+P      NAPLKA+L+DSWY+ YLGV++LVRII+G L KGQ IR M     + ++R
Sbjct: 182 RIPAPKG--DINAPLKAMLVDSWYDPYLGVVILVRIIDGSLKKGQQIRFMQAGTTHLIDR 239

Query: 246 IGILTPKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVVF 305
           +G   PK+  +++L PGEIG + A IKEVS T VGDTITD  +PT++ LPGFK +QPVVF
Sbjct: 240 VGCFRPKIEILDSLGPGEIGFITAQIKEVSQTAVGDTITDAKNPTSTPLPGFKQVQPVVF 299

Query: 306 CGLFPVDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERLE 365
           CGLFPVDA  F+ L+ ++ KLRLNDASFSFE ENS ALGFGFRCGFLGLLHLEIIQERL 
Sbjct: 300 CGLFPVDAADFDKLKESLGKLRLNDASFSFEAENSAALGFGFRCGFLGLLHLEIIQERLS 359

Query: 366 REFSLNLIGTSPSVVYELYMHDGSMQ-KLSNPIDMPEVTKIAELREPWIQVTIITPNEYL 424
           RE+ L+LI T+PSVVY L M  G     L NP DMP+VT+I  + EPWI+ TI  P++YL
Sbjct: 360 REYDLDLITTAPSVVYHLNMTHGEGSIDLHNPADMPDVTRIDSIDEPWIEATIYVPDQYL 419

Query: 425 GSILKLCQERRGIQIDMSHLDNRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDY 484
           G++LKLCQ+RRGIQ DM+++  R  ++YELPLNEV+FDFYDRLKS+S+GYASFDY+ I Y
Sbjct: 420 GAVLKLCQDRRGIQKDMTYVGGRVQLLYELPLNEVVFDFYDRLKSISRGYASFDYHQIGY 479

Query: 485 RDSDLVKLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGGR 544
           R+ DLVK+TI+VN E +DALS++VHR  +E RGR +C+++K+LIP+ +F+I IQAAIGG+
Sbjct: 480 REGDLVKMTIMVNGEVVDALSMIVHRHAAEGRGRQMCQRMKDLIPRHLFKIPIQAAIGGK 539

Query: 545 IIARETVKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISILKTD 604
           +IARET+ A RKDVTAKCYGGDI+RK+KLLEKQKEGKKRMR++G VDIPQ AFI+ L+  
Sbjct: 540 VIARETIGAMRKDVTAKCYGGDISRKKKLLEKQKEGKKRMRQYGSVDIPQEAFIAALRMG 599

Query: 605 NE 606
           ++
Sbjct: 600 DD 601


>gi|126733268|ref|ZP_01749015.1| GTP-binding protein LepA [Roseobacter sp. CCS2]
 gi|126716134|gb|EBA12998.1| GTP-binding protein LepA [Roseobacter sp. CCS2]
          Length = 599

 Score =  828 bits (2138), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 390/600 (65%), Positives = 485/600 (80%), Gaps = 2/600 (0%)

Query: 6   TPLSRIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQT 65
           T LS IRNFSIVAHIDHGKSTLADR IQ    + +R+M +Q+LD+MDIERERGITIKA T
Sbjct: 2   TDLSHIRNFSIVAHIDHGKSTLADRLIQSTNTVADRDMKAQLLDSMDIERERGITIKANT 61

Query: 66  VRLNYTSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQ 125
           VR++Y + + +DY LNLIDTPGHVDF YEVSRS+ A EGSLLVVD+TQGVEAQTLANVYQ
Sbjct: 62  VRIDYKADNGQDYVLNLIDTPGHVDFAYEVSRSMRAVEGSLLVVDSTQGVEAQTLANVYQ 121

Query: 126 AIDNNHEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERIVQ 185
           AID +HEI+ VLNK DLP+A+ DRV +QIE+ IGI    A+ VSAKTG GI   LE IV 
Sbjct: 122 AIDADHEIVPVLNKIDLPAAECDRVAEQIEDVIGIDASGAIQVSAKTGIGIKDTLEAIVN 181

Query: 186 QLPSPTSPEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVER 245
            LP+P      +APLKA+L+DSWY+SYLGV+VLVRII+G + K   ++ M     + +++
Sbjct: 182 LLPAPEGDR--DAPLKAMLVDSWYDSYLGVIVLVRIIDGTMKKNDKVKFMSNGTIHGIDK 239

Query: 246 IGILTPKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVVF 305
           IG+  P+M D++ L PGEIG + ASIK+V  TRVGDTIT +   T  ALPGFKP QPVVF
Sbjct: 240 IGVFRPQMQDVDELGPGEIGFITASIKQVRDTRVGDTITSERKGTEVALPGFKPAQPVVF 299

Query: 306 CGLFPVDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERLE 365
           CGLFPVD+++FE+LR AI KL LNDASFS E+E S ALGFGFRCGFLGLLHLE+I++R+E
Sbjct: 300 CGLFPVDSSEFEDLRDAIEKLALNDASFSNEMETSAALGFGFRCGFLGLLHLEVIRDRIE 359

Query: 366 REFSLNLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEYLG 425
           RE+++ LI T+PSVVY +YM DG M +L NP DMP++T +  L EP I+ TI+ P+EYLG
Sbjct: 360 REYNIELITTAPSVVYHVYMRDGEMVELHNPADMPDMTHVDHLEEPRIKATILVPDEYLG 419

Query: 426 SILKLCQERRGIQIDMSHLDNRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDYR 485
            +LKLCQ+RRG+Q D+++  +RAM+VY+LPLNEV+FDFYDRLKSV+KGYASFDY +  Y+
Sbjct: 420 DVLKLCQDRRGVQQDLTYAGSRAMVVYDLPLNEVVFDFYDRLKSVTKGYASFDYQMTGYQ 479

Query: 486 DSDLVKLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGGRI 545
             +LVK+++LVN+E +DALS++VHR  +E RGR + EKLK+LIP+ MF+I IQAAIGG++
Sbjct: 480 TDNLVKMSLLVNDEPVDALSMMVHRDRAEMRGRAMVEKLKDLIPRHMFKIPIQAAIGGKV 539

Query: 546 IARETVKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISILKTDN 605
           IARET+ A RKDVTAKCYGGD TRKRKLL+KQK GKK+MR+FG+VDIPQ AFIS LK D 
Sbjct: 540 IARETLSALRKDVTAKCYGGDATRKRKLLDKQKAGKKKMRQFGKVDIPQEAFISALKMDG 599


>gi|84514434|ref|ZP_01001798.1| GTP-binding protein LepA [Loktanella vestfoldensis SKA53]
 gi|84511485|gb|EAQ07938.1| GTP-binding protein LepA [Loktanella vestfoldensis SKA53]
          Length = 599

 Score =  828 bits (2138), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 391/600 (65%), Positives = 483/600 (80%), Gaps = 2/600 (0%)

Query: 6   TPLSRIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQT 65
           T LS IRNFSIVAHIDHGKSTLADR IQ    +  R+M  Q+LD+MDIERERGITIKA T
Sbjct: 2   TDLSHIRNFSIVAHIDHGKSTLADRLIQSTNTVAARDMKEQMLDSMDIERERGITIKANT 61

Query: 66  VRLNYTSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQ 125
           VR++YT+ + + Y LNLIDTPGHVDF YEVSRS+ A EGSLLVVD+TQGVEAQTLANVY 
Sbjct: 62  VRIDYTADNGRAYVLNLIDTPGHVDFAYEVSRSMRAVEGSLLVVDSTQGVEAQTLANVYH 121

Query: 126 AIDNNHEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERIVQ 185
           A+D  HEI+ VLNK DLP+++ D+V  QIE+ IG+    A+ VSAKTG GI   LE IV 
Sbjct: 122 ALDAGHEIVPVLNKIDLPASECDQVAAQIEDVIGLDASGAIRVSAKTGIGIHETLEAIVN 181

Query: 186 QLPSPTSPEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVER 245
            LP+P      +APLKA+L+DSWY+SYLGV+VLVRII+G + K   +R M     +Q+++
Sbjct: 182 LLPAPQGDR--DAPLKAMLVDSWYDSYLGVIVLVRIIDGTMKKNDRVRFMSNGTVHQIDK 239

Query: 246 IGILTPKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVVF 305
           IG+  PKM D+E L PGEIG + ASIK+V  TRVGDTIT +   T  ALPGFKP QPVVF
Sbjct: 240 IGVFRPKMQDVEILGPGEIGFITASIKQVRDTRVGDTITSEKKGTDQALPGFKPAQPVVF 299

Query: 306 CGLFPVDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERLE 365
           CGLFPVD++ FE+LR AI KL LNDASFSFE+E S ALGFGFRCGFLGLLHLE+I++R+E
Sbjct: 300 CGLFPVDSSLFEDLRDAIEKLALNDASFSFEMETSAALGFGFRCGFLGLLHLEVIRDRIE 359

Query: 366 REFSLNLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEYLG 425
           RE+ ++LI T+PSVVY L+M DG M++L NP DMP++T I  L EP I+ TI+ P+EYLG
Sbjct: 360 REYDIDLITTAPSVVYHLHMRDGEMRELHNPADMPDLTLIDHLEEPRIKATILVPDEYLG 419

Query: 426 SILKLCQERRGIQIDMSHLDNRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDYR 485
            +LKLCQ+RRG+Q+D+++  +RAM+VY+LPLNEV+FDFYDRLKSV+KGYASFDY +  Y+
Sbjct: 420 DVLKLCQDRRGVQLDLTYAGSRAMVVYDLPLNEVVFDFYDRLKSVTKGYASFDYVLTGYQ 479

Query: 486 DSDLVKLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGGRI 545
           +  LVK+++LVN+E +DALS++VHR  +E RGR + EKLK+LIP+ MF+I IQAAIGG++
Sbjct: 480 EDYLVKMSVLVNDEPVDALSMMVHRDRAEMRGRAMVEKLKDLIPRHMFKIPIQAAIGGKV 539

Query: 546 IARETVKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISILKTDN 605
           IARET+ A RKDVTAKCYGGD TRKRKLL+KQK GKK+MR+FG+VDIPQ AFIS LK D 
Sbjct: 540 IARETLSALRKDVTAKCYGGDATRKRKLLDKQKAGKKKMRQFGKVDIPQEAFISALKMDG 599


>gi|307294999|ref|ZP_07574841.1| GTP-binding protein LepA [Sphingobium chlorophenolicum L-1]
 gi|306879473|gb|EFN10691.1| GTP-binding protein LepA [Sphingobium chlorophenolicum L-1]
          Length = 608

 Score =  827 bits (2135), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 393/601 (65%), Positives = 492/601 (81%), Gaps = 2/601 (0%)

Query: 6   TPLSRIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQT 65
           T LS IRNFSI+AHIDHGKSTLADR IQ   GLT+REMS+QVLDNMDIE+ERGITIKAQT
Sbjct: 9   TDLSHIRNFSIIAHIDHGKSTLADRLIQRTGGLTDREMSAQVLDNMDIEKERGITIKAQT 68

Query: 66  VRLNYTSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQ 125
           VRLNY + + + Y LNL+DTPGHVDF YEVSRSL+ACEG+LLVVDA QGVEAQTLANVYQ
Sbjct: 69  VRLNYVAKNGETYALNLMDTPGHVDFAYEVSRSLAACEGALLVVDAAQGVEAQTLANVYQ 128

Query: 126 AIDNNHEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERIVQ 185
           +I+++HEI+ V+NK DLP+A+P++VK +IEE IG+   +A+L SAK G GI  +LE +V 
Sbjct: 129 SIEHDHEIVPVINKIDLPAAEPEKVKAEIEEVIGLDASEAVLASAKAGIGIDDILEAVVA 188

Query: 186 QLPSPTSPEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVER 245
           ++P+P       APL+A+L+DSWY+ YLGV++LVR++NG + KGQ+I+ M    ++ ++R
Sbjct: 189 KIPAPKGDR--EAPLEAMLVDSWYDPYLGVVILVRVVNGVIKKGQNIKFMIGGTEHLIDR 246

Query: 246 IGILTPKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVVF 305
           +G   PK+  +  L PGEIG + A IKE+S TRVGDTIT   +P   ALPGFK +QPVVF
Sbjct: 247 VGCFRPKIEQLGELGPGEIGFITAQIKEISQTRVGDTITTVKNPAKEALPGFKEVQPVVF 306

Query: 306 CGLFPVDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERLE 365
           CGLFPVDA  FE LR +I+KLRLNDASFSFE+E S ALGFGFRCGFLGLLHLEIIQERL 
Sbjct: 307 CGLFPVDANDFEKLRESISKLRLNDASFSFEMETSAALGFGFRCGFLGLLHLEIIQERLS 366

Query: 366 REFSLNLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEYLG 425
           RE+ L+LI T+PSVVY+++M+DG+ + L NP DMP+   I  + EPWI+  I  P+EYLG
Sbjct: 367 REYDLDLITTAPSVVYDIHMNDGTTRHLHNPADMPDANYIDFIEEPWIEAVIYCPDEYLG 426

Query: 426 SILKLCQERRGIQIDMSHLDNRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDYR 485
           SILKLCQ+RRGIQ +++++  RA + YELPLNEV+FDFYDRLKS+S+GYASFDY+ I  R
Sbjct: 427 SILKLCQDRRGIQKNLTYVGGRAQVTYELPLNEVVFDFYDRLKSISRGYASFDYHQIGAR 486

Query: 486 DSDLVKLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGGRI 545
           + DLVK++ILVNNE +DALS++VHR  +E RGRG+CE+LK+LIP+ +F+I IQAAIGG++
Sbjct: 487 EGDLVKMSILVNNEPVDALSMIVHRGTAESRGRGMCERLKDLIPRHLFKIPIQAAIGGKV 546

Query: 546 IARETVKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISILKTDN 605
           IARET+ A RKDVTAKCYGGDITRK+KLLEKQKEGKKRMR +G V IPQ AFI+ L+  +
Sbjct: 547 IARETIAAMRKDVTAKCYGGDITRKKKLLEKQKEGKKRMREYGSVQIPQEAFIAALRMGD 606

Query: 606 E 606
           E
Sbjct: 607 E 607


>gi|294084791|ref|YP_003551549.1| GTP-binding protein LepA [Candidatus Puniceispirillum marinum
           IMCC1322]
 gi|292664364|gb|ADE39465.1| GTP-binding protein LepA [Candidatus Puniceispirillum marinum
           IMCC1322]
          Length = 600

 Score =  825 bits (2132), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 397/597 (66%), Positives = 484/597 (81%), Gaps = 2/597 (0%)

Query: 6   TPLSRIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQT 65
           T + +IRNFSI+AHIDHGKST+ADR IQ C GL++REM  QVLDNMDIERERGITIKAQT
Sbjct: 2   TDIDQIRNFSIIAHIDHGKSTIADRLIQACGGLSDREMKDQVLDNMDIERERGITIKAQT 61

Query: 66  VRLNYTSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQ 125
           VRLNY + D KDY LNL+DTPGHVDF YEVSRSLSACEGSLLVVDA+QGVEAQTLANVYQ
Sbjct: 62  VRLNYQAKDGKDYVLNLMDTPGHVDFGYEVSRSLSACEGSLLVVDASQGVEAQTLANVYQ 121

Query: 126 AIDNNHEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERIVQ 185
           AI+ +HEI+ VLNK DLP+A+PDRVK QIEE IG+  +DA+  SAKTGEGI  +LE +V 
Sbjct: 122 AIEADHEIVPVLNKIDLPAAEPDRVKAQIEEVIGLPADDAIAASAKTGEGINEILEALVT 181

Query: 186 QLPSPTSPEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVER 245
            LP+P       APLKALL+DSWY++YLGVM LVR+ +G L KG  IR+M + A + VER
Sbjct: 182 SLPAPKGDR--TAPLKALLVDSWYDAYLGVMTLVRVHDGVLKKGMKIRMMASGATHVVER 239

Query: 246 IGILTPKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVVF 305
           +G   PK   ++ L PGEIG + A +K VS  +VGDTIT++      ALPGF P  PVVF
Sbjct: 240 VGTFLPKPTSVDELGPGEIGFINAGVKTVSDAKVGDTITEERRLCDEALPGFAPSVPVVF 299

Query: 306 CGLFPVDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERLE 365
           CGLFPVD   F  LR A+ KL LNDASFSFE E S ALGFGFRCGFLGLLH+E+I++RL 
Sbjct: 300 CGLFPVDTNDFTGLREALEKLSLNDASFSFEAETSAALGFGFRCGFLGLLHMEVIRDRLT 359

Query: 366 REFSLNLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEYLG 425
           REF+L+LI T+PSVVY++++ DG    L NP DMPEVT+I+E+ EPWI+ TI+TP+E+LG
Sbjct: 360 REFNLDLISTAPSVVYQMHLTDGKRFDLHNPADMPEVTRISEIEEPWIKATIMTPDEFLG 419

Query: 426 SILKLCQERRGIQIDMSHLDNRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDYR 485
            +L LC ERRG QID+++  NRAM VY LPLNEV+FDFYDRLKS++KGYASFDY +  YR
Sbjct: 420 PVLTLCTERRGEQIDLTYAGNRAMAVYRLPLNEVVFDFYDRLKSITKGYASFDYAIDCYR 479

Query: 486 DSDLVKLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGGRI 545
             +LVK++ILVN + +DALS++VHR  +E +GR IC +LK+L+P+QMF++A+QAAIGG++
Sbjct: 480 PGELVKVSILVNGDPVDALSMIVHRDQAEGKGRAICIRLKDLVPRQMFKVALQAAIGGKV 539

Query: 546 IARETVKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISILK 602
           IARET+ A RKDVTAKCYGGDITRK+KLLEKQKEGKK+MR+FG+VDIPQ+AF   LK
Sbjct: 540 IARETIAALRKDVTAKCYGGDITRKKKLLEKQKEGKKKMRQFGKVDIPQTAFFEALK 596


>gi|84687496|ref|ZP_01015373.1| GTP-binding protein LepA [Maritimibacter alkaliphilus HTCC2654]
 gi|84664521|gb|EAQ11008.1| GTP-binding protein LepA [Rhodobacterales bacterium HTCC2654]
          Length = 599

 Score =  824 bits (2129), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 385/600 (64%), Positives = 483/600 (80%), Gaps = 2/600 (0%)

Query: 6   TPLSRIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQT 65
           T L+ IRNFSIVAHIDHGKSTLADR IQ    + +R+M  Q+LD MDIERERGITIKA T
Sbjct: 2   TDLAHIRNFSIVAHIDHGKSTLADRLIQATNTVPDRDMKEQLLDAMDIERERGITIKANT 61

Query: 66  VRLNYTSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQ 125
           VR+ Y + D + Y LNLIDTPGHVDF YEVSRS+ A EGSLLVVD+TQGVEAQTLANVYQ
Sbjct: 62  VRIEYDALDGQSYVLNLIDTPGHVDFAYEVSRSMRAVEGSLLVVDSTQGVEAQTLANVYQ 121

Query: 126 AIDNNHEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERIVQ 185
           AID +HEI+ V NK DLP++D  RV +Q+E+ IGI    A+ VSAKTGEGI  +LE IV 
Sbjct: 122 AIDADHEIVPVFNKIDLPASDISRVAEQVEDVIGIDASGAIAVSAKTGEGIREVLEAIVH 181

Query: 186 QLPSPTSPEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVER 245
           +LP+PT    A+APLKA+L+DSWY+ YLGV+VLVR+++G++ K   +  M     +Q+++
Sbjct: 182 RLPAPTG--DADAPLKAMLVDSWYDPYLGVVVLVRVMDGKMKKNDRVMFMQNGTVHQIDK 239

Query: 246 IGILTPKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVVF 305
           IG+  PKM D++ L PGEIG + ASIK+V  T+VGDTIT +       LPGF P  PVVF
Sbjct: 240 IGVFRPKMQDVKELGPGEIGFITASIKQVRDTKVGDTITHEKKGCEKPLPGFNPSIPVVF 299

Query: 306 CGLFPVDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERLE 365
           CGLFPVD+ +FE+LR AI KL LNDASFS+E+E S ALGFGFRCGFLGLLHLE++++RLE
Sbjct: 300 CGLFPVDSAEFEDLRDAIEKLALNDASFSYEMETSAALGFGFRCGFLGLLHLEVVRDRLE 359

Query: 366 REFSLNLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEYLG 425
           RE+ + LI T+PSVVY +YM DG+MQ+L NP DMP++T +  + EP I+ TI+ P+E+LG
Sbjct: 360 REYDIELITTAPSVVYNIYMKDGTMQELHNPADMPDLTYVDHVEEPRIKATIMVPDEFLG 419

Query: 426 SILKLCQERRGIQIDMSHLDNRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDYR 485
            +LKLCQ+RRGIQ+D+++  +RAM+VY+LPLNEV+FDFYDRLKSV+KGYASFDY++  YR
Sbjct: 420 DVLKLCQDRRGIQLDLTYAGSRAMVVYDLPLNEVVFDFYDRLKSVTKGYASFDYSIEGYR 479

Query: 486 DSDLVKLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGGRI 545
             +LVK+ ILVN+E +DALS++VHR  +E RGR +CEKLK+LIP+ MF+I IQAAIGG++
Sbjct: 480 QDNLVKMQILVNDEPVDALSMMVHRDRAEMRGRAMCEKLKDLIPRHMFKIPIQAAIGGKV 539

Query: 546 IARETVKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISILKTDN 605
           IARET+ A RKDVTAKCYGGD TRK+KLLEKQK GKK+MR+FG+V+IPQ AFIS LK D 
Sbjct: 540 IARETLSALRKDVTAKCYGGDATRKKKLLEKQKAGKKKMRQFGKVEIPQEAFISALKMDG 599


>gi|15892292|ref|NP_360006.1| GTP-binding protein LepA [Rickettsia conorii str. Malish 7]
 gi|24211924|sp|Q92IQ1|LEPA_RICCN RecName: Full=Elongation factor 4; Short=EF-4; AltName:
           Full=Ribosomal back-translocase LepA
 gi|15619433|gb|AAL02907.1| GTP-binding protein lepA [Rickettsia conorii str. Malish 7]
          Length = 600

 Score =  822 bits (2124), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 384/596 (64%), Positives = 489/596 (82%), Gaps = 2/596 (0%)

Query: 11  IRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVRLNY 70
           IRNFSI+AHIDHGKSTLADR I+HC GL  REMS QVLD+MDIE+ERGITIKAQTVRL Y
Sbjct: 7   IRNFSIIAHIDHGKSTLADRLIEHCGGLQAREMSQQVLDSMDIEKERGITIKAQTVRLVY 66

Query: 71  TSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQAIDNN 130
            + D  +Y LNL+DTPGHVDF YEVSRSL+ACEGSLLVVD+TQGVEAQTLANVYQAI+N+
Sbjct: 67  KAKDGNNYYLNLMDTPGHVDFAYEVSRSLAACEGSLLVVDSTQGVEAQTLANVYQAIEND 126

Query: 131 HEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERIVQQLPSP 190
           HEI+ VLNK DLP+++P++VK+QIE+ IGI T +A+L+SAK+G GI L+LE IV +LP P
Sbjct: 127 HEIVLVLNKLDLPASEPEQVKQQIEDIIGIDTSEAVLISAKSGIGIDLVLEAIVNKLPPP 186

Query: 191 TSPEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVERIGILT 250
              E ++  LKALL+DSWY+ YLGV++LVR+I+G L K   I++M TN+ Y VE +G  T
Sbjct: 187 K--ESSSDILKALLVDSWYDPYLGVVILVRVIDGYLRKNMRIKMMATNSVYTVENVGYFT 244

Query: 251 PKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVVFCGLFP 310
           PK    + L+ GEIG   A+IK+V+  +VGDTITD+  P   ALPGFKP  PVVFCGL+P
Sbjct: 245 PKKHISDVLHAGEIGFFTAAIKQVADCKVGDTITDEKKPCEQALPGFKPNLPVVFCGLYP 304

Query: 311 VDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERLEREFSL 370
            D+++FE+L+ ++ KLRLNDASF +E+E+S+ALG GFRCGFLGLLHLEIIQERL REF L
Sbjct: 305 TDSSEFEHLKDSLAKLRLNDASFEYEMESSSALGVGFRCGFLGLLHLEIIQERLSREFDL 364

Query: 371 NLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEYLGSILKL 430
           +LI T+PSVVY+++M DG   ++ NP D+P++ KI  + EPWI+ TI+ P+E+LG++L L
Sbjct: 365 DLITTAPSVVYKIHMRDGENLEIHNPADLPDLQKIESMEEPWIKATIMVPDEFLGAVLSL 424

Query: 431 CQERRGIQIDMSHLDNRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDYRDSDLV 490
           C E+RG+Q+D S++ NRA I+Y+LPLNE+++DFYDRLKS SKGYASF++ +  Y  S+LV
Sbjct: 425 CTEKRGMQLDHSYIANRAKIIYKLPLNEIVYDFYDRLKSCSKGYASFEWQMDVYEPSELV 484

Query: 491 KLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGGRIIARET 550
           KL ILVN E +DALS +VHRS +E+RGR +C +LK+LIP+Q   IAIQA+IG RIIARET
Sbjct: 485 KLGILVNAEVVDALSTIVHRSRAEQRGRALCVRLKDLIPRQQIDIAIQASIGSRIIARET 544

Query: 551 VKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISILKTDNE 606
           +KA RKDV +KCYGGDI+RKRKLLEKQK GKKRMR++G ++IPQSAFI+ LK  +E
Sbjct: 545 IKALRKDVLSKCYGGDISRKRKLLEKQKAGKKRMRQYGNIEIPQSAFIAALKIGDE 600


>gi|229586525|ref|YP_002845026.1| GTP-binding protein LepA [Rickettsia africae ESF-5]
 gi|259494318|sp|C3PMX3|LEPA_RICAE RecName: Full=Elongation factor 4; Short=EF-4; AltName:
           Full=Ribosomal back-translocase LepA
 gi|228021575|gb|ACP53283.1| GTP-binding protein LepA [Rickettsia africae ESF-5]
          Length = 600

 Score =  822 bits (2124), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 384/596 (64%), Positives = 486/596 (81%), Gaps = 2/596 (0%)

Query: 11  IRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVRLNY 70
           IRNFSI+AHIDHGKSTLADR I+HC GL  REMS QVLD+MDIE+ERGITIKAQTVRL Y
Sbjct: 7   IRNFSIIAHIDHGKSTLADRLIEHCGGLQAREMSQQVLDSMDIEKERGITIKAQTVRLVY 66

Query: 71  TSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQAIDNN 130
            + D   Y LNL+DTPGHVDF YEVSRSL+ACEGSLLVVD+TQGV AQTLANVYQAI+N+
Sbjct: 67  KAKDGNTYYLNLMDTPGHVDFAYEVSRSLAACEGSLLVVDSTQGVAAQTLANVYQAIEND 126

Query: 131 HEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERIVQQLPSP 190
           HEI+ VLNK DLP+++P++VK+QIE+ IGI T DA+L+SAK+G GI L+LE IV +LP P
Sbjct: 127 HEIVLVLNKLDLPASEPEQVKQQIEDIIGIDTSDAVLISAKSGIGIDLVLEAIVNKLPPP 186

Query: 191 TSPEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVERIGILT 250
              E ++  LKALL+DSWY+ YLGV++LVR+I+G L K   I++M TN+ Y VE +G  T
Sbjct: 187 K--ESSSDILKALLVDSWYDQYLGVVILVRVIDGYLRKNMRIKMMATNSVYTVENVGYFT 244

Query: 251 PKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVVFCGLFP 310
           PK    + L+ GEIG   A+IK+V+  +VGDTITD+  P   ALPGFKP  PVVFCGL+P
Sbjct: 245 PKKHISDVLHAGEIGFFTAAIKQVADCKVGDTITDEKKPCEQALPGFKPNLPVVFCGLYP 304

Query: 311 VDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERLEREFSL 370
            D+++FE+L+ ++ KLRLNDASF +E+E+S+ALG GFRCGFLGLLHLEIIQERL REF L
Sbjct: 305 TDSSEFEHLKDSLAKLRLNDASFEYEMESSSALGVGFRCGFLGLLHLEIIQERLSREFDL 364

Query: 371 NLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEYLGSILKL 430
           +LI T+PSVVY+++M DG   ++ NP D+P + KI  + EPWI+ TI+ P+E+LG++L L
Sbjct: 365 DLITTAPSVVYKIHMQDGENLEIHNPADLPNLQKIESMEEPWIKATIMVPDEFLGAVLSL 424

Query: 431 CQERRGIQIDMSHLDNRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDYRDSDLV 490
           C E+RG+Q+D S++ NRA I+Y+LPLNE+++DFYDRLKS SKGYASF++ +  Y  S+LV
Sbjct: 425 CTEKRGMQLDHSYIANRAKIIYKLPLNEIVYDFYDRLKSCSKGYASFEWQMDVYEPSELV 484

Query: 491 KLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGGRIIARET 550
           KL ILVN E +DALS +VHRS +E+RGR +C +LK+LIP+Q   IAIQA+IG RIIARET
Sbjct: 485 KLGILVNAEVVDALSTIVHRSRAEQRGRALCVRLKDLIPRQQIDIAIQASIGSRIIARET 544

Query: 551 VKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISILKTDNE 606
           +KA RKDV +KCYGGDI+RKRKLLEKQK GKKRMR++G ++IPQSAFI+ LK  +E
Sbjct: 545 IKALRKDVLSKCYGGDISRKRKLLEKQKAGKKRMRQYGNIEIPQSAFIAALKIGDE 600


>gi|157828247|ref|YP_001494489.1| GTP-binding protein LepA [Rickettsia rickettsii str. 'Sheila
           Smith']
 gi|165932948|ref|YP_001649737.1| GTP-binding protein LepA [Rickettsia rickettsii str. Iowa]
 gi|166224520|sp|A8GRF6|LEPA_RICRS RecName: Full=Elongation factor 4; Short=EF-4; AltName:
           Full=Ribosomal back-translocase LepA
 gi|189046451|sp|B0BWV5|LEPA_RICRO RecName: Full=Elongation factor 4; Short=EF-4; AltName:
           Full=Ribosomal back-translocase LepA
 gi|157800728|gb|ABV75981.1| GTP-binding protein LepA [Rickettsia rickettsii str. 'Sheila
           Smith']
 gi|165908035|gb|ABY72331.1| GTP-binding protein [Rickettsia rickettsii str. Iowa]
          Length = 600

 Score =  822 bits (2124), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 384/596 (64%), Positives = 489/596 (82%), Gaps = 2/596 (0%)

Query: 11  IRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVRLNY 70
           IRNFSI+AHIDHGKSTLADR I+HC GL  REMS QVLD+MDIE+ERGITIKAQTVRL Y
Sbjct: 7   IRNFSIIAHIDHGKSTLADRLIEHCGGLQAREMSQQVLDSMDIEKERGITIKAQTVRLVY 66

Query: 71  TSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQAIDNN 130
            + D   Y LNL+DTPGHVDF YEVSRSL+ACEGSLLVVD+TQGVEAQTLANVYQAI+N+
Sbjct: 67  KAKDGNTYYLNLMDTPGHVDFAYEVSRSLAACEGSLLVVDSTQGVEAQTLANVYQAIEND 126

Query: 131 HEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERIVQQLPSP 190
           HEI+ VLNK DLP+++P++VK+QIE+ IGI T +A+L+SAK+G GI L+LE IV +LP P
Sbjct: 127 HEIVLVLNKLDLPASEPEQVKQQIEDIIGIDTSEAVLISAKSGIGIDLVLEAIVSKLPPP 186

Query: 191 TSPEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVERIGILT 250
              E ++  LKALL+DSWY+ YLGV++LVR+I+G L K   I++M TN+ Y VE +G  T
Sbjct: 187 K--ESSSDILKALLVDSWYDPYLGVVILVRVIDGYLRKNMRIKMMATNSVYTVENVGYFT 244

Query: 251 PKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVVFCGLFP 310
           PK    + L+ GEIG   A+IK+V+  +VGDTITD+  P   ALPGFKP  PVVFCGL+P
Sbjct: 245 PKKHISDVLHAGEIGFFTAAIKQVADCKVGDTITDEKKPCEQALPGFKPQLPVVFCGLYP 304

Query: 311 VDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERLEREFSL 370
            D+++FE+L+ ++ KLRLNDASF +E+E+S+ALG GFRCGFLGLLHLEIIQERL REF+L
Sbjct: 305 TDSSEFEHLKDSLAKLRLNDASFEYEMESSSALGVGFRCGFLGLLHLEIIQERLSREFNL 364

Query: 371 NLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEYLGSILKL 430
           +LI T+PSVVY+++M DG   ++ NP D+P++ KI  + EPWI+ TI+ P+E+LG++L L
Sbjct: 365 DLITTAPSVVYKIHMRDGENLEIHNPADLPDLQKIESMEEPWIKATIMVPDEFLGAVLSL 424

Query: 431 CQERRGIQIDMSHLDNRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDYRDSDLV 490
           C E+RG+Q+D S++ NRA I+Y+LPLNE+++DFYDRLKS SKGYASF++ +  Y  S+LV
Sbjct: 425 CTEKRGMQLDHSYIANRAKIIYKLPLNEIVYDFYDRLKSCSKGYASFEWQMDVYEPSELV 484

Query: 491 KLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGGRIIARET 550
           KL ILVN E +DALS +VHRS +E+RGR +C +LK+LIP+Q   IAIQA+IG RIIARET
Sbjct: 485 KLGILVNAEVVDALSTIVHRSRAEQRGRALCVRLKDLIPRQQIDIAIQASIGSRIIARET 544

Query: 551 VKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISILKTDNE 606
           +KA RKDV +KCYGGDI+RKRKLLEKQK GKKRMR++G ++IPQSAFI+ LK  +E
Sbjct: 545 IKALRKDVLSKCYGGDISRKRKLLEKQKAGKKRMRQYGNIEIPQSAFIAALKIGDE 600


>gi|157827016|ref|YP_001496080.1| GTP-binding protein LepA [Rickettsia bellii OSU 85-389]
 gi|166224518|sp|A8GW16|LEPA_RICB8 RecName: Full=Elongation factor 4; Short=EF-4; AltName:
           Full=Ribosomal back-translocase LepA
 gi|157802320|gb|ABV79043.1| GTP-binding protein LepA [Rickettsia bellii OSU 85-389]
          Length = 600

 Score =  822 bits (2124), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 382/596 (64%), Positives = 488/596 (81%), Gaps = 2/596 (0%)

Query: 11  IRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVRLNY 70
           IRNFSI+AHIDHGKSTLADR I++C GL  REMS QVLD+MDIE+ERGITIKAQTVRL Y
Sbjct: 7   IRNFSIIAHIDHGKSTLADRLIEYCGGLQAREMSQQVLDSMDIEKERGITIKAQTVRLVY 66

Query: 71  TSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQAIDNN 130
            + D   Y LNL+DTPGHVDF YEVSRSL+ACEGSLLVVD+TQGVEAQTLANVYQAI+N+
Sbjct: 67  KAKDGNTYYLNLMDTPGHVDFAYEVSRSLAACEGSLLVVDSTQGVEAQTLANVYQAIEND 126

Query: 131 HEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERIVQQLPSP 190
           HEI+ VLNK DLP+++PD+VK+QIE+ IGI   +A+L+SAK+G GI L+LE IV +LP P
Sbjct: 127 HEIVPVLNKIDLPASEPDQVKQQIEDIIGIDASEAVLISAKSGIGIDLVLEAIVNKLPPP 186

Query: 191 TSPEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVERIGILT 250
              E +   LKALL+DSWY+ YLGV++LVR+I+G L K   +++M TN+ Y +E +G  T
Sbjct: 187 K--ESSTDILKALLVDSWYDPYLGVVILVRVIDGSLRKNMKVKMMATNSVYTIENVGYFT 244

Query: 251 PKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVVFCGLFP 310
           PK    + L+ GEIG   ASIK+V+  +VGDTITD+  P   ALPGFKP  PVVFCGL+P
Sbjct: 245 PKKHISDVLHAGEIGFFTASIKQVADCKVGDTITDEKKPCKQALPGFKPNLPVVFCGLYP 304

Query: 311 VDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERLEREFSL 370
            D+++FE+L+ ++ KLRLNDASF +E+E+S+ALG GFRCGFLGLLHLEIIQERL REF L
Sbjct: 305 TDSSEFEHLKDSLAKLRLNDASFEYEMESSSALGVGFRCGFLGLLHLEIIQERLSREFDL 364

Query: 371 NLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEYLGSILKL 430
           +LI T+PSVVY+++M +G + ++ NP D+P++ KI  + EPWI+ TI+ P+E+LG++L L
Sbjct: 365 DLITTAPSVVYKIHMREGEVLEIHNPADLPDLQKIDSMEEPWIKATIMVPDEFLGAVLSL 424

Query: 431 CQERRGIQIDMSHLDNRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDYRDSDLV 490
           C E+RGIQ+D +++ NRA +VY+LPLNE+++DFYDRLKS SKGYASF++ +  Y  S+LV
Sbjct: 425 CTEKRGIQLDHNYIANRAKVVYKLPLNEIVYDFYDRLKSCSKGYASFEWQMDTYEPSELV 484

Query: 491 KLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGGRIIARET 550
           KL ILVN+E +DALS +VHRS +E+RGR +C +LK+LIP+Q   IAIQA+IG RIIARET
Sbjct: 485 KLGILVNSEVVDALSTIVHRSRAEQRGRALCVRLKDLIPRQQIDIAIQASIGSRIIARET 544

Query: 551 VKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISILKTDNE 606
           +KA RKDV +KCYGGDITRKRKLLEKQK GKKRMR++G ++IPQSAFI+ LK  +E
Sbjct: 545 IKALRKDVLSKCYGGDITRKRKLLEKQKAGKKRMRQYGNIEIPQSAFIAALKIGDE 600


>gi|326387144|ref|ZP_08208754.1| GTP-binding protein LepA [Novosphingobium nitrogenifigens DSM
           19370]
 gi|326208325|gb|EGD59132.1| GTP-binding protein LepA [Novosphingobium nitrogenifigens DSM
           19370]
          Length = 600

 Score =  821 bits (2120), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 394/601 (65%), Positives = 485/601 (80%), Gaps = 2/601 (0%)

Query: 6   TPLSRIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQT 65
           T L+ IRNFSI+AHIDHGKSTLADR IQ+  GL EREM +QVLDNMDIERERGITIKAQT
Sbjct: 2   TDLALIRNFSIIAHIDHGKSTLADRLIQYTGGLAEREMQAQVLDNMDIERERGITIKAQT 61

Query: 66  VRLNYTSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQ 125
           VRL+YT+ D K Y+LNL+DTPGHVDF YEVSRSL+ACEG+LLVVDA QGVEAQTLANVYQ
Sbjct: 62  VRLDYTAKDGKTYELNLMDTPGHVDFAYEVSRSLAACEGALLVVDAAQGVEAQTLANVYQ 121

Query: 126 AIDNNHEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERIVQ 185
           +I+++HEI+ V+NK DLP+A+P++VK +IEE IG+   +A++ SAK+G GI  +LE IV 
Sbjct: 122 SIEHDHEIVPVINKIDLPAAEPEKVKAEIEEVIGLDASEAVMTSAKSGIGIEEVLEAIVT 181

Query: 186 QLPSPTSPEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVER 245
           ++P P      +APLKA+L+DSWY+ YLGV++LVR+++G + KGQ +R M    ++ ++R
Sbjct: 182 RIPPPQGDR--DAPLKAMLVDSWYDPYLGVVILVRVVDGVIRKGQQVRFMAGGTEHLIDR 239

Query: 246 IGILTPKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVVF 305
           +G + PK+  +  L PGE+G + A IKEV+  RVGDTIT         L GFK +QPVVF
Sbjct: 240 VGCMRPKIELLPELGPGEVGFITAQIKEVAQARVGDTITTVKGGAVEPLAGFKEVQPVVF 299

Query: 306 CGLFPVDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERLE 365
           CGLFP DA  FE LR +I KLRLNDASFSFE+E S ALGFGFRCGFLGLLHLEIIQERL 
Sbjct: 300 CGLFPTDAADFEKLRDSIGKLRLNDASFSFEMETSAALGFGFRCGFLGLLHLEIIQERLS 359

Query: 366 REFSLNLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEYLG 425
           RE+ L+LI T+PSVVY L M DGS+Q+L NP DMP+V KI  + EPWI+ TI TP+EYLG
Sbjct: 360 REYDLDLITTAPSVVYRLTMTDGSVQELHNPADMPDVVKIETMEEPWIKATIYTPDEYLG 419

Query: 426 SILKLCQERRGIQIDMSHLDNRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDYR 485
           SILKLCQ+RRGIQ  ++++  RA + YELPLNEV+FDFYDRLKS+S+GYASFDY  I  R
Sbjct: 420 SILKLCQDRRGIQTGLTYVGGRAQVNYELPLNEVVFDFYDRLKSISRGYASFDYEQIGLR 479

Query: 486 DSDLVKLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGGRI 545
           + DLVK+ ILVNNE +DALS++VHRS +E RGR +CE+LK+LIP+ +F+I IQAAIG ++
Sbjct: 480 EGDLVKMNILVNNEPVDALSMIVHRSQAEARGRALCERLKDLIPRHLFKIPIQAAIGAKV 539

Query: 546 IARETVKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISILKTDN 605
           IARET+ A RKDVTAKCYGGDITRK+KLLEKQKEGKKRMR +G V IPQ AFI+ L+   
Sbjct: 540 IARETIAALRKDVTAKCYGGDITRKKKLLEKQKEGKKRMREYGSVQIPQEAFIAALRMGE 599

Query: 606 E 606
           E
Sbjct: 600 E 600


>gi|34580695|ref|ZP_00142175.1| GTP-binding protein lepA [Rickettsia sibirica 246]
 gi|28262080|gb|EAA25584.1| GTP-binding protein lepA [Rickettsia sibirica 246]
          Length = 600

 Score =  820 bits (2118), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 383/596 (64%), Positives = 488/596 (81%), Gaps = 2/596 (0%)

Query: 11  IRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVRLNY 70
           IRNFSI+AHIDHGKSTLADR I+HC GL  REMS QVLD+MDIE+ERGITIKAQTVRL Y
Sbjct: 7   IRNFSIIAHIDHGKSTLADRLIEHCGGLQAREMSQQVLDSMDIEKERGITIKAQTVRLVY 66

Query: 71  TSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQAIDNN 130
            + D   Y LNL+DTPGHVDF YEVSRSL+ACEGSLLVVD+TQGVEAQTLANVYQAI+N+
Sbjct: 67  KAKDGNTYYLNLMDTPGHVDFAYEVSRSLAACEGSLLVVDSTQGVEAQTLANVYQAIEND 126

Query: 131 HEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERIVQQLPSP 190
           HEI+ VLNK DLP+++P++VK+QIE+ IGI T +A+L+SAK+G GI L+LE IV +LP P
Sbjct: 127 HEIVLVLNKLDLPASEPEQVKQQIEDIIGIDTSEAVLISAKSGIGIDLVLEAIVNKLPPP 186

Query: 191 TSPEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVERIGILT 250
              E ++  LKALL+DSWY+ YLGV++LVR+I+G L K   I++M TN+ Y VE +G  T
Sbjct: 187 K--ESSSDILKALLVDSWYDPYLGVVILVRVIDGYLRKNMRIKMMATNSVYTVENVGYFT 244

Query: 251 PKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVVFCGLFP 310
           PK    + L+ GEIG   A+IK+V+  +VGDTITD+  P   ALPGFKP  PVVFCGL+P
Sbjct: 245 PKKHIADVLHAGEIGFFTAAIKQVADCKVGDTITDEKKPCEQALPGFKPNLPVVFCGLYP 304

Query: 311 VDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERLEREFSL 370
            D+++FE+L+ ++ KLRLNDASF +E+E+S+ALG GFRCGFLGLLHLEIIQERL REF L
Sbjct: 305 TDSSEFEHLKDSLAKLRLNDASFEYEMESSSALGVGFRCGFLGLLHLEIIQERLSREFDL 364

Query: 371 NLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEYLGSILKL 430
           +LI T+PSVVY+++M DG   ++ +P D+P++ KI  + EPWI+ TI+ P+E+LG++L L
Sbjct: 365 DLITTAPSVVYKIHMRDGENLEIHSPADLPDLQKIESMEEPWIKATIMVPDEFLGAVLSL 424

Query: 431 CQERRGIQIDMSHLDNRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDYRDSDLV 490
           C E+RG+Q+D S++ NRA I+Y+LPLNE+++DFYDRLKS SKGYASF++ +  Y  S+LV
Sbjct: 425 CTEKRGMQLDHSYIANRAKIIYKLPLNEIVYDFYDRLKSCSKGYASFEWQMDVYEPSELV 484

Query: 491 KLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGGRIIARET 550
           KL ILVN E +DALS +VHRS +E+RGR +C +LK+LIP+Q   IAIQA+IG RIIARET
Sbjct: 485 KLGILVNAEVVDALSTIVHRSRAEQRGRALCVRLKDLIPRQQIDIAIQASIGSRIIARET 544

Query: 551 VKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISILKTDNE 606
           +KA RKDV +KCYGGDI+RKRKLLEKQK GKKRMR++G ++IPQSAFI+ LK  +E
Sbjct: 545 IKALRKDVLSKCYGGDISRKRKLLEKQKAGKKRMRQYGNIEIPQSAFIAALKIGDE 600


>gi|148284680|ref|YP_001248770.1| GTP-binding protein LepA [Orientia tsutsugamushi str. Boryong]
 gi|166224504|sp|A5CE57|LEPA_ORITB RecName: Full=Elongation factor 4; Short=EF-4; AltName:
           Full=Ribosomal back-translocase LepA
 gi|146740119|emb|CAM80294.1| hypothetical protein OTBS_1228 [Orientia tsutsugamushi str.
           Boryong]
          Length = 601

 Score =  820 bits (2118), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 383/598 (64%), Positives = 480/598 (80%), Gaps = 2/598 (0%)

Query: 9   SRIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVRL 68
           S IRNF+I+AHIDHGKSTLADR I++C  L  REM  QVLD+MDIE+ERGITIKAQTVRL
Sbjct: 5   SNIRNFAIIAHIDHGKSTLADRLIEYCNALEAREMCQQVLDSMDIEKERGITIKAQTVRL 64

Query: 69  NYTSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQAID 128
            Y + D   Y LNL+DTPGHVDF YEVSRSL+ACE SLLVVDA+QGVEAQTLAN+YQA+D
Sbjct: 65  VYKADDGCVYHLNLMDTPGHVDFAYEVSRSLAACESSLLVVDASQGVEAQTLANLYQAVD 124

Query: 129 NNHEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERIVQQLP 188
           NNH+I+ VLNK DLP+A+P +V++QIE+ IGI   DAL++SAK G GI  +L+ IV +LP
Sbjct: 125 NNHKILIVLNKIDLPAANPQQVQQQIEDVIGIDASDALMISAKIGLGIKDVLQAIVTKLP 184

Query: 189 SPTSPEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVERIGI 248
           SP     + + LKALLIDSWY+SYLGV++LVR+++G++ KG  IR+   NA Y VE +G 
Sbjct: 185 SPNG--DSQSQLKALLIDSWYDSYLGVVILVRVVDGKIEKGMRIRMCSNNAVYTVENVGF 242

Query: 249 LTPKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVVFCGL 308
            +PK      LY GEIG + A+IK+V+  RVGDTITDD  P    LPGFKP  PVVFCGL
Sbjct: 243 FSPKKQISGVLYTGEIGFVTAAIKQVADCRVGDTITDDKKPCAQILPGFKPNLPVVFCGL 302

Query: 309 FPVDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERLEREF 368
           +P DA+QF +L+ ++ KLRLNDASF FE E+S ALGFGFRCGFLGLLHLEIIQERLEREF
Sbjct: 303 YPSDASQFNHLKDSLQKLRLNDASFEFEQESSGALGFGFRCGFLGLLHLEIIQERLEREF 362

Query: 369 SLNLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEYLGSIL 428
            L++I T+PSV+Y++Y++ G +  + NP D+PE+ KI  + EPW++ TI  P++YLG+IL
Sbjct: 363 DLDMITTAPSVMYKVYLNTGKVIDVHNPADLPEMQKIKSMSEPWVEATIFIPDQYLGAIL 422

Query: 429 KLCQERRGIQIDMSHLDNRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDYRDSD 488
            LC E+RG+Q+D+++++ RA +VY LPLNE++FDFYD+LKS SKGYASFD+ +  Y+ SD
Sbjct: 423 GLCTEKRGVQVDLTYVNGRAKLVYLLPLNEIVFDFYDKLKSYSKGYASFDWQIDSYKQSD 482

Query: 489 LVKLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGGRIIAR 548
           L+KL+ILVN   +DALS +VHRS +E RGR +C++LK+LIP  +FQIAIQAAIG RIIAR
Sbjct: 483 LIKLSILVNGNPVDALSTIVHRSKAEFRGRELCKRLKDLIPAHLFQIAIQAAIGSRIIAR 542

Query: 549 ETVKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISILKTDNE 606
           ET++A RKDV AKCYGGDITRKRKLLEKQK GKKRMR  G V+IPQSAFI+ LK  N+
Sbjct: 543 ETIRALRKDVLAKCYGGDITRKRKLLEKQKAGKKRMRNIGNVEIPQSAFIAALKITNK 600


>gi|103487519|ref|YP_617080.1| GTP-binding protein LepA [Sphingopyxis alaskensis RB2256]
 gi|119371398|sp|Q1GRH5|LEPA_SPHAL RecName: Full=Elongation factor 4; Short=EF-4; AltName:
           Full=Ribosomal back-translocase LepA
 gi|98977596|gb|ABF53747.1| GTP-binding protein LepA [Sphingopyxis alaskensis RB2256]
          Length = 607

 Score =  820 bits (2117), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 395/606 (65%), Positives = 488/606 (80%), Gaps = 7/606 (1%)

Query: 6   TPLSRIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQT 65
           TPLSRIRNFSI+AHIDHGKSTLADR IQ   GLTEREMS+QVLDNMDIE+ERGITIKAQT
Sbjct: 3   TPLSRIRNFSIIAHIDHGKSTLADRLIQFTGGLTEREMSAQVLDNMDIEKERGITIKAQT 62

Query: 66  VRLNYTSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQ 125
           VRL+YT+ D + YQLNL+DTPGHVDF YEVSRSL+ACEG+LLVVDA QGVEAQTLANVYQ
Sbjct: 63  VRLSYTAKDGETYQLNLMDTPGHVDFAYEVSRSLAACEGALLVVDAAQGVEAQTLANVYQ 122

Query: 126 AIDNNHEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERIVQ 185
           +I+++HEI+ V+NK DLP+AD D+VK +IE+ IG+  +DA+L SAK G GI   LE IV 
Sbjct: 123 SIEHDHEIVPVINKIDLPAADVDKVKAEIEDIIGLPADDAVLASAKAGIGIEETLEAIVA 182

Query: 186 QLPSPTSPEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVER 245
           ++P P     A APL A+L+DSWY+ YLGV++LVR+++G L KGQ I+ M     + ++R
Sbjct: 183 RIPPPRG--DAAAPLVAMLVDSWYDPYLGVVILVRVVDGVLKKGQQIKFMQAGTTHLIDR 240

Query: 246 IGILTPKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVVF 305
           +G  TPK  D+  + PGEIG + A IK+V+  RVGDT+TD   P  + LPGFK +QPVVF
Sbjct: 241 VGCFTPKRTDLVEIGPGEIGFITAQIKDVAQARVGDTVTDAKKPAAAPLPGFKEVQPVVF 300

Query: 306 CGLFPVDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERLE 365
           CGLFP DA  FE LR +I KLRLNDASFSFE+E+S ALGFGFRCGFLGLLHLEIIQERL 
Sbjct: 301 CGLFPTDANDFEKLRESIQKLRLNDASFSFEMESSAALGFGFRCGFLGLLHLEIIQERLT 360

Query: 366 REFSLNLIGTSPSVVYELYMHDGSMQ-----KLSNPIDMPEVTKIAELREPWIQVTIITP 420
           RE+ L+LI T+PSVVY+L +     +     +L NP DMP+  +I E+ EPWI+  I  P
Sbjct: 361 REYDLDLITTAPSVVYKLKLSHTKNEAAKEVELHNPADMPDPNRIDEIEEPWIEAVIYVP 420

Query: 421 NEYLGSILKLCQERRGIQIDMSHLDNRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYN 480
           +EYLG ILKLCQ+RRG+Q +++++  RA I YELPLNEV+FDFYDRLKS+S+GYASFDY+
Sbjct: 421 DEYLGPILKLCQDRRGVQKNLTYVGGRAQITYELPLNEVVFDFYDRLKSISRGYASFDYH 480

Query: 481 VIDYRDSDLVKLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAA 540
            I +R  DLVK++ILVNNE +DALS++VHR  +E RGRG+CE+LK+LIP+ MF+I IQAA
Sbjct: 481 QIGHRPGDLVKMSILVNNEPVDALSMIVHRGSAESRGRGMCERLKDLIPRHMFKIPIQAA 540

Query: 541 IGGRIIARETVKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISI 600
           IGG++IARET+ A RKDVTAKCYGGD TRK+KLLEKQKEGKKRMR +G V+IPQ AFI+ 
Sbjct: 541 IGGKVIARETIAALRKDVTAKCYGGDATRKKKLLEKQKEGKKRMREYGNVNIPQEAFIAA 600

Query: 601 LKTDNE 606
           L+  ++
Sbjct: 601 LRMGDD 606


>gi|189183641|ref|YP_001937426.1| GTP-binding protein LepA [Orientia tsutsugamushi str. Ikeda]
 gi|238692242|sp|B3CRQ1|LEPA_ORITI RecName: Full=Elongation factor 4; Short=EF-4; AltName:
           Full=Ribosomal back-translocase LepA
 gi|189180412|dbj|BAG40192.1| GTP-binding protein LepA [Orientia tsutsugamushi str. Ikeda]
          Length = 601

 Score =  820 bits (2117), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 383/598 (64%), Positives = 480/598 (80%), Gaps = 2/598 (0%)

Query: 9   SRIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVRL 68
           S IRNF+I+AHIDHGKSTLADR I++C  L  REM  QVLD+MDIE+ERGITIKAQTVRL
Sbjct: 5   SNIRNFAIIAHIDHGKSTLADRLIEYCNALEAREMCQQVLDSMDIEKERGITIKAQTVRL 64

Query: 69  NYTSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQAID 128
            Y + D   Y LNL+DTPGHVDF YEVSRSL+ACE SLLVVDA+QGVEAQTLAN+YQA+D
Sbjct: 65  VYKADDGCVYHLNLMDTPGHVDFAYEVSRSLAACESSLLVVDASQGVEAQTLANLYQAVD 124

Query: 129 NNHEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERIVQQLP 188
           NNH+I+ VLNK DLP+A+P +V++QIE+ IGI   DAL++SAK G GI  +L+ IV +LP
Sbjct: 125 NNHKILIVLNKIDLPAANPQQVQQQIEDVIGIDASDALMISAKIGLGIKDVLQAIVTKLP 184

Query: 189 SPTSPEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVERIGI 248
           SP     + + LKALLIDSWY+SYLGV++LVR+++G++ KG  IR+   NA Y VE +G 
Sbjct: 185 SPNGD--SQSQLKALLIDSWYDSYLGVVILVRVVDGKIEKGMRIRMCSNNAVYTVENVGF 242

Query: 249 LTPKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVVFCGL 308
            +PK      LY GEIG + A+IK+V+  RVGDTITDD  P    LPGFKP  PVVFCGL
Sbjct: 243 FSPKKQISGVLYTGEIGFVTAAIKQVADCRVGDTITDDKKPCAQILPGFKPNLPVVFCGL 302

Query: 309 FPVDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERLEREF 368
           +P DA+QF +L+ ++ KLRLNDASF FE E+S ALGFGFRCGFLGLLHLEIIQERLEREF
Sbjct: 303 YPSDASQFNHLKDSLQKLRLNDASFEFEQESSGALGFGFRCGFLGLLHLEIIQERLEREF 362

Query: 369 SLNLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEYLGSIL 428
            L++I T+PSV+Y++Y++ G +  + NP D+PE+ KI  + EPW++ TI  P++YLG+IL
Sbjct: 363 DLDMITTAPSVMYKVYLNTGKVIDVHNPADLPEMQKIKSMSEPWVEATIFIPDQYLGAIL 422

Query: 429 KLCQERRGIQIDMSHLDNRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDYRDSD 488
            LC E+RG+Q+D+++++ RA +VY LPLNE++FDFYD+LKS SKGYASFD+ +  Y+ SD
Sbjct: 423 GLCTEKRGVQVDLTYVNGRAKLVYLLPLNEIVFDFYDKLKSYSKGYASFDWQMNSYKQSD 482

Query: 489 LVKLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGGRIIAR 548
           L+KL+ILVN   +DALS +VHRS +E RGR +C++LK+LIP  +FQIAIQAAIG RIIAR
Sbjct: 483 LIKLSILVNGNPVDALSTIVHRSKAEFRGRELCKRLKDLIPAHLFQIAIQAAIGSRIIAR 542

Query: 549 ETVKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISILKTDNE 606
           ET++A RKDV AKCYGGDITRKRKLLEKQK GKKRMR  G V+IPQSAFI+ LK  N+
Sbjct: 543 ETIRALRKDVLAKCYGGDITRKRKLLEKQKAGKKRMRNIGNVEIPQSAFIAALKITNK 600


>gi|157964349|ref|YP_001499173.1| GTP-binding protein LepA [Rickettsia massiliae MTU5]
 gi|157844125|gb|ABV84626.1| GTP-binding protein LepA [Rickettsia massiliae MTU5]
          Length = 604

 Score =  818 bits (2112), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 382/596 (64%), Positives = 485/596 (81%), Gaps = 2/596 (0%)

Query: 11  IRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVRLNY 70
           IRNFSI+AHIDHGKSTLADR I+HC GL  REMS QVLD+MDIE+ERGITIKAQTVRL Y
Sbjct: 11  IRNFSIIAHIDHGKSTLADRLIEHCGGLQAREMSQQVLDSMDIEKERGITIKAQTVRLVY 70

Query: 71  TSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQAIDNN 130
            + D   Y LNL+DTPGHVDF YEVSRSL+ACEGSLLVVD+TQGVEAQTLANVYQAI+N+
Sbjct: 71  KAKDGNTYYLNLMDTPGHVDFAYEVSRSLAACEGSLLVVDSTQGVEAQTLANVYQAIEND 130

Query: 131 HEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERIVQQLPSP 190
           HEI+ VLNK DLP+++P +VK+QIE+ IGI   +A+L+SAK+G GI L+LE IV +LP P
Sbjct: 131 HEIVLVLNKLDLPASEPAQVKQQIEDIIGIDASEAVLISAKSGIGIDLVLEAIVNKLPPP 190

Query: 191 TSPEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVERIGILT 250
              E ++  LKALL+DSWY+ YLGV++LVR+I+G L K   I++M TN+ Y VE +G  T
Sbjct: 191 K--ESSSDILKALLVDSWYDPYLGVVILVRVIDGYLRKNMRIKMMATNSVYTVENVGYFT 248

Query: 251 PKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVVFCGLFP 310
           PK    + L+ GEIG   A+IK+V+  +VGDTITD+  P   ALPGFKP  PVVFCGL+P
Sbjct: 249 PKKHISDVLHAGEIGFFTAAIKQVADCKVGDTITDEKKPCEQALPGFKPNLPVVFCGLYP 308

Query: 311 VDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERLEREFSL 370
            D+++FE+L+ ++ KLRLNDASF +E+E+S+ALG GFRCGFLGLLHLEIIQERL REF L
Sbjct: 309 TDSSEFEHLKDSLAKLRLNDASFEYEMESSSALGVGFRCGFLGLLHLEIIQERLSREFDL 368

Query: 371 NLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEYLGSILKL 430
           +LI T+PSVVY+++M DG   ++ NP D+P++ KI  + EPWI+ TI+ P+E+LG++L L
Sbjct: 369 DLITTAPSVVYKIHMRDGESLEIHNPADLPDLQKIESMEEPWIKATIMVPDEFLGAVLSL 428

Query: 431 CQERRGIQIDMSHLDNRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDYRDSDLV 490
           C E+RG Q+D S++ NRA I+Y+LPLNE+++DFYDRLKS SKGYASF++ +  Y  S+LV
Sbjct: 429 CTEKRGGQLDHSYIANRAKIIYKLPLNEIVYDFYDRLKSCSKGYASFEWQMDVYEPSELV 488

Query: 491 KLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGGRIIARET 550
           KL ILVN E +DALS +VHRS +E+RGR +C +LK+LIP+Q   IAIQA++G RIIARET
Sbjct: 489 KLGILVNAEAVDALSTIVHRSRAEQRGRALCVRLKDLIPRQQIDIAIQASMGSRIIARET 548

Query: 551 VKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISILKTDNE 606
           +KA RKDV +KCYGGDI+RKRKLLEKQK GKKRMR++G ++IPQSAFI+ LK  +E
Sbjct: 549 IKALRKDVLSKCYGGDISRKRKLLEKQKAGKKRMRQYGNIEIPQSAFIAALKIGDE 604


>gi|238650500|ref|YP_002916352.1| GTP-binding protein LepA [Rickettsia peacockii str. Rustic]
 gi|259494319|sp|C4K153|LEPA_RICPU RecName: Full=Elongation factor 4; Short=EF-4; AltName:
           Full=Ribosomal back-translocase LepA
 gi|238624598|gb|ACR47304.1| GTP-binding protein LepA [Rickettsia peacockii str. Rustic]
          Length = 600

 Score =  818 bits (2112), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 382/596 (64%), Positives = 486/596 (81%), Gaps = 2/596 (0%)

Query: 11  IRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVRLNY 70
           IRNFSI+AHIDHGKSTLADR I+HC GL  REMS QVLD+MDIE+ERGITIKAQTVRL Y
Sbjct: 7   IRNFSIIAHIDHGKSTLADRLIEHCGGLQAREMSQQVLDSMDIEKERGITIKAQTVRLVY 66

Query: 71  TSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQAIDNN 130
            + D   Y LNL+DTPGHVDF YEVSRSL+ACEGSLLVVD+TQGVEAQTL NVYQAI+N+
Sbjct: 67  KAKDGNTYYLNLMDTPGHVDFAYEVSRSLAACEGSLLVVDSTQGVEAQTLTNVYQAIEND 126

Query: 131 HEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERIVQQLPSP 190
           HEI+ VLNK DLP+++P++VK+QIE+ IGI T +A+L+SAK+G GI L+LE IV +LP P
Sbjct: 127 HEIVLVLNKLDLPASEPEQVKQQIEDIIGIDTSEAVLISAKSGIGIDLVLEAIVNKLPPP 186

Query: 191 TSPEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVERIGILT 250
              E ++  LKALL+DSWY+ YLGV++LVR+I+G L K   I++M TN+ Y VE +G  T
Sbjct: 187 K--ESSSDILKALLVDSWYDPYLGVVILVRVIDGYLRKNMRIKMMATNSVYNVENVGYFT 244

Query: 251 PKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVVFCGLFP 310
           PK    + L+ G IG   A+IK+V+  +VGDTITD+  P   ALPGFKP  PVVFCGL+P
Sbjct: 245 PKKHISDVLHAGAIGFFTAAIKQVADCKVGDTITDEKKPCEQALPGFKPNLPVVFCGLYP 304

Query: 311 VDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERLEREFSL 370
            D+++FE+L+ ++ KLRLNDASF +E+E+S+ALG GFRCGFLGLLHLEIIQERL REF L
Sbjct: 305 TDSSEFEHLKDSLAKLRLNDASFEYEMESSSALGVGFRCGFLGLLHLEIIQERLSREFDL 364

Query: 371 NLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEYLGSILKL 430
           +LI T+PSVVY+++M DG   ++ NP D+P++ KI  + EPWI+ TI+ P+E+LG++L L
Sbjct: 365 DLITTAPSVVYKIHMRDGENLEIHNPADLPDLQKIESMEEPWIKATIMVPDEFLGAVLSL 424

Query: 431 CQERRGIQIDMSHLDNRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDYRDSDLV 490
           C E+RG+Q+D S++ NRA I+Y+LPLNE+++DFYDRLKS SKGYASF++ +  Y  S+LV
Sbjct: 425 CTEKRGMQLDHSYIANRAKIIYKLPLNEIVYDFYDRLKSCSKGYASFEWQMDVYEPSELV 484

Query: 491 KLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGGRIIARET 550
           KL ILVN E +DALS +VHRS +E+RGR +C +LK+LIP+Q   IAIQA+IG RIIARET
Sbjct: 485 KLGILVNAEVVDALSTIVHRSRAEQRGRALCVRLKDLIPRQQIDIAIQASIGSRIIARET 544

Query: 551 VKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISILKTDNE 606
           +KA RKDV +KCYGGDI+RKRKLLEKQK GKKRMR++G ++IPQSAFI+ LK  +E
Sbjct: 545 IKALRKDVLSKCYGGDISRKRKLLEKQKAGKKRMRQYGNIEIPQSAFIAALKIGDE 600


>gi|67459392|ref|YP_247016.1| GTP-binding protein LepA [Rickettsia felis URRWXCal2]
 gi|75536188|sp|Q4UKS2|LEPA_RICFE RecName: Full=Elongation factor 4; Short=EF-4; AltName:
           Full=Ribosomal back-translocase LepA
 gi|67004925|gb|AAY61851.1| GTP-binding protein LepA [Rickettsia felis URRWXCal2]
          Length = 600

 Score =  816 bits (2109), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 383/596 (64%), Positives = 485/596 (81%), Gaps = 2/596 (0%)

Query: 11  IRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVRLNY 70
           IRNFSI+AHIDHGKSTLADR I+HC GL  REMS QVLD+MDIE+ERGITIKAQTVRL Y
Sbjct: 7   IRNFSIIAHIDHGKSTLADRLIEHCGGLQAREMSQQVLDSMDIEKERGITIKAQTVRLVY 66

Query: 71  TSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQAIDNN 130
            + D   Y LNL+DTPGHVDF YEVSRSL+ACEGSLLVVD+TQGVEAQTLANVYQAI+N+
Sbjct: 67  KAKDGNTYYLNLMDTPGHVDFAYEVSRSLAACEGSLLVVDSTQGVEAQTLANVYQAIEND 126

Query: 131 HEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERIVQQLPSP 190
           HEI+ VLNK DLP+++P++VK+QI++ IGI   +A+L+SAK+G GI L+LE IV +LP P
Sbjct: 127 HEIVPVLNKIDLPASEPEQVKQQIKDIIGIDASEAVLISAKSGIGIDLVLEAIVNKLPPP 186

Query: 191 TSPEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVERIGILT 250
              E ++  LKALL+DSWY+ YLGV++LVRII+G L K   I++M TN+ Y VE +G  T
Sbjct: 187 K--ESSSDILKALLVDSWYDPYLGVVILVRIIDGTLRKNIRIKMMATNSVYTVENVGYFT 244

Query: 251 PKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVVFCGLFP 310
           PK    + L+ GEIG   ASIK+V+  +VGDTITD+  P   ALPGFKP  PVVFCGL+P
Sbjct: 245 PKKHISDVLHAGEIGFFTASIKQVADCKVGDTITDEKKPCEQALPGFKPNLPVVFCGLYP 304

Query: 311 VDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERLEREFSL 370
            D+ +FE+L+ ++ KLRLNDASF +E+E+S+ALG GFRCGFLGLLHLEIIQERL REF L
Sbjct: 305 TDSAEFEHLKDSLAKLRLNDASFEYEMESSSALGVGFRCGFLGLLHLEIIQERLSREFDL 364

Query: 371 NLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEYLGSILKL 430
           +LI T+PSVVY+++M DG   ++ NP D+ ++ KI  + EPWI+ TI+ P+E+LG++L L
Sbjct: 365 DLITTAPSVVYKIHMRDGESLEIHNPADLSDLQKIESMEEPWIKATIMVPDEFLGAVLSL 424

Query: 431 CQERRGIQIDMSHLDNRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDYRDSDLV 490
           C E+RG+Q+D S++ NRA I+Y+LPLNE+++DFYDRLKS SKGYASF++ +  Y  S+LV
Sbjct: 425 CTEKRGVQLDHSYIANRAKIIYKLPLNEIVYDFYDRLKSCSKGYASFEWQMDVYEPSELV 484

Query: 491 KLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGGRIIARET 550
           KL ILVN E +DALS +VHRS +E+RGR +C +LK+LIP+Q   IAIQA+IG RIIARET
Sbjct: 485 KLGILVNGEEVDALSTIVHRSRAEQRGRALCVRLKDLIPRQQIDIAIQASIGSRIIARET 544

Query: 551 VKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISILKTDNE 606
           +KA RKDV +KCYGGDI+RKRKLLEKQK GKKRMR++G ++IPQSAFI+ LK  +E
Sbjct: 545 IKALRKDVLSKCYGGDISRKRKLLEKQKAGKKRMRQYGNIEIPQSAFIAALKIGDE 600


>gi|239947763|ref|ZP_04699516.1| GTP-binding protein LepA [Rickettsia endosymbiont of Ixodes
           scapularis]
 gi|241116876|ref|XP_002401651.1| GTP-binding protein lepa, putative [Ixodes scapularis]
 gi|215493195|gb|EEC02836.1| GTP-binding protein lepa, putative [Ixodes scapularis]
 gi|239922039|gb|EER22063.1| GTP-binding protein LepA [Rickettsia endosymbiont of Ixodes
           scapularis]
          Length = 600

 Score =  815 bits (2105), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 384/596 (64%), Positives = 485/596 (81%), Gaps = 2/596 (0%)

Query: 11  IRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVRLNY 70
           IRNFSI+AHIDHGKSTLADR I+HC GL  REMS QVLD+MDIE+ERGITIKAQTVRL Y
Sbjct: 7   IRNFSIIAHIDHGKSTLADRLIEHCGGLQIREMSQQVLDSMDIEKERGITIKAQTVRLVY 66

Query: 71  TSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQAIDNN 130
            + D   Y LNL+DTPGHVDF YEVSRSL+ACEGSLLVVD+TQGVEAQTLANVYQAI+N+
Sbjct: 67  KAKDGNTYYLNLMDTPGHVDFAYEVSRSLAACEGSLLVVDSTQGVEAQTLANVYQAIEND 126

Query: 131 HEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERIVQQLPSP 190
           HEI+ VLNK DLP+++P++VK+QIE+ IGI   +A+L+SAK+G GI L+LE IV +LP P
Sbjct: 127 HEIVPVLNKIDLPASEPEQVKQQIEDIIGIDASEAVLISAKSGIGIDLVLEVIVNKLPPP 186

Query: 191 TSPEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVERIGILT 250
              E  +  LKALL+DSWY  YLGV++LVR+I+G L K   I++M TN+ Y VE +G  T
Sbjct: 187 K--ESNSDILKALLVDSWYAPYLGVVILVRVIDGYLRKNMRIKMMATNSVYTVENVGYFT 244

Query: 251 PKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVVFCGLFP 310
           PK    + L+ GEIG   ASIK+++  +VGDTITD+  P   ALPGFKP  PVVFCGL+P
Sbjct: 245 PKKHISDVLHAGEIGFFTASIKQIADCKVGDTITDEKKPCEQALPGFKPNLPVVFCGLYP 304

Query: 311 VDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERLEREFSL 370
            D+++FE+L+ ++ KLRLNDASF +E+E+S+ALG GFRCGFLGLLHLEIIQERL REF L
Sbjct: 305 TDSSEFEHLKYSLAKLRLNDASFEYEMESSSALGVGFRCGFLGLLHLEIIQERLSREFDL 364

Query: 371 NLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEYLGSILKL 430
           +LI T+PSVVY+++M DG   ++ NP D+P++ KI  + EPWI+ TI+ P+E+LG++L L
Sbjct: 365 DLITTAPSVVYKIHMRDGESLEIHNPADLPDLQKIELIEEPWIKATIMVPDEFLGAVLLL 424

Query: 431 CQERRGIQIDMSHLDNRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDYRDSDLV 490
           C E+RG+Q+D S++ NRA IVY+LPLNE+++DFYDRLKS SKGYASF++ +  Y  S+LV
Sbjct: 425 CTEKRGMQLDHSYIANRAKIVYKLPLNEIVYDFYDRLKSCSKGYASFEWQMDVYEPSELV 484

Query: 491 KLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGGRIIARET 550
           KL ILVN E +DALS +VHRS +E+RGR +C +LK+LIP+Q   IAIQA+IG RIIARET
Sbjct: 485 KLGILVNAEVVDALSTIVHRSRAEQRGRALCVRLKDLIPRQQIDIAIQASIGSRIIARET 544

Query: 551 VKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISILKTDNE 606
           +KA RKDV +KCYGGDI+RKRKLLEKQK GKKRMR++G ++IPQSAFI+ LK  +E
Sbjct: 545 IKALRKDVLSKCYGGDISRKRKLLEKQKAGKKRMRQYGNIEIPQSAFIAALKIGDE 600


>gi|262276755|ref|ZP_06054548.1| GTP-binding protein LepA [alpha proteobacterium HIMB114]
 gi|262223858|gb|EEY74317.1| GTP-binding protein LepA [alpha proteobacterium HIMB114]
          Length = 602

 Score =  815 bits (2105), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 378/598 (63%), Positives = 491/598 (82%), Gaps = 3/598 (0%)

Query: 6   TPLSRIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQT 65
           T +S IRNFSIVAHIDHGKSTLADR IQ C GLT+REM  QVLD+M+IERERGITIKAQT
Sbjct: 2   TDISLIRNFSIVAHIDHGKSTLADRLIQTCGGLTDREMKDQVLDSMEIERERGITIKAQT 61

Query: 66  VRLNYTSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQ 125
           VRL Y   D K+Y LN+IDTPGHVDF+YEV+RSL+ACEGSLLVVD+TQGVEAQTLANVYQ
Sbjct: 62  VRLKYKHKDGKEYILNIIDTPGHVDFSYEVNRSLAACEGSLLVVDSTQGVEAQTLANVYQ 121

Query: 126 AIDNNHEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERIVQ 185
           A+DNNHEIITVLNK+DLP+++P+RVK QIE+ IG+ T +A+L S KTGEGI  +L  IV+
Sbjct: 122 ALDNNHEIITVLNKSDLPASEPERVKSQIEDVIGVDTSNAILASGKTGEGIHDILNSIVE 181

Query: 186 QLPSPTSPEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVER 245
            LPSP   E  N  LKALL+DSWY+SYLGV++LVR+I+G++ K   I +M  N+++ VER
Sbjct: 182 NLPSPKGNE--NDSLKALLVDSWYDSYLGVVILVRVIDGKIRKKDQIIMMSNNSRHDVER 239

Query: 246 IGILTPKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVVF 305
           +GI TPK IDIE + PGEIG ++  IK++S T+VGDTIT   +PT+ AL GFKP +PVVF
Sbjct: 240 VGIFTPKAIDIEEIGPGEIGFIVTGIKDLSDTKVGDTITTLKNPTSHALSGFKPSKPVVF 299

Query: 306 CGLFPVDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERLE 365
           CGLFP+D++ +  L+ ++ KL+LND+S  +E ENS+ALG GFRCGFLGLLHLEI+ +RLE
Sbjct: 300 CGLFPIDSSDYGLLKDSLAKLKLNDSSIEYEPENSSALGLGFRCGFLGLLHLEIVVQRLE 359

Query: 366 REFSLNLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEYLG 425
           RE++++LI T+P VVY+L   D  +  L NP +MPE + +  ++EPWI  TIITP+EYLG
Sbjct: 360 REYNISLITTTPGVVYKLETTDNKITDLQNPTNMPEASLVKNIKEPWIIATIITPDEYLG 419

Query: 426 SILKLCQERRGIQIDMSHLDNRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDYR 485
           SI+K+C+E+RG+Q DMS+  NR ++ Y++PLNEV+FDFYDRLKS++ GYASFDY + +Y+
Sbjct: 420 SIIKICEEKRGLQKDMSYSGNRVVLKYDMPLNEVVFDFYDRLKSITSGYASFDYEISEYK 479

Query: 486 DSDLVKLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGGRI 545
           + DL+KL+ILVN+E +DALS+++H+  ++K+GR ICEKLK+LIP+  FQI +QAAIGG+I
Sbjct: 480 EGDLIKLSILVNDEPVDALSVIIHKDFAQKQGRLICEKLKDLIPRHQFQIPVQAAIGGKI 539

Query: 546 IARETVKARRKDVTAKCYGGD-ITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISILK 602
           IARET+K  +KDV  K +GG  + RKRKLL+KQK+GK RM++FG+V+IPQ AFI +LK
Sbjct: 540 IARETIKGFKKDVLTKIHGGGALDRKRKLLDKQKKGKSRMKQFGKVEIPQEAFIGVLK 597


>gi|51473472|ref|YP_067229.1| GTP-binding protein LepA [Rickettsia typhi str. Wilmington]
 gi|60389957|sp|Q68X95|LEPA_RICTY RecName: Full=Elongation factor 4; Short=EF-4; AltName:
           Full=Ribosomal back-translocase LepA
 gi|51459784|gb|AAU03747.1| GTP-binding protein LepA [Rickettsia typhi str. Wilmington]
          Length = 600

 Score =  815 bits (2105), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 381/596 (63%), Positives = 481/596 (80%), Gaps = 2/596 (0%)

Query: 11  IRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVRLNY 70
           IRNFSI+AHIDHGKSTLADR I+HC GL  REMS QVLD+MDIE+ERGITIKAQTVRL Y
Sbjct: 7   IRNFSIIAHIDHGKSTLADRLIEHCGGLNAREMSQQVLDSMDIEKERGITIKAQTVRLVY 66

Query: 71  TSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQAIDNN 130
            + +   Y LNL+DTPGHVDF+YEVSRSL+ACEGSLLVVD+TQGVEAQTLANVYQAI N+
Sbjct: 67  KAKNGNTYYLNLMDTPGHVDFSYEVSRSLAACEGSLLVVDSTQGVEAQTLANVYQAIAND 126

Query: 131 HEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERIVQQLPSP 190
           HEI+ VLNK DL +++P+ VKKQIE+ IGI   +A+L+SAK G GI  +LE I+ +LPSP
Sbjct: 127 HEIVPVLNKIDLAASEPEHVKKQIEDIIGIDASEAVLISAKNGIGIDSVLEAIINKLPSP 186

Query: 191 TSPEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVERIGILT 250
              E +   LKALL+DSWY+ YLGV++LVRII+G L K   ++++GTN+ Y VE +G  T
Sbjct: 187 K--ESSTDTLKALLVDSWYDPYLGVVILVRIIDGTLRKNMRVKMIGTNSVYTVEHVGFFT 244

Query: 251 PKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVVFCGLFP 310
           PK    + LY GEIG   ASIK VS  +VGDTITD+      ALPGFKP  PVVFCG +P
Sbjct: 245 PKKHISDVLYAGEIGFFTASIKRVSDCKVGDTITDEKKSCEQALPGFKPNIPVVFCGFYP 304

Query: 311 VDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERLEREFSL 370
            D+ +FE+L+ ++ KLRLNDASF +E+E+S+ALG GFRCGFLGLLHLEIIQERL REF+L
Sbjct: 305 TDSAEFEHLKDSLAKLRLNDASFEYEMESSSALGVGFRCGFLGLLHLEIIQERLSREFNL 364

Query: 371 NLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEYLGSILKL 430
           +LI T+PSV+Y++YM DG   ++ NP D+P++ KIA + EPWI+ TI+ P+E++G++L L
Sbjct: 365 DLITTAPSVIYKIYMLDGESLEIHNPADLPDLQKIASMEEPWIKATIMVPDEFIGTVLSL 424

Query: 431 CQERRGIQIDMSHLDNRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDYRDSDLV 490
           C+E+RGIQ+D S++ NRA IVY+LPLNE+++DFYDRLKS SKGYASF++ +  Y  SDLV
Sbjct: 425 CKEKRGIQLDHSYISNRAKIVYKLPLNEIVYDFYDRLKSCSKGYASFEWQMDVYELSDLV 484

Query: 491 KLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGGRIIARET 550
            L ILVN E +DALS +VHRS +E+RGR +C +LK+LIP+Q   IAIQA++G RIIARET
Sbjct: 485 NLRILVNGEVVDALSTIVHRSRAEQRGRALCVRLKDLIPRQQIDIAIQASVGNRIIARET 544

Query: 551 VKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISILKTDNE 606
           +KA RKDV +KCYGGDI+RKRKLLEKQK GKK+MR++G ++IPQSAFI+ L+   E
Sbjct: 545 IKALRKDVLSKCYGGDISRKRKLLEKQKAGKKKMRQYGNIEIPQSAFIAALQIGGE 600


>gi|157825494|ref|YP_001493214.1| GTP-binding protein LepA [Rickettsia akari str. Hartford]
 gi|166224517|sp|A8GMT1|LEPA_RICAH RecName: Full=Elongation factor 4; Short=EF-4; AltName:
           Full=Ribosomal back-translocase LepA
 gi|157799452|gb|ABV74706.1| GTP-binding protein LepA [Rickettsia akari str. Hartford]
          Length = 600

 Score =  814 bits (2103), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 383/596 (64%), Positives = 485/596 (81%), Gaps = 2/596 (0%)

Query: 11  IRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVRLNY 70
           IRNFSI+AHIDHGKSTLADR I+HC GL  REM +QVLD+MDIE+ERGITIKAQTVRL Y
Sbjct: 7   IRNFSIIAHIDHGKSTLADRLIEHCGGLQAREMRTQVLDSMDIEKERGITIKAQTVRLVY 66

Query: 71  TSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQAIDNN 130
            + D   Y LNL+DTPGHVDF YEVSRSL+ACEGSLLVVD+TQGVEAQTLANVYQAI+++
Sbjct: 67  KAKDGNTYYLNLMDTPGHVDFAYEVSRSLAACEGSLLVVDSTQGVEAQTLANVYQAIEHD 126

Query: 131 HEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERIVQQLPSP 190
           HEI+ VLNK DLP+++P++VK+QIE+ IGI   +A+L+SAK+G GI L+LE IV +L  P
Sbjct: 127 HEIVPVLNKIDLPASEPEQVKQQIEDIIGIDASEAVLISAKSGIGIDLVLEAIVNKLHPP 186

Query: 191 TSPEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVERIGILT 250
              E +   LKALL+DSWY+ YLGV++LVRII+G L K   I++M TN+ Y VE +G  T
Sbjct: 187 K--ESSTDILKALLVDSWYDPYLGVVILVRIIDGTLRKNMRIKMMATNSVYTVENVGFFT 244

Query: 251 PKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVVFCGLFP 310
           PK    + LY GEIG + ASIK+V+  +VGDTITD+  P   ALPGFKP  PVVFCGL+P
Sbjct: 245 PKKHISDVLYAGEIGFVTASIKQVADCKVGDTITDEKKPCEQALPGFKPNLPVVFCGLYP 304

Query: 311 VDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERLEREFSL 370
            D+++FE+L+ ++ KLRLNDASF +E+E+S+ALG GFRCGFLGLLHLEIIQERL REF L
Sbjct: 305 TDSSEFEHLKDSLAKLRLNDASFEYEMESSSALGVGFRCGFLGLLHLEIIQERLSREFDL 364

Query: 371 NLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEYLGSILKL 430
           +LI T+PSVVY+++M  G   ++ NP D+P++ KI  + EPWI+ TI+ P+E+LG++L L
Sbjct: 365 DLITTAPSVVYKIHMRYGESLEIHNPADLPDLQKIESMEEPWIKATIMVPDEFLGAVLSL 424

Query: 431 CQERRGIQIDMSHLDNRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDYRDSDLV 490
           C E+RG+Q+D S++ NRA IVY+LPLNE+++DFYDRLKS SKGYASF++ +  Y  S+LV
Sbjct: 425 CTEKRGVQLDHSYIANRAKIVYKLPLNEIVYDFYDRLKSCSKGYASFEWQIDVYEPSELV 484

Query: 491 KLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGGRIIARET 550
           KL ILVN E IDALS +VHRS +E+RG+ +C +LK+LIP+Q   IAIQA+IG RIIARET
Sbjct: 485 KLGILVNGEVIDALSTIVHRSRAEQRGKVLCVRLKDLIPRQQIDIAIQASIGSRIIARET 544

Query: 551 VKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISILKTDNE 606
           +KA RKDV +KCYGGDI+RKRKLLEKQK GKKRMR++G ++IPQSAFI+ LK  +E
Sbjct: 545 IKALRKDVLSKCYGGDISRKRKLLEKQKAGKKRMRQYGNIEIPQSAFIAALKIGDE 600


>gi|83594694|ref|YP_428446.1| GTP-binding protein LepA [Rhodospirillum rubrum ATCC 11170]
 gi|83577608|gb|ABC24159.1| GTP-binding protein LepA [Rhodospirillum rubrum ATCC 11170]
          Length = 621

 Score =  813 bits (2100), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 384/600 (64%), Positives = 497/600 (82%), Gaps = 3/600 (0%)

Query: 8   LSRIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVR 67
           LS IRNF+I+AHIDHGKSTLADR IQ C G+  R+M  Q+LD+MD+ERERGITIKAQTVR
Sbjct: 24  LSHIRNFAIIAHIDHGKSTLADRLIQTCGGVEARDMKEQLLDSMDLERERGITIKAQTVR 83

Query: 68  LNYTS-TDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQA 126
           L+YT+ +D + YQLNL+DTPGHVDF YEVSRSL+ACEGSLLVVDA+QGVEAQTLANVYQA
Sbjct: 84  LHYTAKSDGRTYQLNLMDTPGHVDFAYEVSRSLAACEGSLLVVDASQGVEAQTLANVYQA 143

Query: 127 IDNNHEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERIVQQ 186
           ID  HEII VLNK DLP+A+P+R+K+QIE+ IG+ T DA+ +SAKTG  I  +LE +V +
Sbjct: 144 IDAGHEIIPVLNKIDLPAAEPERIKQQIEDVIGLDTSDAVGISAKTGLNIDQVLEALVLR 203

Query: 187 LPSPTSPEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVERI 246
           LP PT     +AP +ALL+DSWY+SYLGV++LVR+ +G L KG  + +M T A + ++++
Sbjct: 204 LPPPTG--DVDAPTQALLVDSWYDSYLGVVILVRVRHGVLRKGMKMLMMATGAVHPIDKV 261

Query: 247 GILTPKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVVFC 306
           G+ TPKM++ ++L  GE+G ++A IK V+  ++GDTITDD +P   ALPGFK   PVV+C
Sbjct: 262 GVFTPKMLETDSLSAGEMGFVMAGIKSVADCQIGDTITDDRAPAAEALPGFKASIPVVWC 321

Query: 307 GLFPVDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERLER 366
           GLFPVD++ FE LR ++ KLRLND+SF F+ E+S ALGFGFRCGFLGLLH+EIIQERLER
Sbjct: 322 GLFPVDSSDFEVLRESLAKLRLNDSSFEFQAESSAALGFGFRCGFLGLLHMEIIQERLER 381

Query: 367 EFSLNLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEYLGS 426
           EF L+LI T+PSVVY ++M DG++ +L NP DMP+  ++  + EPW++ TI+ P+EYLG 
Sbjct: 382 EFGLDLITTAPSVVYRMHMTDGTLLELHNPADMPDPVRLDFVEEPWVKATIMVPDEYLGQ 441

Query: 427 ILKLCQERRGIQIDMSHLDNRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDYRD 486
           IL LC ERRGIQ+D+++  +RAM VY+LPLNE++FDFYDRLKS+S+GYASFDY V DY +
Sbjct: 442 ILALCTERRGIQMDLTYAGSRAMAVYKLPLNEIVFDFYDRLKSISRGYASFDYEVADYAE 501

Query: 487 SDLVKLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGGRII 546
           SDLVK++ILVNNE +DAL+ + HR+ ++ RGR IC +LK+LIP+ +F++ IQAAIGGR+I
Sbjct: 502 SDLVKVSILVNNEPVDALAFIAHRTQADFRGRQICGRLKDLIPRHLFKVPIQAAIGGRVI 561

Query: 547 ARETVKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISILKTDNE 606
           ARET+ A RKDVTAKCYGGDITRK+KLLEKQKEGKK+MR+FG+V+IPQSAFI+ L+  ++
Sbjct: 562 ARETIAAMRKDVTAKCYGGDITRKKKLLEKQKEGKKKMRQFGKVEIPQSAFINALRMSDD 621


>gi|119371387|sp|Q2RNY6|LEPA_RHORT RecName: Full=Elongation factor 4; Short=EF-4; AltName:
           Full=Ribosomal back-translocase LepA
          Length = 601

 Score =  813 bits (2099), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 384/600 (64%), Positives = 497/600 (82%), Gaps = 3/600 (0%)

Query: 8   LSRIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVR 67
           LS IRNF+I+AHIDHGKSTLADR IQ C G+  R+M  Q+LD+MD+ERERGITIKAQTVR
Sbjct: 4   LSHIRNFAIIAHIDHGKSTLADRLIQTCGGVEARDMKEQLLDSMDLERERGITIKAQTVR 63

Query: 68  LNYTS-TDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQA 126
           L+YT+ +D + YQLNL+DTPGHVDF YEVSRSL+ACEGSLLVVDA+QGVEAQTLANVYQA
Sbjct: 64  LHYTAKSDGRTYQLNLMDTPGHVDFAYEVSRSLAACEGSLLVVDASQGVEAQTLANVYQA 123

Query: 127 IDNNHEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERIVQQ 186
           ID  HEII VLNK DLP+A+P+R+K+QIE+ IG+ T DA+ +SAKTG  I  +LE +V +
Sbjct: 124 IDAGHEIIPVLNKIDLPAAEPERIKQQIEDVIGLDTSDAVGISAKTGLNIDQVLEALVLR 183

Query: 187 LPSPTSPEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVERI 246
           LP PT     +AP +ALL+DSWY+SYLGV++LVR+ +G L KG  + +M T A + ++++
Sbjct: 184 LPPPTG--DVDAPTQALLVDSWYDSYLGVVILVRVRHGVLRKGMKMLMMATGAVHPIDKV 241

Query: 247 GILTPKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVVFC 306
           G+ TPKM++ ++L  GE+G ++A IK V+  ++GDTITDD +P   ALPGFK   PVV+C
Sbjct: 242 GVFTPKMLETDSLSAGEMGFVMAGIKSVADCQIGDTITDDRAPAAEALPGFKASIPVVWC 301

Query: 307 GLFPVDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERLER 366
           GLFPVD++ FE LR ++ KLRLND+SF F+ E+S ALGFGFRCGFLGLLH+EIIQERLER
Sbjct: 302 GLFPVDSSDFEVLRESLAKLRLNDSSFEFQAESSAALGFGFRCGFLGLLHMEIIQERLER 361

Query: 367 EFSLNLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEYLGS 426
           EF L+LI T+PSVVY ++M DG++ +L NP DMP+  ++  + EPW++ TI+ P+EYLG 
Sbjct: 362 EFGLDLITTAPSVVYRMHMTDGTLLELHNPADMPDPVRLDFVEEPWVKATIMVPDEYLGQ 421

Query: 427 ILKLCQERRGIQIDMSHLDNRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDYRD 486
           IL LC ERRGIQ+D+++  +RAM VY+LPLNE++FDFYDRLKS+S+GYASFDY V DY +
Sbjct: 422 ILALCTERRGIQMDLTYAGSRAMAVYKLPLNEIVFDFYDRLKSISRGYASFDYEVADYAE 481

Query: 487 SDLVKLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGGRII 546
           SDLVK++ILVNNE +DAL+ + HR+ ++ RGR IC +LK+LIP+ +F++ IQAAIGGR+I
Sbjct: 482 SDLVKVSILVNNEPVDALAFIAHRTQADFRGRQICGRLKDLIPRHLFKVPIQAAIGGRVI 541

Query: 547 ARETVKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISILKTDNE 606
           ARET+ A RKDVTAKCYGGDITRK+KLLEKQKEGKK+MR+FG+V+IPQSAFI+ L+  ++
Sbjct: 542 ARETIAAMRKDVTAKCYGGDITRKKKLLEKQKEGKKKMRQFGKVEIPQSAFINALRMSDD 601


>gi|157803497|ref|YP_001492046.1| GTP-binding protein LepA [Rickettsia canadensis str. McKiel]
 gi|166224519|sp|A8EY28|LEPA_RICCK RecName: Full=Elongation factor 4; Short=EF-4; AltName:
           Full=Ribosomal back-translocase LepA
 gi|157784760|gb|ABV73261.1| GTP-binding protein LepA [Rickettsia canadensis str. McKiel]
          Length = 600

 Score =  811 bits (2094), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 381/596 (63%), Positives = 478/596 (80%), Gaps = 2/596 (0%)

Query: 11  IRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVRLNY 70
           IRNFSI+AHIDHGKSTLADR I+HC G   REMS QVLD+MDIE+ERGITIKAQTV+L Y
Sbjct: 7   IRNFSIIAHIDHGKSTLADRLIEHCGGFQAREMSKQVLDSMDIEKERGITIKAQTVKLLY 66

Query: 71  TSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQAIDNN 130
            + D   Y LNL+DTPGHVDF YEVSRSL+ACEGSLLVVD+TQGVEAQTLANVY+AI+NN
Sbjct: 67  KAKDGNTYYLNLMDTPGHVDFAYEVSRSLAACEGSLLVVDSTQGVEAQTLANVYKAIENN 126

Query: 131 HEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERIVQQLPSP 190
           HEI+ VLNK DLP+++P+ VK+QIE+ IGI   +ALL+SAK+G GI L+LE IV +LP P
Sbjct: 127 HEIVPVLNKIDLPASEPEHVKQQIEDIIGIDASEALLISAKSGIGIDLVLEAIVNKLPPP 186

Query: 191 TSPEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVERIGILT 250
              E ++  LKALL+DSWY+ YLGV++LVRII+G L K   I++M TN+ Y+VE +G  T
Sbjct: 187 K--ESSDDILKALLVDSWYDPYLGVVILVRIIDGALRKNMRIKMMATNSVYKVEHVGYFT 244

Query: 251 PKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVVFCGLFP 310
           PK    + LY GEIG   ASIK+V+  +VGDTITD+  P   ALPGFKP  PVVFCG +P
Sbjct: 245 PKKHIADVLYAGEIGFFTASIKQVADCKVGDTITDEKKPCEQALPGFKPNLPVVFCGFYP 304

Query: 311 VDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERLEREFSL 370
            D+++FE L+ ++ KL LND+SF +E+E+S+ALG GFRCGFLGLLHLEIIQERL REF L
Sbjct: 305 TDSSEFEYLKDSLAKLHLNDSSFEYEMESSSALGVGFRCGFLGLLHLEIIQERLSREFDL 364

Query: 371 NLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEYLGSILKL 430
           +LI T+PSV+Y++YM DG   ++ NP D+P + KI  + EPWI+  II P+E+LG++L L
Sbjct: 365 DLITTAPSVIYKIYMRDGESLEIYNPADLPNLQKIESIEEPWIKAIIIVPDEFLGAVLSL 424

Query: 431 CQERRGIQIDMSHLDNRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDYRDSDLV 490
           C E+RG+Q+D S++ NRA IVY+LPLNE+++DFYDRLKS SKGYASF++ +  Y  S+LV
Sbjct: 425 CTEKRGVQLDHSYIANRARIVYKLPLNEIVYDFYDRLKSCSKGYASFEWQMDVYAPSELV 484

Query: 491 KLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGGRIIARET 550
           KL ILVN + +DALS +VHRS +E+ GR +C +LK+LIP Q   I IQA+IG RIIARET
Sbjct: 485 KLGILVNGKAVDALSTIVHRSRAEQTGRALCVRLKDLIPIQQIDIVIQASIGSRIIARET 544

Query: 551 VKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISILKTDNE 606
           +KA RKDV +KCYGGDITRKRKLLEKQK GKKRMR++G ++IPQSAFI+ LK  +E
Sbjct: 545 IKALRKDVLSKCYGGDITRKRKLLEKQKIGKKRMRQYGNIEIPQSAFIAALKIGDE 600


>gi|149184736|ref|ZP_01863054.1| membrane GTPase [Erythrobacter sp. SD-21]
 gi|148832056|gb|EDL50489.1| membrane GTPase [Erythrobacter sp. SD-21]
          Length = 605

 Score =  810 bits (2091), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 391/606 (64%), Positives = 488/606 (80%), Gaps = 7/606 (1%)

Query: 6   TPLSRIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQT 65
           T LS+IRNFSI+AHIDHGKSTLADR IQ C GLT+REMS QVLDNMDIE+ERGITIKAQT
Sbjct: 2   TDLSKIRNFSIIAHIDHGKSTLADRLIQFCGGLTDREMSEQVLDNMDIEKERGITIKAQT 61

Query: 66  VRLNYTSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQ 125
           VRLNYT+ D + Y+LNL+DTPGHVDF YEVSRSL+ACEG+LLVVDA QGVEAQTLANVYQ
Sbjct: 62  VRLNYTAKDGETYELNLMDTPGHVDFAYEVSRSLAACEGALLVVDAAQGVEAQTLANVYQ 121

Query: 126 AIDNNHEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERIVQ 185
           +I+++HEI+ V+NK DLP+A+PD+VK +IE+ IG+   DA+L SAK+G GI   LE +V 
Sbjct: 122 SIEHDHEIVPVINKIDLPAAEPDKVKAEIEDIIGLDASDAVLTSAKSGIGIEETLEALVA 181

Query: 186 QLPSPTSPEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVER 245
           ++P+PT     +APLKA+L+DSWY+ YLGV++LVR+++G + KG +++ M    ++ ++R
Sbjct: 182 RIPAPTGDR--DAPLKAMLVDSWYDPYLGVVILVRVMDGVIKKGLNVKFMQGGTQHLIDR 239

Query: 246 IGILTPKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVVF 305
           +G  TPK  D+  L PGEIG + A IKEV   RVGDTIT        AL G+K +QPVVF
Sbjct: 240 VGCFTPKRTDLPELGPGEIGFITAQIKEVEQARVGDTITTVKGGAEKALAGYKEVQPVVF 299

Query: 306 CGLFPVDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERLE 365
           CGLFPVDA  FE LR +I KLRLNDASFS+E+E+S ALGFGFR GFLGLLHLEIIQERL 
Sbjct: 300 CGLFPVDAADFEKLRESIGKLRLNDASFSYEMESSAALGFGFRAGFLGLLHLEIIQERLS 359

Query: 366 REFSLNLIGTSPSVVYELYM-----HDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITP 420
           RE+ L+LI T+PSVVY +++      D  +  + NP D P+V +I  + EPWI+  I TP
Sbjct: 360 REYDLDLITTAPSVVYRVHLAHTKTEDAKVIDIHNPADWPDVNRIDMIEEPWIKAVIYTP 419

Query: 421 NEYLGSILKLCQERRGIQIDMSHLDNRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYN 480
           +EYLGSILKLCQ+RRGIQ D++++  RA + YELPLNEV+FDFYDRLKS+S+GYASFDY 
Sbjct: 420 DEYLGSILKLCQDRRGIQTDLTYVGGRAQVSYELPLNEVVFDFYDRLKSISRGYASFDYE 479

Query: 481 VIDYRDSDLVKLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAA 540
            I  R+ DLVK+ I+VNNE +DALS++VHRSV+E+RGRG+CE+LK+LIP+ +F+I IQAA
Sbjct: 480 QIGLREGDLVKMNIMVNNEPVDALSLIVHRSVAEERGRGMCERLKDLIPRHLFKIPIQAA 539

Query: 541 IGGRIIARETVKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISI 600
           IGG+IIARET+ A RKDVTAKCYGGDITRK+KLLEKQK+GK RMR +G V IPQ AFI+ 
Sbjct: 540 IGGKIIARETIAALRKDVTAKCYGGDITRKKKLLEKQKKGKARMREYGNVSIPQEAFIAA 599

Query: 601 LKTDNE 606
           L+   E
Sbjct: 600 LRMGEE 605


>gi|126739966|ref|ZP_01755656.1| GTP-binding protein LepA [Roseobacter sp. SK209-2-6]
 gi|126718785|gb|EBA15497.1| GTP-binding protein LepA [Roseobacter sp. SK209-2-6]
          Length = 599

 Score =  809 bits (2090), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 390/600 (65%), Positives = 492/600 (82%), Gaps = 2/600 (0%)

Query: 6   TPLSRIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQT 65
           T L++IRNFSIVAHIDHGKSTLADR IQ    + +R+M +Q+LD+MDIERERGITIKA T
Sbjct: 2   TDLAKIRNFSIVAHIDHGKSTLADRLIQETGTVEDRDMKAQLLDSMDIERERGITIKANT 61

Query: 66  VRLNYTSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQ 125
           VR+ Y + D + Y LNLIDTPGHVDF YEVSRS+ A EGSLLVVD+TQGVEAQTLANVY 
Sbjct: 62  VRIEYNAEDGEHYVLNLIDTPGHVDFAYEVSRSMRAVEGSLLVVDSTQGVEAQTLANVYH 121

Query: 126 AIDNNHEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERIVQ 185
           AI+ +HEI+ VLNK DLP++D DRV +QIE+ IGI   +A+ VSAKTG+GI   LE IV 
Sbjct: 122 AIEADHEIVPVLNKIDLPASDCDRVAEQIEDVIGIDATEAIQVSAKTGQGIRETLESIVH 181

Query: 186 QLPSPTSPEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVER 245
           +LP+PT     +APLKA+L+DSWY++YLGV+VLVRI++G L KG  ++++   + + V+R
Sbjct: 182 KLPAPTGDR--DAPLKAMLVDSWYDAYLGVIVLVRIMDGVLKKGDKVKMLSNGSVHHVDR 239

Query: 246 IGILTPKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVVF 305
           IG+  P+M  I+ L PGEIG + ASIK+V  TRVGDTIT +   T  ALPGFKP QPVVF
Sbjct: 240 IGVFRPEMTVIDELGPGEIGFLTASIKQVRDTRVGDTITHEKKGTEDALPGFKPAQPVVF 299

Query: 306 CGLFPVDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERLE 365
           CGLFPVD+ +FE+LR AI+KL LNDASFS+E+E S ALGFGFRCGFLGLLHLE+I++R+E
Sbjct: 300 CGLFPVDSAEFEDLRDAIDKLALNDASFSYEMETSAALGFGFRCGFLGLLHLEVIRDRIE 359

Query: 366 REFSLNLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEYLG 425
           RE+ + LI T+PSVVY +YM DG+M  L NP DMP+++ +  L EP I+ TI+ P+EYLG
Sbjct: 360 REYDIELITTAPSVVYHVYMKDGTMIDLHNPADMPDLSVVDHLEEPRIKATILVPDEYLG 419

Query: 426 SILKLCQERRGIQIDMSHLDNRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDYR 485
            +LKLCQERRG+Q+D+++  +RAM VY+LPLNEV+FDFYDRLKSV+KGYASFDY +  Y+
Sbjct: 420 DVLKLCQERRGVQMDLTYAGSRAMAVYDLPLNEVVFDFYDRLKSVTKGYASFDYQMTGYQ 479

Query: 486 DSDLVKLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGGRI 545
             +LVK+++LVN+E +DALS++VHR  +E+RGR +CEKLK LIP+ MF+I IQAAIGG++
Sbjct: 480 TDNLVKMSVLVNDEPVDALSMMVHRDRAEQRGRAMCEKLKELIPRHMFKIPIQAAIGGKV 539

Query: 546 IARETVKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISILKTDN 605
           IARET+ A RKDVTAKCYGGD TRK+KLLEKQK+GKK+MR+FG+VDIPQ AFIS LK D+
Sbjct: 540 IARETLSAMRKDVTAKCYGGDATRKKKLLEKQKKGKKKMRQFGKVDIPQEAFISALKMDS 599


>gi|126725207|ref|ZP_01741050.1| GTP-binding protein LepA [Rhodobacterales bacterium HTCC2150]
 gi|126706371|gb|EBA05461.1| GTP-binding protein LepA [Rhodobacterales bacterium HTCC2150]
          Length = 599

 Score =  801 bits (2070), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 397/601 (66%), Positives = 489/601 (81%), Gaps = 4/601 (0%)

Query: 6   TPLSRIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQT 65
           T LS IRNFSIVAHIDHGKSTLADR IQ    + +R+M +Q+LD MDIE+ERGITIKA +
Sbjct: 2   TKLSNIRNFSIVAHIDHGKSTLADRLIQSTGTVADRDMEAQLLDTMDIEKERGITIKANS 61

Query: 66  VRLNYTSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQ 125
           VR+ Y + D + Y LNLIDTPGHVDF YEVSRS+ A EGSLLVVDA+QGVEAQTLANVY 
Sbjct: 62  VRIEYKAKDGETYILNLIDTPGHVDFAYEVSRSMRAVEGSLLVVDASQGVEAQTLANVYH 121

Query: 126 AIDNNHEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERIVQ 185
           A+D +HEI+ VLNK DLP+A+P++V +QIE+ IGI   DA+ +SAKTG GIP +LE IV 
Sbjct: 122 ALDADHEIVPVLNKIDLPAAEPEQVCEQIEDVIGIDASDAVHISAKTGIGIPDVLEAIVT 181

Query: 186 QLPSPTSPEGA-NAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVE 244
           +LP+P   EG  +APLKA+L+DSWY+SYLGV+VLVRII+G L KG  I+++ T A Y V+
Sbjct: 182 RLPAP---EGERDAPLKAMLVDSWYDSYLGVVVLVRIIDGVLKKGDKIKMINTGALYPVD 238

Query: 245 RIGILTPKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVV 304
           RIG+  P M  I+ L PGE+G + ASIK+V  TRVGDTIT +    T ALPGFKP QPVV
Sbjct: 239 RIGVFRPGMEVIDELGPGEMGFLTASIKQVRDTRVGDTITHEKKGCTEALPGFKPSQPVV 298

Query: 305 FCGLFPVDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERL 364
           FCGLFPVD+ +FE+LR AI KL LNDASFS E+E S ALGFGFRCGFLGLLHLE+I++RL
Sbjct: 299 FCGLFPVDSAEFEDLRNAIEKLSLNDASFSSEMETSAALGFGFRCGFLGLLHLEVIRDRL 358

Query: 365 EREFSLNLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEYL 424
           ERE++++LI T+PSV+Y ++M DGSM +L NP DMP++T +  L EP I+ TI+ P+EYL
Sbjct: 359 EREYNIDLITTAPSVIYNIHMRDGSMVELHNPADMPDLTHVDHLEEPRIKATILVPDEYL 418

Query: 425 GSILKLCQERRGIQIDMSHLDNRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDY 484
           G +LKLCQ+RRGIQ D+++  +RAM+VY+LPLNEV+FDFYDRLKSV+KGYASFDY +  Y
Sbjct: 419 GDVLKLCQDRRGIQEDLTYAGSRAMVVYDLPLNEVVFDFYDRLKSVTKGYASFDYVMTGY 478

Query: 485 RDSDLVKLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGGR 544
           R+  LVK+ I+VN+E +DALS +VH   +E RGR + EKLK+LIP+ MF+I IQAAIGGR
Sbjct: 479 REDRLVKMQIMVNDEPVDALSTMVHTDRAEARGRAMVEKLKDLIPRHMFKIPIQAAIGGR 538

Query: 545 IIARETVKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISILKTD 604
           IIARET+ A RKDVTAKCYGGD TRK+KLLEKQK+GKK+MR+FG+VDIPQ AFIS LK D
Sbjct: 539 IIARETLSAMRKDVTAKCYGGDATRKKKLLEKQKKGKKKMRQFGKVDIPQEAFISALKMD 598

Query: 605 N 605
            
Sbjct: 599 G 599


>gi|15604145|ref|NP_220660.1| GTP-binding protein LepA [Rickettsia prowazekii str. Madrid E]
 gi|6647576|sp|Q9ZDQ1|LEPA_RICPR RecName: Full=Elongation factor 4; Short=EF-4; AltName:
           Full=Ribosomal back-translocase LepA
 gi|3860837|emb|CAA14737.1| GTP-BINDING PROTEIN LEPA (lepA) [Rickettsia prowazekii]
 gi|292571872|gb|ADE29787.1| GTP-binding protein LepA [Rickettsia prowazekii Rp22]
          Length = 600

 Score =  801 bits (2070), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 379/596 (63%), Positives = 474/596 (79%), Gaps = 2/596 (0%)

Query: 11  IRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVRLNY 70
           IRNFSI+AHIDHGKSTLADR I++C GL  REMS QVLD+MDIERERGITIKAQTVRL Y
Sbjct: 7   IRNFSIIAHIDHGKSTLADRLIEYCGGLNAREMSQQVLDSMDIERERGITIKAQTVRLVY 66

Query: 71  TSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQAIDNN 130
            + +   Y LNL+DTPGHVDF YEVSRSL+ACEGSLLVVD+TQGVEAQTLANVYQAI N+
Sbjct: 67  KAKNGNTYYLNLMDTPGHVDFAYEVSRSLAACEGSLLVVDSTQGVEAQTLANVYQAIAND 126

Query: 131 HEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERIVQQLPSP 190
           H I+ VLNK DL +++PD VK QIE+ IGI   +A+L+SAK G GI  +LE I+ +LP+P
Sbjct: 127 HLIVPVLNKIDLAASEPDYVKTQIEDIIGIDASEAVLISAKNGIGIDSVLEAIINKLPAP 186

Query: 191 TSPEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVERIGILT 250
              E +   LKALL+DSWY+ YLGV++LVRII+G L K   +++M TN+ Y VE +G  T
Sbjct: 187 K--ESSTDILKALLVDSWYDPYLGVVILVRIIDGALRKNMRVKMMRTNSVYTVEHVGFFT 244

Query: 251 PKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVVFCGLFP 310
           PK    + LY GEIG   ASIK VS  +VGDTITD+      ALPGFKP  PVVFCG +P
Sbjct: 245 PKKHISDVLYAGEIGFFTASIKRVSDCKVGDTITDEKKSCEQALPGFKPNIPVVFCGFYP 304

Query: 311 VDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERLEREFSL 370
            D+ +FE+L+ ++ KLRLNDASF +E+E+S+ALG GFRCGFLGLLHLEIIQERL REF L
Sbjct: 305 TDSAEFEHLKDSLAKLRLNDASFEYEMESSSALGVGFRCGFLGLLHLEIIQERLSREFDL 364

Query: 371 NLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEYLGSILKL 430
           +LI T+PSV+Y++ M DG   ++ NP D+P++ KIA + EPWI+ TII P+E++G++L L
Sbjct: 365 DLITTAPSVIYKINMLDGQNLEIHNPADLPDLQKIASMEEPWIKATIIVPDEFIGTVLSL 424

Query: 431 CQERRGIQIDMSHLDNRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDYRDSDLV 490
           C E+RGIQ+D S++ NRA IVY+LPLNE+++DFYDRLKS SKGYASF++ +  Y  SDLV
Sbjct: 425 CTEKRGIQLDHSYISNRAKIVYKLPLNEIVYDFYDRLKSCSKGYASFEWQMDVYELSDLV 484

Query: 491 KLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGGRIIARET 550
            L ILVN E +DALS +VHRS +E+RGR +C +LK+LIP+Q   IAIQA++G RIIARET
Sbjct: 485 NLRILVNGEVVDALSTIVHRSRAEQRGRALCIRLKDLIPRQQIDIAIQASVGSRIIARET 544

Query: 551 VKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISILKTDNE 606
           +KA RKDV +KCYGGDI+RKRKLLEKQK GKK+MR++G ++IPQSAFI+ L+   E
Sbjct: 545 IKALRKDVLSKCYGGDISRKRKLLEKQKAGKKKMRQYGNIEIPQSAFIAALQIGGE 600


>gi|86136573|ref|ZP_01055152.1| GTP-binding protein LepA [Roseobacter sp. MED193]
 gi|85827447|gb|EAQ47643.1| GTP-binding protein LepA [Roseobacter sp. MED193]
          Length = 599

 Score =  800 bits (2067), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 388/600 (64%), Positives = 492/600 (82%), Gaps = 2/600 (0%)

Query: 6   TPLSRIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQT 65
           T L++IRNFSIVAHIDHGKSTLADR IQ    + +R+M +Q+LD+MDIERERGITIKA T
Sbjct: 2   TDLAKIRNFSIVAHIDHGKSTLADRLIQETGTVEDRDMKAQLLDSMDIERERGITIKANT 61

Query: 66  VRLNYTSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQ 125
           VR++Y + D + Y LNLIDTPGHVDF YEVSRS+ A EGSLLVVD+TQGVEAQTLANVY 
Sbjct: 62  VRIDYKADDGEAYVLNLIDTPGHVDFAYEVSRSMRAVEGSLLVVDSTQGVEAQTLANVYH 121

Query: 126 AIDNNHEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERIVQ 185
           A++ +HEI+ VLNK DLP++D DRV +QIE+ IGI    A+ VSAKTG+GI   LE IV 
Sbjct: 122 AMEADHEIVPVLNKIDLPASDCDRVAEQIEDVIGIEATGAIQVSAKTGQGIHETLEAIVN 181

Query: 186 QLPSPTSPEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVER 245
           +LP+P      +APLKA+L+DSWY++YLGV+VLVRI++G L KG+ I+++   + + V+R
Sbjct: 182 ELPAPKGTR--DAPLKAMLVDSWYDAYLGVIVLVRIMDGVLKKGERIKMLSNGSTHHVDR 239

Query: 246 IGILTPKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVVF 305
           IG+  P+M  I+ L PGEIG + ASIK+V  TRVGDTIT +   T   LPGFKP QPVVF
Sbjct: 240 IGVFRPEMEVIDELGPGEIGFLTASIKQVRDTRVGDTITHEKKGTEEVLPGFKPAQPVVF 299

Query: 306 CGLFPVDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERLE 365
           CGLFPVD+++FE+LR AI+KL LNDASFSFE+E S ALGFGFRCGFLGLLHLE+I++R+E
Sbjct: 300 CGLFPVDSSEFEDLRDAIDKLALNDASFSFEMETSAALGFGFRCGFLGLLHLEVIRDRVE 359

Query: 366 REFSLNLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEYLG 425
           RE+++ LI T+PSVVY +YM D +M +L NP DMP++T +  L EP I+ TI+ P+EYLG
Sbjct: 360 REYNIELITTAPSVVYHVYMRDETMIELHNPADMPDLTHVDHLEEPRIKATILVPDEYLG 419

Query: 426 SILKLCQERRGIQIDMSHLDNRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDYR 485
            +LKLCQ+RRGIQ+D+++  +RAM VY+LPLNEV+FDFYDRLKSV+KGYASFDY +  Y+
Sbjct: 420 DVLKLCQDRRGIQLDLTYAGSRAMAVYDLPLNEVVFDFYDRLKSVTKGYASFDYQMTGYQ 479

Query: 486 DSDLVKLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGGRI 545
             +LVK+++LVN+E +DALS++VHR  +E RGR + EKLK+LIP+ MF+I IQAAIGG++
Sbjct: 480 TDNLVKMSVLVNDEPVDALSMMVHRDRAEARGRAMVEKLKDLIPRHMFKIPIQAAIGGKV 539

Query: 546 IARETVKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISILKTDN 605
           IARET+ A RKDVTAKCYGGD TRK+KLLEKQK+GKK+MR+FG+VDIPQ AFIS LK D+
Sbjct: 540 IARETLSAMRKDVTAKCYGGDATRKKKLLEKQKKGKKKMRQFGKVDIPQEAFISALKMDS 599


>gi|87200600|ref|YP_497857.1| GTP-binding protein LepA [Novosphingobium aromaticivorans DSM
           12444]
 gi|119371374|sp|Q2G550|LEPA_NOVAD RecName: Full=Elongation factor 4; Short=EF-4; AltName:
           Full=Ribosomal back-translocase LepA
 gi|87136281|gb|ABD27023.1| GTP-binding protein LepA [Novosphingobium aromaticivorans DSM
           12444]
          Length = 605

 Score =  797 bits (2058), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 384/606 (63%), Positives = 486/606 (80%), Gaps = 7/606 (1%)

Query: 6   TPLSRIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQT 65
           T L+ IRNFSI+AHIDHGKSTLADR IQ+  GLTEREMS QVLDNMDIE+ERGITIKAQT
Sbjct: 2   TDLALIRNFSIIAHIDHGKSTLADRLIQYTGGLTEREMSEQVLDNMDIEKERGITIKAQT 61

Query: 66  VRLNYTSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQ 125
           VRL+YT  D K YQLNL+DTPGHVDF YEVSRSL+ACEG+LLVVDA QGVEAQTLANVYQ
Sbjct: 62  VRLDYTGKDGKTYQLNLMDTPGHVDFAYEVSRSLAACEGALLVVDAAQGVEAQTLANVYQ 121

Query: 126 AIDNNHEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERIVQ 185
           +I+++HEI+ V+NK DLP+A+P++VK +IE+ IG+   +A+L SAK+G GI  +L+ +V+
Sbjct: 122 SIEHDHEIVPVINKIDLPAAEPEKVKAEIEDVIGLDASNAVLTSAKSGIGIEEVLDAVVE 181

Query: 186 QLPSPTSPEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVER 245
           ++P P      +APLKA+L+DSWY+ YLGV++LVR+I+G + KG  ++ M    ++ ++R
Sbjct: 182 RIPPPKGDR--SAPLKAMLVDSWYDPYLGVVILVRVIDGVIRKGLQVKFMAGGTEHLIDR 239

Query: 246 IGILTPKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVVF 305
           +G + PK+  ++ L PGEIG + A IKEV+  RVGDTIT      + ALPGFK +QPVVF
Sbjct: 240 VGCMRPKIETLDELGPGEIGFITAQIKEVAQARVGDTITTVKQGASEALPGFKEVQPVVF 299

Query: 306 CGLFPVDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERLE 365
           CG+FPVDA  FE LR +I KLRLNDASFSFE+E+S ALGFGFRCGFLGLLHLEIIQERL 
Sbjct: 300 CGIFPVDAADFEKLRESIAKLRLNDASFSFEMESSAALGFGFRCGFLGLLHLEIIQERLS 359

Query: 366 REFSLNLIGTSPSVVYELYMH-----DGSMQKLSNPIDMPEVTKIAELREPWIQVTIITP 420
           RE+ L+LI T+PSVVY + +      D     L NP D P+ ++I  + EPWI+ TI TP
Sbjct: 360 REYDLDLITTAPSVVYRIQLRASRNDDAREILLHNPADYPDPSRIETIEEPWIKGTIYTP 419

Query: 421 NEYLGSILKLCQERRGIQIDMSHLDNRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYN 480
           +EYLGS+LKLCQ+RRGIQ  ++++  RA + YELPLNEV+FDFYDRLKS+S+GYASFDY 
Sbjct: 420 DEYLGSVLKLCQDRRGIQTGLTYVGGRAQVTYELPLNEVVFDFYDRLKSISRGYASFDYE 479

Query: 481 VIDYRDSDLVKLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAA 540
            +  R+ DLVK++ILVNNE +DALS++VHRS +E RGR +CE+LK+LIP+ +F+I IQAA
Sbjct: 480 QVGLREGDLVKMSILVNNEPVDALSMIVHRSAAEARGRHMCERLKDLIPRHLFKIPIQAA 539

Query: 541 IGGRIIARETVKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISI 600
           IGG+++ARET+ A RKDVTAKCYGGDITRK+KLLEKQK+GK RMR +G V IPQ AFI+ 
Sbjct: 540 IGGKVVARETISAMRKDVTAKCYGGDITRKKKLLEKQKKGKARMREYGNVSIPQEAFIAA 599

Query: 601 LKTDNE 606
           L+   E
Sbjct: 600 LRMGEE 605


>gi|190570916|ref|YP_001975274.1| GTP-binding protein LepA [Wolbachia endosymbiont of Culex
           quinquefasciatus Pel]
 gi|213019432|ref|ZP_03335238.1| GTP-binding protein LepA [Wolbachia endosymbiont of Culex
           quinquefasciatus JHB]
 gi|238057821|sp|B3CPV1|LEPA_WOLPP RecName: Full=Elongation factor 4; Short=EF-4; AltName:
           Full=Ribosomal back-translocase LepA
 gi|190357188|emb|CAQ54604.1| GTP-binding protein LepA [Wolbachia endosymbiont of Culex
           quinquefasciatus Pel]
 gi|212994854|gb|EEB55496.1| GTP-binding protein LepA [Wolbachia endosymbiont of Culex
           quinquefasciatus JHB]
          Length = 598

 Score =  796 bits (2056), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 373/600 (62%), Positives = 478/600 (79%), Gaps = 4/600 (0%)

Query: 8   LSRIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVR 67
           ++ IRNF+I+AHIDHGKSTLADR I+ C GL  REM++QVLD+MDIERERGITIKAQTVR
Sbjct: 1   MNNIRNFAIIAHIDHGKSTLADRLIEECNGLETREMTNQVLDSMDIERERGITIKAQTVR 60

Query: 68  LNYTSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQAI 127
           LNYT+ +   Y LNL+DTPGHVDF+YEVSRSL+ACEGSLLVVD++QGVEAQTLANVY+AI
Sbjct: 61  LNYTANNGNKYCLNLMDTPGHVDFSYEVSRSLAACEGSLLVVDSSQGVEAQTLANVYKAI 120

Query: 128 DNNHEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERIVQQL 187
           DNNHEII VLNK DLP+ADP+R+K QIEE IGI   +++L+SAKTG GI  +LE IV +L
Sbjct: 121 DNNHEIIVVLNKVDLPAADPERIKLQIEEVIGIDATESILISAKTGLGIKDVLEAIVTKL 180

Query: 188 PSPTSPEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVERIG 247
           P+P      NAPL+A+L+DSWY+ YLGV++LVR+ NG L KG  I +M  NA YQV+ IG
Sbjct: 181 PAPQG--DTNAPLQAILVDSWYDPYLGVVILVRVKNGVLKKGMRIVMMSNNATYQVDNIG 238

Query: 248 ILTPKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVVFCG 307
           I TPK +    L  GE+G + AS+KEV+  +VGDTIT++  P + ALPGFK + PVVFC 
Sbjct: 239 IFTPKKVMTGELSAGEVGFITASMKEVADCKVGDTITEEKRPCSKALPGFKEVHPVVFCS 298

Query: 308 LFPVDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERLERE 367
           +FP +   F+ LR A+ KL LNDASF+F+ E S ALG+GFRCGFLG+LHLE+IQERLERE
Sbjct: 299 IFPNNTDDFKYLREALEKLHLNDASFTFDAETSNALGYGFRCGFLGMLHLEVIQERLERE 358

Query: 368 FSLNLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEYLGSI 427
           F L+L  T+PSV+Y++   +G +  + NP DMP+ TKI  + EPWI  TI+ P++YLG I
Sbjct: 359 FDLDLTATAPSVIYKVETQNGKVLNIHNPSDMPDPTKIEIVEEPWITATIMVPDQYLGEI 418

Query: 428 LKLCQERRGIQIDMSHLDN--RAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDYR 485
           L LC+ERRG Q D+S++ N   A++ Y+LPL+EV+FDFYDRLKS+SKGYAS D+ + DY+
Sbjct: 419 LSLCEERRGEQQDLSYVGNTTTALLKYKLPLSEVVFDFYDRLKSISKGYASLDWEISDYQ 478

Query: 486 DSDLVKLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGGRI 545
           +S + KL+ LVN E +DAL+ +VH+S +EKRGR IC +LK+LIP+Q ++IAIQAA+GG+I
Sbjct: 479 ESQIDKLSFLVNGEPVDALACIVHKSRAEKRGREICARLKDLIPRQQYKIAIQAAVGGKI 538

Query: 546 IARETVKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISILKTDN 605
           IARET+   RKDVTAK YGGD+TR+ KLLEKQK+GKKR+   G ++IPQ+AFI  LK ++
Sbjct: 539 IARETINPYRKDVTAKLYGGDVTRRMKLLEKQKKGKKRLHSVGNINIPQNAFIEALKIND 598


>gi|330813588|ref|YP_004357827.1| translation elongation factor LepA [Candidatus Pelagibacter sp.
           IMCC9063]
 gi|327486683|gb|AEA81088.1| translation elongation factor LepA [Candidatus Pelagibacter sp.
           IMCC9063]
          Length = 602

 Score =  796 bits (2055), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 374/597 (62%), Positives = 479/597 (80%), Gaps = 3/597 (0%)

Query: 11  IRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVRLNY 70
           IRNFSIVAHIDHGKSTLADR IQ C GL  REM  QVLD+MDIERERGITIKAQTVRLNY
Sbjct: 7   IRNFSIVAHIDHGKSTLADRLIQTCGGLQSREMKEQVLDSMDIERERGITIKAQTVRLNY 66

Query: 71  TSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQAIDNN 130
              D K Y LN++DTPGHVDF+YEVSRSL+ACEGSLL+VD+TQGVEAQTLANVYQA+DNN
Sbjct: 67  KHKDGKTYILNIMDTPGHVDFSYEVSRSLAACEGSLLIVDSTQGVEAQTLANVYQAMDNN 126

Query: 131 HEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERIVQQLPSP 190
           HEI+ VLNKADLP+++P+ VK++I++ IG+ T  A+L S KTG GI  +L  IV++LP+P
Sbjct: 127 HEIVVVLNKADLPASEPELVKQEIQDVIGLDTSSAILASGKTGIGIEDILTAIVEKLPAP 186

Query: 191 TSPEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVERIGILT 250
            S   +N  LKALL+DSWY+SYLGV++LVRII+G + +   I +M  +AKY+++++G+ T
Sbjct: 187 ISE--SNDQLKALLVDSWYDSYLGVVILVRIIDGYIKRDDEILMMSNSAKYKIDKVGVFT 244

Query: 251 PKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVVFCGLFP 310
           PK I+ +AL PGE+G ++  IK VS T+VGDTIT   +P T ALPGFKP +PVVFCGLFP
Sbjct: 245 PKPINKDALGPGEMGFIVTGIKSVSETKVGDTITLSKNPITKALPGFKPSKPVVFCGLFP 304

Query: 311 VDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERLEREFSL 370
           VD++ +  LR ++ KL LND+S  +E E+S+ALG GFRCGFLGLLHLEI  +RL+RE++L
Sbjct: 305 VDSSDYGLLRDSLGKLSLNDSSLIYEAESSSALGLGFRCGFLGLLHLEIAVQRLDREYNL 364

Query: 371 NLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEYLGSILKL 430
           NLI T+P VVY+L   DG+   L NP  MPE   I  ++EPWI  T+ITP+EYLGSI+KL
Sbjct: 365 NLITTTPGVVYKLEKTDGTKSDLQNPSSMPEPNFIKTIKEPWIDATLITPDEYLGSIIKL 424

Query: 431 CQERRGIQIDMSHLDNRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDYRDSDLV 490
           C+E+RG+Q ++S+  NRA++ YELPLNEV+FDFYDRLKS+S GYASFDY + DY+D DL+
Sbjct: 425 CEEKRGLQKNLSYSGNRAVLKYELPLNEVVFDFYDRLKSISSGYASFDYEINDYKDGDLI 484

Query: 491 KLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGGRIIARET 550
           KL++LVN E +DALS+++HR  + ++GR ICEKLK LIP+  FQI IQAAIGG++IARET
Sbjct: 485 KLSVLVNAEPVDALSMIIHREFAVRQGRLICEKLKELIPRHQFQIPIQAAIGGKVIARET 544

Query: 551 VKARRKDVTAKCYGGDI-TRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISILKTDNE 606
           ++  +KDV  K +GG    RKRKLL+KQK+GK RM++FG V+IPQ AFI +LK + +
Sbjct: 545 IQGFKKDVLTKIHGGGARDRKRKLLDKQKKGKSRMKQFGNVEIPQEAFIGVLKINKD 601


>gi|71083150|ref|YP_265869.1| GTP-binding protein LepA [Candidatus Pelagibacter ubique HTCC1062]
 gi|90185165|sp|Q4FNH3|LEPA_PELUB RecName: Full=Elongation factor 4; Short=EF-4; AltName:
           Full=Ribosomal back-translocase LepA
 gi|71062263|gb|AAZ21266.1| GTP-Binding protein lepA [Candidatus Pelagibacter ubique HTCC1062]
          Length = 602

 Score =  793 bits (2048), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 367/602 (60%), Positives = 483/602 (80%), Gaps = 3/602 (0%)

Query: 6   TPLSRIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQT 65
           T +  IRNF+I+AHIDHGKST+ADR I  C GLTEREM +QVLD+MDIERERGITIKAQT
Sbjct: 2   TKIDHIRNFAIIAHIDHGKSTIADRIIHSCGGLTEREMKAQVLDSMDIERERGITIKAQT 61

Query: 66  VRLNYTSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQ 125
           V+LNY + D KDY LN+IDTPGHVDF+YEVSRSL ACEGS+L+VD+TQGVEAQTLANVYQ
Sbjct: 62  VKLNYKAKDGKDYILNIIDTPGHVDFSYEVSRSLYACEGSILIVDSTQGVEAQTLANVYQ 121

Query: 126 AIDNNHEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERIVQ 185
           A+D  HEI+ VLNK DLP++D ++ KKQIEE IGI TE+A+  S KTGEGI  +LE+I+ 
Sbjct: 122 ALDTKHEIVPVLNKVDLPASDLEKTKKQIEEVIGIDTENAIPCSGKTGEGIEDILEQIIV 181

Query: 186 QLPSPTSPEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVER 245
            LP+P   +  +A LK LL+DSWY++YLGV++LVR+ING+++K   I++M T+ +Y +E+
Sbjct: 182 SLPAPEGEK--DADLKCLLVDSWYDTYLGVVILVRVINGKISKNMKIKMMSTDQEYIIEK 239

Query: 246 IGILTPKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVVF 305
           +G+ TPK  D+  L  GEIG +   IK +S T+VGDTI D + P   ALPGFKP +PVVF
Sbjct: 240 VGVFTPKATDVNELNAGEIGFITTGIKILSETKVGDTICDATKPPQEALPGFKPSKPVVF 299

Query: 306 CGLFPVDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERLE 365
           CGLFPVD+++++ L+  + KL+LNDASFS+E E+S+ALG GFRCGFLGLLHLEII ERLE
Sbjct: 300 CGLFPVDSSEYQKLKDGLGKLQLNDASFSYEAESSSALGLGFRCGFLGLLHLEIITERLE 359

Query: 366 REFSLNLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEYLG 425
           REF +NL+ T+P VVY+++M+ G + +L NP  +PE T I  + EPWI+ TIITP++YLG
Sbjct: 360 REFDINLLTTTPGVVYKVHMNKGDIIELQNPSSLPEPTLIKFIEEPWIKATIITPDQYLG 419

Query: 426 SILKLCQERRGIQIDMSHLDNRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDYR 485
           +I+K+CQ++RG+Q ++S+  NRA++ YE+PLNEV+FDF DRLKS++ GYASFDY +I +R
Sbjct: 420 AIIKVCQDKRGVQTNLSYSGNRAVLNYEIPLNEVVFDFNDRLKSMTSGYASFDYEIIGHR 479

Query: 486 DSDLVKLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGGRI 545
           + DLVKL ILVN E +DALS++VH+  ++  GR +CEKLK+LIP+  F I +QAAIGG+I
Sbjct: 480 EGDLVKLGILVNAEPVDALSMMVHKDFAQTVGREVCEKLKDLIPRHNFMIPVQAAIGGKI 539

Query: 546 IARETVKARRKDVTAKCYGGDI-TRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISILKTD 604
           IARET+K  +KDV  K +GG    RKRKLL+KQK+GK R ++FG+V+IPQ AFI +LK +
Sbjct: 540 IARETIKGFKKDVLTKIHGGGARDRKRKLLDKQKKGKARGKQFGKVEIPQEAFIGVLKIN 599

Query: 605 NE 606
            +
Sbjct: 600 KD 601


>gi|85374280|ref|YP_458342.1| GTP-binding protein LepA [Erythrobacter litoralis HTCC2594]
 gi|123409616|sp|Q2N9U6|LEPA_ERYLH RecName: Full=Elongation factor 4; Short=EF-4; AltName:
           Full=Ribosomal back-translocase LepA
 gi|84787363|gb|ABC63545.1| membrane GTPase [Erythrobacter litoralis HTCC2594]
          Length = 609

 Score =  792 bits (2046), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 386/610 (63%), Positives = 490/610 (80%), Gaps = 11/610 (1%)

Query: 6   TPLSRIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQT 65
           T LS+IRNFSI+AHIDHGKSTLADR IQ C GLT REMS QVLDNMDIE+ERGITIKAQT
Sbjct: 2   TDLSKIRNFSIIAHIDHGKSTLADRLIQVCGGLTAREMSEQVLDNMDIEKERGITIKAQT 61

Query: 66  VRLNYTSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQ 125
           VRLNYT++D + Y+LNL+DTPGHVDF YEVSRSL+ACEG+LLVVDA QGVEAQTLANVYQ
Sbjct: 62  VRLNYTASDGETYELNLMDTPGHVDFAYEVSRSLAACEGALLVVDAAQGVEAQTLANVYQ 121

Query: 126 AIDNNHEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERIVQ 185
           +I+++HEI+ V+NK DLP+A+P++V+ +IE+ IG+   +A++ SAK+G GI  +LE IV 
Sbjct: 122 SIEHDHEIVPVINKIDLPAAEPEQVRAEIEDIIGLDASEAVMTSAKSGIGIEDVLEAIVA 181

Query: 186 QLPSPTSPEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVER 245
           ++P P      +APLKA L+DSWY+ YLGV++LVR+I+G LTKG ++R M    ++ ++R
Sbjct: 182 KIPPPEGDR--DAPLKASLVDSWYDPYLGVVILVRVIDGVLTKGLNVRFMQGGTQHLIDR 239

Query: 246 IGILTPKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVVF 305
           +G  TPK +D+  + PGEIG + A IKEV   RVGDTIT   +     L G+K +QPVVF
Sbjct: 240 VGCFTPKRVDLPEIGPGEIGFITAQIKEVEQARVGDTITTVKNGAPEPLKGYKEVQPVVF 299

Query: 306 CGLFPVDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERLE 365
           CGLFPVDA  FE LR +I KLRLNDASFS+E+E+S ALGFGFR GFLGLLHLEIIQERL 
Sbjct: 300 CGLFPVDAADFEKLRESIGKLRLNDASFSYEMESSAALGFGFRAGFLGLLHLEIIQERLS 359

Query: 366 REFSLNLIGTSPSVVYELYM-----HDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITP 420
           RE+ L+LI T+PSVVY +++      D  + ++ NP D P+V +I  + EPWI+ TI TP
Sbjct: 360 REYDLDLITTAPSVVYTVHLAHTKTEDAKVIEIHNPADWPDVNRIDVIEEPWIKATIYTP 419

Query: 421 NEYLGSILKLCQERRGIQIDMSHLDN----RAMIVYELPLNEVIFDFYDRLKSVSKGYAS 476
           ++YLG+ILKLCQ+RRGIQ +++++      RA + Y+LPLNEV+FDFYDRLKS+S+GYAS
Sbjct: 420 DDYLGAILKLCQDRRGIQTNLTYVGGASTLRAQVTYDLPLNEVVFDFYDRLKSISRGYAS 479

Query: 477 FDYNVIDYRDSDLVKLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIA 536
           FDY  I  R+ DLVK+ ILVNNE +DALS++VHRSV+E+RGRG+CE+LK+LIP+ +F+I 
Sbjct: 480 FDYEQIGSREGDLVKMNILVNNEPVDALSLIVHRSVAEERGRGMCERLKDLIPRHLFKIP 539

Query: 537 IQAAIGGRIIARETVKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSA 596
           IQAAIGG+IIARET+ A RKDVTAKCYGGDI+RK+KLLEKQK+GK RMR +G V IPQ A
Sbjct: 540 IQAAIGGKIIARETIAALRKDVTAKCYGGDISRKKKLLEKQKKGKARMREYGNVSIPQEA 599

Query: 597 FISILKTDNE 606
           FI+ L+   E
Sbjct: 600 FIAALRMGEE 609


>gi|296285047|ref|ZP_06863045.1| GTP-binding protein LepA [Citromicrobium bathyomarinum JL354]
          Length = 611

 Score =  792 bits (2045), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 388/612 (63%), Positives = 486/612 (79%), Gaps = 13/612 (2%)

Query: 6   TPLSRIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQT 65
           T LS+IRNFSI+AHIDHGKSTLADR IQ   GLTEREMS Q+LDNMDIERERGITIKAQT
Sbjct: 2   TDLSKIRNFSIIAHIDHGKSTLADRLIQLTGGLTEREMSEQLLDNMDIERERGITIKAQT 61

Query: 66  VRLNYTSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQ 125
           VRL+YT+ D + YQLNL+DTPGHVDF YEVSRSL+ACEG+LLVVDA QGVEAQTLANVYQ
Sbjct: 62  VRLSYTANDGETYQLNLMDTPGHVDFAYEVSRSLAACEGALLVVDAAQGVEAQTLANVYQ 121

Query: 126 AIDNNHEIITVLNKADLPSADPDRVKKQIEETIGISTED------ALLVSAKTGEGIPLL 179
           +I+++HEI+ V+NK DLP+A+P+RV ++IEE +GI          A+L SAK+G G+  +
Sbjct: 122 SIEHDHEILPVINKIDLPAAEPERVAEEIEEIVGIQATGTWQNGGAVLTSAKSGIGVEDV 181

Query: 180 LERIVQQLPSPTSPEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNA 239
           LE IV ++P PT     +APL A L+DSWY+ YLGV++LVR+I+G L KG +++ M    
Sbjct: 182 LEAIVARIPPPTGDR--DAPLTASLVDSWYDPYLGVVILVRVIDGVLKKGLNVKFMQGGT 239

Query: 240 KYQVERIGILTPKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKP 299
           ++ ++R+G  TPK +D+  + PGEIG + A IKEV   RVGDTIT   +  T ALPG++ 
Sbjct: 240 QHLIDRVGAFTPKRVDLAEIGPGEIGFITAQIKEVEQARVGDTITTVKNGATKALPGYRE 299

Query: 300 IQPVVFCGLFPVDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEI 359
            QPVVFCGLFPVDA  F+ LR +I +LRLNDASF+FE E+S ALGFGFRCGFLGLLHLEI
Sbjct: 300 PQPVVFCGLFPVDAADFDKLRESIARLRLNDASFTFETESSAALGFGFRCGFLGLLHLEI 359

Query: 360 IQERLEREFSLNLIGTSPSVVYELYM-----HDGSMQKLSNPIDMPEVTKIAELREPWIQ 414
           IQERL RE+ L+LI T+PSVVY +++      D  + +L NP D P+  +I  + EPWI+
Sbjct: 360 IQERLSREYDLDLITTAPSVVYRIHLGKSKTEDAKVIELHNPADYPDPNRIEVIEEPWIK 419

Query: 415 VTIITPNEYLGSILKLCQERRGIQIDMSHLDNRAMIVYELPLNEVIFDFYDRLKSVSKGY 474
             I TP+EYLGSILKLCQ+RRGIQ D++++  RA + YELPLNEV+FDFYDRLKS+S+GY
Sbjct: 420 AVIYTPDEYLGSILKLCQDRRGIQTDLTYVGGRAQVTYELPLNEVVFDFYDRLKSISRGY 479

Query: 475 ASFDYNVIDYRDSDLVKLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQ 534
           ASFDY  I  R+ DLVK+ ILVNNE +DALS++VHR V+E+RGRG+CE+LK+LIP+ +F+
Sbjct: 480 ASFDYEQIGLREGDLVKMNILVNNEPVDALSLIVHRGVAEERGRGMCERLKDLIPRHLFK 539

Query: 535 IAIQAAIGGRIIARETVKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQ 594
           I IQAAIGG++IARET+ A RKDVTAKCYGGDI+RK+KLLEKQK+GK RMR +G V IPQ
Sbjct: 540 IPIQAAIGGKVIARETIAALRKDVTAKCYGGDISRKKKLLEKQKKGKARMREYGNVSIPQ 599

Query: 595 SAFISILKTDNE 606
            AFI+ L+   E
Sbjct: 600 EAFIAALRMGEE 611


>gi|91762419|ref|ZP_01264384.1| GTP-Binding protein lepA [Candidatus Pelagibacter ubique HTCC1002]
 gi|91718221|gb|EAS84871.1| GTP-Binding protein lepA [Candidatus Pelagibacter ubique HTCC1002]
          Length = 602

 Score =  792 bits (2045), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 366/602 (60%), Positives = 484/602 (80%), Gaps = 3/602 (0%)

Query: 6   TPLSRIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQT 65
           T +  IRNF+I+AHIDHGKST+ADR I  C GLTEREM +QVLD+MDIERERGITIKAQT
Sbjct: 2   TKIDHIRNFAIIAHIDHGKSTIADRIIHSCGGLTEREMKAQVLDSMDIERERGITIKAQT 61

Query: 66  VRLNYTSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQ 125
           V+LNY + D K+Y LN+IDTPGHVDF+YEVSRSL ACEGS+L+VD+TQGVEAQTLANVYQ
Sbjct: 62  VKLNYKAKDGKEYILNIIDTPGHVDFSYEVSRSLYACEGSILIVDSTQGVEAQTLANVYQ 121

Query: 126 AIDNNHEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERIVQ 185
           A+D  HEI+ VLNK DLP++D ++ KKQIEE IGI TE+A+  S KTGEGI  +LE+I+ 
Sbjct: 122 ALDTKHEIVPVLNKVDLPASDLEKTKKQIEEVIGIDTENAIPCSGKTGEGIEDILEQIIV 181

Query: 186 QLPSPTSPEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVER 245
            LP+P   +  +A LK LL+DSWY++YLGV++LVR+ING+++K   I++M T+ +Y +E+
Sbjct: 182 SLPAPEGEK--DADLKCLLVDSWYDTYLGVVILVRVINGKISKNMKIKMMSTDQEYIIEK 239

Query: 246 IGILTPKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVVF 305
           +G+ TPK  D++ L  GEIG +   IK +S T+VGDTI D + P   ALPGFKP +PVVF
Sbjct: 240 VGVFTPKATDVKELNAGEIGFITTGIKILSETKVGDTICDATKPPQEALPGFKPSKPVVF 299

Query: 306 CGLFPVDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERLE 365
           CGLFPVD+++++ L+  + KL+LNDASFS+E E+S+ALG GFRCGFLGLLHLEII ERLE
Sbjct: 300 CGLFPVDSSEYQKLKDGLGKLQLNDASFSYEAESSSALGLGFRCGFLGLLHLEIITERLE 359

Query: 366 REFSLNLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEYLG 425
           REF +NL+ T+P VVY+++M+ G + +L NP  +PE T I  + EPWI+ TIITP++YLG
Sbjct: 360 REFDINLLTTTPGVVYKVHMNKGGIIELQNPSSLPEPTLIKFIEEPWIKATIITPDQYLG 419

Query: 426 SILKLCQERRGIQIDMSHLDNRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDYR 485
           +I+K+CQ++RG+Q ++S+  NRA++ YE+PLNEV+FDF DRLKS++ GYASFDY +I +R
Sbjct: 420 AIIKVCQDKRGVQTNLSYSGNRAVLNYEIPLNEVVFDFNDRLKSMTSGYASFDYEIIGHR 479

Query: 486 DSDLVKLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGGRI 545
           + DLVKL ILVN E +DALS++VH+  ++  GR +CEKLK+LIP+  F I +QAAIGG+I
Sbjct: 480 EGDLVKLGILVNAEPVDALSMMVHKDFAQTVGREVCEKLKDLIPRHNFMIPVQAAIGGKI 539

Query: 546 IARETVKARRKDVTAKCYGGDI-TRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISILKTD 604
           IARET+K  +KDV  K +GG    RKRKLL+KQK+GK R ++FG+V+IPQ AFI +LK +
Sbjct: 540 IARETIKGFKKDVLTKIHGGGARDRKRKLLDKQKKGKARGKQFGKVEIPQEAFIGVLKIN 599

Query: 605 NE 606
            +
Sbjct: 600 KD 601


>gi|58698989|ref|ZP_00373841.1| GTP-binding protein LepA [Wolbachia endosymbiont of Drosophila
           ananassae]
 gi|225630115|ref|YP_002726906.1| GTP-binding protein LepA [Wolbachia sp. wRi]
 gi|254808759|sp|C0R5S3|LEPA_WOLWR RecName: Full=Elongation factor 4; Short=EF-4; AltName:
           Full=Ribosomal back-translocase LepA
 gi|58534494|gb|EAL58641.1| GTP-binding protein LepA [Wolbachia endosymbiont of Drosophila
           ananassae]
 gi|225592096|gb|ACN95115.1| GTP-binding protein LepA [Wolbachia sp. wRi]
          Length = 598

 Score =  788 bits (2035), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 370/597 (61%), Positives = 470/597 (78%), Gaps = 4/597 (0%)

Query: 8   LSRIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVR 67
           ++ IRNF+I+AHIDHGKSTLADR I+ C GL  REM +Q+LD+MDIERERGITIKAQTV+
Sbjct: 1   MNNIRNFAIIAHIDHGKSTLADRLIEECNGLEAREMINQILDSMDIERERGITIKAQTVK 60

Query: 68  LNYTSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQAI 127
           LNYT+ D   Y LNL+DTPGHVDF+YEVSRSL+ACEGSLLVVD++QGVEAQTLANVY+AI
Sbjct: 61  LNYTANDGNQYCLNLMDTPGHVDFSYEVSRSLAACEGSLLVVDSSQGVEAQTLANVYKAI 120

Query: 128 DNNHEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERIVQQL 187
           DNNHEII VLNK DLP+ADP++VK Q+EE IGI   +++L+SAKTG GI  +LE IV +L
Sbjct: 121 DNNHEIIVVLNKVDLPAADPEKVKLQVEEVIGIDASESVLISAKTGLGIKDVLEAIVAKL 180

Query: 188 PSPTSPEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVERIG 247
           P+P      NAPL+A+L+DSWY++YLGV++LVR+ NG L KG  I +M  NA YQ++ IG
Sbjct: 181 PAPQG--DVNAPLQAILVDSWYDTYLGVVILVRVKNGVLKKGMKIVMMSNNATYQIDNIG 238

Query: 248 ILTPKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVVFCG 307
           I TPK +    L  GE+G + AS+KEV+  +VGDTIT++  P + ALPGFK + PVVFC 
Sbjct: 239 IFTPKKVMTGELSAGEVGFITASMKEVADCKVGDTITEEKRPCSEALPGFKEVHPVVFCS 298

Query: 308 LFPVDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERLERE 367
           +FP     F+ LR A+ KL LNDASF+FE E S ALG+GFRCGFLG+LHLE+IQERLERE
Sbjct: 299 IFPHKTDDFKYLREALEKLHLNDASFTFEAETSNALGYGFRCGFLGMLHLEVIQERLERE 358

Query: 368 FSLNLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEYLGSI 427
           F L+L  T+PSV+Y +    G +  + NP DMP+ TKI  + EPWI  TI+ P++YLG I
Sbjct: 359 FDLDLTATAPSVIYRVTTRSGEILNIHNPSDMPDPTKIEIVEEPWITATIMVPDQYLGEI 418

Query: 428 LKLCQERRGIQIDMSHLDN--RAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDYR 485
           L LC+ERRG Q D+S++ N   A++ Y+LPL+EV+FDFYDRLKS+SKGYAS D+ +  Y 
Sbjct: 419 LSLCEERRGEQEDLSYIGNTTTALLRYKLPLSEVVFDFYDRLKSISKGYASLDWEISSYL 478

Query: 486 DSDLVKLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGGRI 545
            S + KL+ L+N E +DAL+ +VH+S +EKRGR IC +LK+LIP+Q ++IAIQAA+GG+I
Sbjct: 479 VSQIDKLSFLINGEPVDALACIVHKSRAEKRGREICARLKDLIPRQQYKIAIQAAVGGKI 538

Query: 546 IARETVKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISILK 602
           IARET+   RKDVTAK YGGD+TR+ KLLEKQK+GKKR+   G V+IPQ+AFI  LK
Sbjct: 539 IARETINPYRKDVTAKLYGGDVTRRMKLLEKQKKGKKRLHSIGNVNIPQNAFIQALK 595


>gi|225677397|ref|ZP_03788364.1| GTP-binding protein LepA [Wolbachia endosymbiont of Muscidifurax
           uniraptor]
 gi|225590541|gb|EEH11801.1| GTP-binding protein LepA [Wolbachia endosymbiont of Muscidifurax
           uniraptor]
          Length = 598

 Score =  788 bits (2034), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 370/597 (61%), Positives = 470/597 (78%), Gaps = 4/597 (0%)

Query: 8   LSRIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVR 67
           ++ IRNF+I+AHIDHGKSTLADR I+ C GL  REM++Q+LD+MDIERERGITIKAQTV+
Sbjct: 1   MNNIRNFAIIAHIDHGKSTLADRLIEECNGLEAREMTNQILDSMDIERERGITIKAQTVK 60

Query: 68  LNYTSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQAI 127
           LNYT+ D   Y LNL+DTPGHVDF+YEVSRSL+ACEGSLLVVD++QGVEAQTLANVY+AI
Sbjct: 61  LNYTANDGNQYCLNLMDTPGHVDFSYEVSRSLAACEGSLLVVDSSQGVEAQTLANVYKAI 120

Query: 128 DNNHEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERIVQQL 187
           DNNHEII VLNK DLP+ADP+ VK Q+EE IGI   +++L+SAKTG GI  +LE IV +L
Sbjct: 121 DNNHEIIVVLNKVDLPAADPEGVKLQVEEIIGIDASESVLISAKTGLGIKDVLEAIVAKL 180

Query: 188 PSPTSPEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVERIG 247
           P+P      NAPL+A+L+DSWY++YLGV++LVR+ NG L KG  I +M  NA YQ++ IG
Sbjct: 181 PAPQG--DVNAPLQAILVDSWYDTYLGVVILVRVKNGVLKKGMRIVMMSNNATYQIDNIG 238

Query: 248 ILTPKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVVFCG 307
           I TPK +    L  GE+G + AS+KEV+  +VGDTIT++  P + ALPGFK + PVVFC 
Sbjct: 239 IFTPKKVMTGELSAGEVGFITASMKEVADCKVGDTITEEKRPCSEALPGFKEVHPVVFCS 298

Query: 308 LFPVDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERLERE 367
           +FP     F+ LR A+ KL LNDASF+FE E S ALG+GFRCGFLG+LHLE+IQERLERE
Sbjct: 299 IFPHKTDDFKYLREALEKLHLNDASFTFEAETSNALGYGFRCGFLGMLHLEVIQERLERE 358

Query: 368 FSLNLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEYLGSI 427
           F L+L  T+PSV+Y +    G +  + NP DMP+ TKI  + EPWI  TI+ P++YLG I
Sbjct: 359 FDLDLTATAPSVIYRVTTQSGEILNIHNPSDMPDPTKIEIVEEPWITATIMVPDQYLGEI 418

Query: 428 LKLCQERRGIQIDMSHLDN--RAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDYR 485
           L LC+ERRG Q D+S++ N   A++ Y+LPL+EV+FDFYDRLKS+SKGYAS D+ +  Y 
Sbjct: 419 LSLCEERRGEQEDLSYIGNTTTALLRYKLPLSEVVFDFYDRLKSISKGYASLDWEISSYL 478

Query: 486 DSDLVKLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGGRI 545
            S + KL+ L+N E +DAL+ +VH+S +EKRGR IC +LK+LIP+Q ++IAIQAA+GG+I
Sbjct: 479 VSQIDKLSFLINGEPVDALACIVHKSRAEKRGREICARLKDLIPRQQYKIAIQAAVGGKI 538

Query: 546 IARETVKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISILK 602
           IARET+   RKDVTAK YGGD+TR+ KLLEKQK+GKKR+   G V+IPQ+AFI  LK
Sbjct: 539 IARETINPYRKDVTAKLYGGDVTRRMKLLEKQKKGKKRLHSIGNVNIPQNAFIQALK 595


>gi|42520346|ref|NP_966261.1| GTP-binding protein LepA [Wolbachia endosymbiont of Drosophila
           melanogaster]
 gi|99034720|ref|ZP_01314653.1| hypothetical protein Wendoof_01000531 [Wolbachia endosymbiont of
           Drosophila willistoni TSC#14030-0811.24]
 gi|60390052|sp|Q73HR8|LEPA_WOLPM RecName: Full=Elongation factor 4; Short=EF-4; AltName:
           Full=Ribosomal back-translocase LepA
 gi|42410084|gb|AAS14195.1| GTP-binding protein LepA [Wolbachia endosymbiont of Drosophila
           melanogaster]
          Length = 598

 Score =  787 bits (2033), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 370/597 (61%), Positives = 470/597 (78%), Gaps = 4/597 (0%)

Query: 8   LSRIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVR 67
           ++ IRNF+I+AHIDHGKSTLADR I+ C GL  REM +Q+LD+MDIERERGITIKAQTV+
Sbjct: 1   MNNIRNFAIIAHIDHGKSTLADRLIEECNGLEAREMINQILDSMDIERERGITIKAQTVK 60

Query: 68  LNYTSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQAI 127
           LNYT+ D   Y LNL+DTPGHVDF+YEVSRSL+ACEGSLLVVD++QGVEAQTLANVY+AI
Sbjct: 61  LNYTANDGNQYCLNLMDTPGHVDFSYEVSRSLAACEGSLLVVDSSQGVEAQTLANVYKAI 120

Query: 128 DNNHEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERIVQQL 187
           DNNHEII VLNK DLP+ADP++VK Q+EE IGI   +++L+SAKTG GI  +LE IV +L
Sbjct: 121 DNNHEIIVVLNKVDLPAADPEKVKLQVEEVIGIDASESVLISAKTGLGIKDVLEAIVAKL 180

Query: 188 PSPTSPEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVERIG 247
           P+P      NAPL+A+L+DSWY++YLGV++LVR+ NG L KG  I +M  NA YQ++ IG
Sbjct: 181 PAPQG--DVNAPLQAILVDSWYDTYLGVVILVRVKNGVLKKGMRIVMMSNNATYQIDNIG 238

Query: 248 ILTPKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVVFCG 307
           I TPK +    L  GE+G + AS+KEV+  +VGDTIT++  P + ALPGFK + PVVFC 
Sbjct: 239 IFTPKKVMTGELSAGEVGFITASMKEVADCKVGDTITEEKRPCSEALPGFKEVHPVVFCS 298

Query: 308 LFPVDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERLERE 367
           +FP     F+ LR A+ KL LNDASF+FE E S ALG+GFRCGFLG+LHLE+IQERLERE
Sbjct: 299 IFPHKTDDFKYLREALEKLHLNDASFTFEAETSNALGYGFRCGFLGMLHLEVIQERLERE 358

Query: 368 FSLNLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEYLGSI 427
           F L+L  T+PSV+Y +    G +  + NP DMP+ TKI  + EPWI  TI+ P++YLG I
Sbjct: 359 FDLDLTATAPSVIYRVTTRSGEVLNIHNPSDMPDPTKIEIVEEPWITATIMVPDQYLGDI 418

Query: 428 LKLCQERRGIQIDMSHLDN--RAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDYR 485
           L LC+ERRG Q D+S++ N   A++ Y+LPL+EV+FDFYDRLKS+SKGYAS D+ +  Y 
Sbjct: 419 LSLCEERRGEQEDLSYIGNTTTALLRYKLPLSEVVFDFYDRLKSISKGYASLDWEISSYL 478

Query: 486 DSDLVKLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGGRI 545
            S + KL+ L+N E +DAL+ +VH+S +EKRGR IC +LK+LIP+Q ++IAIQAA+GG+I
Sbjct: 479 VSQIDKLSFLINGEPVDALACIVHKSRAEKRGREICARLKDLIPRQQYKIAIQAAVGGKI 538

Query: 546 IARETVKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISILK 602
           IARET+   RKDVTAK YGGD+TR+ KLLEKQK+GKKR+   G V+IPQ+AFI  LK
Sbjct: 539 IARETINPYRKDVTAKLYGGDVTRRMKLLEKQKKGKKRLHSIGNVNIPQNAFIQALK 595


>gi|58584924|ref|YP_198497.1| GTP-binding protein LepA [Wolbachia endosymbiont strain TRS of
           Brugia malayi]
 gi|75497674|sp|Q5GRW9|LEPA_WOLTR RecName: Full=Elongation factor 4; Short=EF-4; AltName:
           Full=Ribosomal back-translocase LepA
 gi|58419240|gb|AAW71255.1| Membrane GTPase LepA [Wolbachia endosymbiont strain TRS of Brugia
           malayi]
          Length = 598

 Score =  780 bits (2015), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 366/597 (61%), Positives = 466/597 (78%), Gaps = 4/597 (0%)

Query: 8   LSRIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVR 67
           +  +RNF+I+AHIDHGKSTLADR I+ C GL  REM++QVLD+MDIERERGITIKAQTVR
Sbjct: 1   MDNVRNFAIIAHIDHGKSTLADRLIEECNGLEAREMTNQVLDSMDIERERGITIKAQTVR 60

Query: 68  LNYTSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQAI 127
           LNYT+ D   Y LNL+DTPGHVDF+YEVSRSL+ACEGSLLV+D++QGVEAQTLANVY+AI
Sbjct: 61  LNYTANDGNRYCLNLMDTPGHVDFSYEVSRSLAACEGSLLVIDSSQGVEAQTLANVYKAI 120

Query: 128 DNNHEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERIVQQL 187
           DNNHEII VLNK DLP++DP+RVK Q+EE IGI + +++L+SAKTG GI  +LE I+ +L
Sbjct: 121 DNNHEIIVVLNKVDLPASDPERVKLQVEEIIGIGSSESILISAKTGLGIRDVLEAIITKL 180

Query: 188 PSPTSPEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVERIG 247
           P+P      NAPL+A+L+DSWY+ YLGV++LVR+ NG L KG  I +M  NA YQV+ IG
Sbjct: 181 PAPQG--NINAPLQAILVDSWYDPYLGVVILVRVKNGVLKKGMKIVMMSNNAVYQVDNIG 238

Query: 248 ILTPKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVVFCG 307
           I TPK +    L  GE+G + AS+++++  +VGDTIT++  P   ALPGFK I PVVFC 
Sbjct: 239 IFTPKKVMTSELSAGEVGFITASMRKMADCKVGDTITEEKKPCGEALPGFKEIHPVVFCS 298

Query: 308 LFPVDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERLERE 367
           +FP     F+ LR A+ KL LND SF+FE E S ALG+GFRCGFLG+LHLE+IQERLERE
Sbjct: 299 IFPNKTDGFKYLREALEKLHLNDTSFTFEAETSNALGYGFRCGFLGMLHLEVIQERLERE 358

Query: 368 FSLNLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEYLGSI 427
           F L+L  T+PSV+YE+    G    + NP DMP+  KI  + EPWI  TI+ P++YLG I
Sbjct: 359 FDLDLTATAPSVIYEVTTQSGETLNIHNPNDMPDSVKIKIVEEPWITATIMVPDQYLGEI 418

Query: 428 LKLCQERRGIQIDMSHLDN--RAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDYR 485
           L LC ERRG Q D+S++ N   A++ Y+LPL+EV+ DFYDRLKS+SKGYAS D+ + +Y+
Sbjct: 419 LSLCDERRGKQEDLSYVGNTMTALLKYKLPLSEVVLDFYDRLKSISKGYASLDWEISNYQ 478

Query: 486 DSDLVKLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGGRI 545
           +S + KL+ LVN E +DAL+ +VH+S SEKRGR IC +L++LIP+Q ++IAIQA +GG+I
Sbjct: 479 ESQIDKLSFLVNGEPVDALACIVHKSRSEKRGREICARLRDLIPRQQYKIAIQATVGGKI 538

Query: 546 IARETVKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISILK 602
           +ARET+   RKDVTAK YGGD+TRK KLLEKQK+GKKR+   G VDIP +AFI  LK
Sbjct: 539 VARETINPYRKDVTAKLYGGDVTRKMKLLEKQKKGKKRLYSVGNVDIPHNAFIQALK 595


>gi|254456367|ref|ZP_05069796.1| GTP-binding protein LepA [Candidatus Pelagibacter sp. HTCC7211]
 gi|207083369|gb|EDZ60795.1| GTP-binding protein LepA [Candidatus Pelagibacter sp. HTCC7211]
          Length = 602

 Score =  779 bits (2012), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 370/600 (61%), Positives = 479/600 (79%), Gaps = 3/600 (0%)

Query: 8   LSRIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVR 67
           +  IRNF+I+AHIDHGKST+ADR I  C GLTEREM +QVLD+MDIERERGITIKAQTV+
Sbjct: 4   IDNIRNFAIIAHIDHGKSTIADRIIHSCGGLTEREMKAQVLDSMDIERERGITIKAQTVK 63

Query: 68  LNYTSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQAI 127
           LNY + D K+Y LN+IDTPGHVDF+YEVSRSL ACEGS+L+VD+TQGVEAQTLANVYQA+
Sbjct: 64  LNYKAKDGKNYILNIIDTPGHVDFSYEVSRSLYACEGSILIVDSTQGVEAQTLANVYQAL 123

Query: 128 DNNHEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERIVQQL 187
           D NHEI+ VLNK DLP++D ++ K QIEE IGI TE A+  S KTGEGI  +LE+I+  L
Sbjct: 124 DINHEIVPVLNKVDLPASDLEKTKTQIEEVIGIDTEGAVPCSGKTGEGINDILEQIITVL 183

Query: 188 PSPTSPEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVERIG 247
           P P      +  LK LL+DSWY++YLGV++LVR+I+G+++K   I++M TN +Y VE++G
Sbjct: 184 PGPKGE--VSGDLKCLLVDSWYDTYLGVVILVRVIDGKISKNMKIKMMSTNQEYIVEKVG 241

Query: 248 ILTPKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVVFCG 307
           + TPK  DI  L  GEIG +   IK +S T+VGDTI D + P    LPGFKP +PVVFCG
Sbjct: 242 VFTPKATDINQLNAGEIGFITTGIKVLSETKVGDTICDAAKPLKEVLPGFKPSKPVVFCG 301

Query: 308 LFPVDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERLERE 367
           LFPVD+++++ L+  + KL+LNDASFSFE E+S+ALG GFRCGFLGLLHLEI+ ERLERE
Sbjct: 302 LFPVDSSEYQKLKDGLAKLQLNDASFSFEPESSSALGLGFRCGFLGLLHLEIVTERLERE 361

Query: 368 FSLNLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEYLGSI 427
           F +NL+ T+P VVY++YM++GS   L NP  +P+ T I  + EPWI+ TIITP++YLGSI
Sbjct: 362 FDVNLLTTTPGVVYKVYMNNGSTIDLHNPSSLPDSTLIKTIEEPWIKATIITPDQYLGSI 421

Query: 428 LKLCQERRGIQIDMSHLDNRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDYRDS 487
           +K+CQ++RG+Q ++S+  NRA++ YELPLNEV+FDF DRLKS++ GYASFDY +I++R+ 
Sbjct: 422 IKMCQDKRGVQTNLSYSGNRAVVNYELPLNEVVFDFNDRLKSMTSGYASFDYEIIEHREG 481

Query: 488 DLVKLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGGRIIA 547
           DLVKL ILVN E +DAL++++H+  +++ GR +CEKLK+LIP+  F I +QAAIGG+IIA
Sbjct: 482 DLVKLGILVNAEPVDALAMMIHKDFAQRTGREVCEKLKDLIPRHNFMIPVQAAIGGKIIA 541

Query: 548 RETVKARRKDVTAKCYGGDIT-RKRKLLEKQKEGKKRMRRFGRVDIPQSAFISILKTDNE 606
           RET+K  +KDV  K +GG  T RKRKLLEKQK+GK R ++FGRV+IPQ AFI +LK   E
Sbjct: 542 RETIKGFKKDVLTKIHGGGATDRKRKLLEKQKKGKARSKQFGRVEIPQEAFIGVLKISKE 601


>gi|329115280|ref|ZP_08244035.1| GTP-binding protein LepA [Acetobacter pomorum DM001]
 gi|326695723|gb|EGE47409.1| GTP-binding protein LepA [Acetobacter pomorum DM001]
          Length = 561

 Score =  778 bits (2009), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 362/563 (64%), Positives = 456/563 (80%), Gaps = 2/563 (0%)

Query: 43  MSSQVLDNMDIERERGITIKAQTVRLNYTSTDAKDYQLNLIDTPGHVDFTYEVSRSLSAC 102
           M++QVLDNMD+ERERGITIKAQTVRL Y + D   Y LNL+DTPGHVDF YEVSRSL+AC
Sbjct: 1   MTNQVLDNMDLERERGITIKAQTVRLTYPAKDGNTYVLNLMDTPGHVDFAYEVSRSLAAC 60

Query: 103 EGSLLVVDATQGVEAQTLANVYQAIDNNHEIITVLNKADLPSADPDRVKKQIEETIGIST 162
           EGSLLVVDA+QGVEAQTLANVYQAID NHEI+ VLNK DLP+A+P+RVK QIEE IGI  
Sbjct: 61  EGSLLVVDASQGVEAQTLANVYQAIDANHEIVPVLNKVDLPAAEPERVKAQIEEVIGIPA 120

Query: 163 EDALLVSAKTGEGIPLLLERIVQQLPSPTSPEGANAPLKALLIDSWYNSYLGVMVLVRII 222
           +DA+ +SAKTG  I  +LE +V +LP PT    A  PL+A+LIDSWY+ YLGV+VLVRI 
Sbjct: 121 DDAVEISAKTGLNIEGVLEAVVTRLPPPTG--DAEKPLQAMLIDSWYDPYLGVIVLVRIK 178

Query: 223 NGQLTKGQSIRLMGTNAKYQVERIGILTPKMIDIEALYPGEIGVMIASIKEVSHTRVGDT 282
            G+L +G  +R+M + A +QV+++G+  P+M  +E+L PGE+G + A+IK V+   VGDT
Sbjct: 179 EGRLKRGMKVRMMSSGAVHQVDQVGVFAPRMTSVESLGPGEMGFINAAIKTVADCNVGDT 238

Query: 283 ITDDSSPTTSALPGFKPIQPVVFCGLFPVDATQFENLRTAINKLRLNDASFSFELENSTA 342
           ITDD  P    LPGFKP  PVV+CGL+PV A  FE LR ++ KLRLNDASF +E E S A
Sbjct: 239 ITDDRRPAEKPLPGFKPSIPVVWCGLYPVVADDFEKLRDSLAKLRLNDASFHYEAETSAA 298

Query: 343 LGFGFRCGFLGLLHLEIIQERLEREFSLNLIGTSPSVVYELYMHDGSMQKLSNPIDMPEV 402
           LGFGFRCGFLGLLHLEIIQERL REF L+LI T+PSVVY++   +G  ++L NP DMP+ 
Sbjct: 299 LGFGFRCGFLGLLHLEIIQERLSREFDLDLIATAPSVVYKITRTNGEREELHNPADMPDS 358

Query: 403 TKIAELREPWIQVTIITPNEYLGSILKLCQERRGIQIDMSHLDNRAMIVYELPLNEVIFD 462
           + I  + EPWI+ TI+ P+EYLG++L LC ERRG+Q+D++++ +RAM VY LPLNEV+FD
Sbjct: 359 SLIETIEEPWIKATIMVPDEYLGAVLTLCTERRGVQVDLTYVGSRAMAVYRLPLNEVVFD 418

Query: 463 FYDRLKSVSKGYASFDYNVIDYRDSDLVKLTILVNNETIDALSILVHRSVSEKRGRGICE 522
           FYDRLKS+++GYASFDY +  Y +SDLV+++ILVN E +DALS + HR+ +E RGR IC 
Sbjct: 419 FYDRLKSLTRGYASFDYQMDGYEESDLVRISILVNQEPVDALSFIAHRTAAESRGRSICA 478

Query: 523 KLKNLIPQQMFQIAIQAAIGGRIIARETVKARRKDVTAKCYGGDITRKRKLLEKQKEGKK 582
           +LK+LIP+Q+F+IAIQAAIG ++IARET+ A  KDVTAKCYGGDI+RKRKLLEKQKEGKK
Sbjct: 479 RLKDLIPRQLFKIAIQAAIGSKVIARETIGALSKDVTAKCYGGDISRKRKLLEKQKEGKK 538

Query: 583 RMRRFGRVDIPQSAFISILKTDN 605
           RMR+FG+V+IPQSAF++ LK ++
Sbjct: 539 RMRQFGKVEIPQSAFLAALKMEH 561


>gi|58617086|ref|YP_196285.1| GTP-binding protein LepA [Ehrlichia ruminantium str. Gardel]
 gi|75432821|sp|Q5FHQ1|LEPA_EHRRG RecName: Full=Elongation factor 4; Short=EF-4; AltName:
           Full=Ribosomal back-translocase LepA
 gi|58416698|emb|CAI27811.1| GTP-binding protein LepA [Ehrlichia ruminantium str. Gardel]
          Length = 598

 Score =  772 bits (1993), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 359/592 (60%), Positives = 474/592 (80%), Gaps = 2/592 (0%)

Query: 11  IRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVRLNY 70
           IRNF+I+AHIDHGKSTLADR I+ C GL +REM  QVLD+MDIERERGITIKAQTVRL Y
Sbjct: 6   IRNFAIIAHIDHGKSTLADRLIEECNGLEKREMKDQVLDSMDIERERGITIKAQTVRLMY 65

Query: 71  TSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQAIDNN 130
           T+ D K Y LNL+DTPGHVDF+YEVSRSL+ACEGSLLVVD+TQGVEAQTLANVY+AID+N
Sbjct: 66  TAKDGKVYYLNLMDTPGHVDFSYEVSRSLAACEGSLLVVDSTQGVEAQTLANVYKAIDSN 125

Query: 131 HEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERIVQQLPSP 190
           HEII VLNK DL S+DPD+VK QIEE IGI   ++LLVSAK+G GI  +LE IV +LP+P
Sbjct: 126 HEIIPVLNKIDLASSDPDKVKSQIEEIIGIDASESLLVSAKSGIGIKDVLEAIVSRLPAP 185

Query: 191 TSPEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVERIGILT 250
           +     + PLKA+L+D+WY++YLG+++L+R+++G + KG  I +M +NA YQV+ IGI T
Sbjct: 186 SG--NFDNPLKAILVDTWYDTYLGIVILLRVVDGVIKKGMKIVMMSSNAAYQVDNIGIFT 243

Query: 251 PKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVVFCGLFP 310
           P    ++ L  GEIG + ASIKE+S  ++GDTIT++     + +PGF+ I PVVFC +FP
Sbjct: 244 PHKKIVDQLSVGEIGFITASIKELSDCKIGDTITEEQRRCDNPMPGFRTIHPVVFCSIFP 303

Query: 311 VDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERLEREFSL 370
            +A  FE LR A+ KL+LNDASF+F++E S+ALG+GFRCGFLG+LHLE+IQERLEREF+L
Sbjct: 304 NEAGDFERLREALKKLQLNDASFTFDIEVSSALGYGFRCGFLGMLHLEVIQERLEREFNL 363

Query: 371 NLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEYLGSILKL 430
           +L  T+P VVY++   +G ++++ NP D  +V  IA ++EPWI  TI+ P++YLG ++ L
Sbjct: 364 DLTATAPGVVYQIISKNGILREVHNPHDFGDVQDIASIKEPWICATIMVPDQYLGVVMSL 423

Query: 431 CQERRGIQIDMSHLDNRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDYRDSDLV 490
           C  +RG ++D+S+  N A++ Y LPL+EV+FDFYDR+KS+SKGYAS D+ +  Y DS++ 
Sbjct: 424 CNNKRGEKVDLSYSGNTALLKYRLPLSEVVFDFYDRIKSISKGYASLDWEMDGYMDSEIA 483

Query: 491 KLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGGRIIARET 550
           KLTIL+N+E +DAL+ +VH+S  E+RGR IC +LK+LIP+Q ++IAIQAA+G +IIARET
Sbjct: 484 KLTILINSEPVDALACIVHKSKVEQRGREICLRLKDLIPRQQYKIAIQAAVGSKIIARET 543

Query: 551 VKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISILK 602
           +   RKDVTAK YGGD+TR+ KLLEKQK+GKKR+R  G V++P +AFI  LK
Sbjct: 544 ISPYRKDVTAKLYGGDVTRRMKLLEKQKKGKKRLRAIGNVNVPHNAFIQALK 595


>gi|56416733|ref|YP_153807.1| GTP-binding protein LepA [Anaplasma marginale str. St. Maries]
 gi|222475097|ref|YP_002563513.1| GTP binding protein (lepA) [Anaplasma marginale str. Florida]
 gi|81599157|sp|Q5PAX8|LEPA_ANAMM RecName: Full=Elongation factor 4; Short=EF-4; AltName:
           Full=Ribosomal back-translocase LepA
 gi|254808372|sp|B9KIE5|LEPA_ANAMF RecName: Full=Elongation factor 4; Short=EF-4; AltName:
           Full=Ribosomal back-translocase LepA
 gi|56387965|gb|AAV86552.1| GTP-binding protein [Anaplasma marginale str. St. Maries]
 gi|222419234|gb|ACM49257.1| GTP binding protein (lepA) [Anaplasma marginale str. Florida]
          Length = 599

 Score =  772 bits (1993), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 358/594 (60%), Positives = 469/594 (78%), Gaps = 2/594 (0%)

Query: 9   SRIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVRL 68
           S IRNF+I+AHIDHGKSTLADR I+ C  L++R+M  QVLD+MDIERERGITIKAQTVRL
Sbjct: 5   STIRNFAIIAHIDHGKSTLADRLIEACNALSDRDMKDQVLDSMDIERERGITIKAQTVRL 64

Query: 69  NYTSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQAID 128
            Y + D   Y LNL+DTPGHVDF+YEVSRSL+ACEGSLLV+D++QGVEAQTLANVY+AI+
Sbjct: 65  TYAAKDGVVYHLNLVDTPGHVDFSYEVSRSLAACEGSLLVIDSSQGVEAQTLANVYKAIE 124

Query: 129 NNHEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERIVQQLP 188
           N+HEI+TVLNKADL S+DP+RVK Q+EE IG+    ALL+SAKTG GI  +LE IV +LP
Sbjct: 125 NDHEIVTVLNKADLASSDPERVKSQVEEIIGLDASGALLISAKTGMGISDVLEAIVHRLP 184

Query: 189 SPTSPEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVERIGI 248
           +P     ANAPLKA+L+DSWY+ YLG+++L+R+ +G L KG  + ++ T A YQV+ +G+
Sbjct: 185 APVG--DANAPLKAILVDSWYDPYLGIVILLRVKDGVLKKGMKVAMLSTGAVYQVDNVGV 242

Query: 249 LTPKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVVFCGL 308
            TP    +++L  GEIG + A IKE++  +VGDT+T+DS    +  PGF+   PVVFC L
Sbjct: 243 FTPNKQMVDSLSVGEIGFITAGIKEIADCKVGDTLTEDSRRCDNPFPGFRATCPVVFCSL 302

Query: 309 FPVDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERLEREF 368
           FPVDA+ FE+LR A+ KL+LND+SF+F++E+STALG+GFRCGFLG+LHLE++QERLEREF
Sbjct: 303 FPVDASSFEHLREALGKLQLNDSSFTFDMESSTALGYGFRCGFLGMLHLEVVQERLEREF 362

Query: 369 SLNLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEYLGSIL 428
            L+L  T+PSVVY +       +++ NP D+PE  +I  + EPWI  TI+ P++YLGSIL
Sbjct: 363 DLDLTATAPSVVYRVTDKHRVTKEVHNPNDLPESHEILGVEEPWIAATIMVPDQYLGSIL 422

Query: 429 KLCQERRGIQIDMSHLDNRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDYRDSD 488
            LC  +RG ++D+S+  + A++ Y LPL EV+FDFYD LKSVSKGYAS D+ V  Y  ++
Sbjct: 423 ALCNSKRGEKVDLSYTGSMALLKYRLPLAEVVFDFYDSLKSVSKGYASLDWYVDGYVPTE 482

Query: 489 LVKLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGGRIIAR 548
           + KLTIL+N+E +DALS ++H+S  E RGR ICE+LK+LIP+Q +++AIQAA+G +I+AR
Sbjct: 483 ISKLTILINSEPVDALSCIIHKSKVESRGREICERLKDLIPRQQYKVAIQAAVGAKIVAR 542

Query: 549 ETVKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISILK 602
           ET+   RKDVTAK YG D+TRK KLLEKQK+GKKR+R  G V++PQSAFI  LK
Sbjct: 543 ETISPYRKDVTAKVYGRDVTRKMKLLEKQKKGKKRLRSIGNVNVPQSAFIQALK 596


>gi|255004200|ref|ZP_05279001.1| GTP-binding protein LepA [Anaplasma marginale str. Virginia]
          Length = 598

 Score =  772 bits (1993), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 358/594 (60%), Positives = 469/594 (78%), Gaps = 2/594 (0%)

Query: 9   SRIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVRL 68
           S IRNF+I+AHIDHGKSTLADR I+ C  L++R+M  QVLD+MDIERERGITIKAQTVRL
Sbjct: 4   STIRNFAIIAHIDHGKSTLADRLIEACNALSDRDMKDQVLDSMDIERERGITIKAQTVRL 63

Query: 69  NYTSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQAID 128
            Y + D   Y LNL+DTPGHVDF+YEVSRSL+ACEGSLLV+D++QGVEAQTLANVY+AI+
Sbjct: 64  TYAAKDGVVYHLNLVDTPGHVDFSYEVSRSLAACEGSLLVIDSSQGVEAQTLANVYKAIE 123

Query: 129 NNHEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERIVQQLP 188
           N+HEI+TVLNKADL S+DP+RVK Q+EE IG+    ALL+SAKTG GI  +LE IV +LP
Sbjct: 124 NDHEIVTVLNKADLASSDPERVKSQVEEIIGLDASGALLISAKTGMGISDVLEAIVHRLP 183

Query: 189 SPTSPEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVERIGI 248
           +P     ANAPLKA+L+DSWY+ YLG+++L+R+ +G L KG  + ++ T A YQV+ +G+
Sbjct: 184 APVG--DANAPLKAILVDSWYDPYLGIVILLRVKDGVLKKGMKVAMLSTGAVYQVDNVGV 241

Query: 249 LTPKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVVFCGL 308
            TP    +++L  GEIG + A IKE++  +VGDT+T+DS    +  PGF+   PVVFC L
Sbjct: 242 FTPNKQMVDSLSVGEIGFITAGIKEIADCKVGDTLTEDSRRCDNPFPGFRATCPVVFCSL 301

Query: 309 FPVDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERLEREF 368
           FPVDA+ FE+LR A+ KL+LND+SF+F++E+STALG+GFRCGFLG+LHLE++QERLEREF
Sbjct: 302 FPVDASSFEHLREALGKLQLNDSSFTFDMESSTALGYGFRCGFLGMLHLEVVQERLEREF 361

Query: 369 SLNLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEYLGSIL 428
            L+L  T+PSVVY +       +++ NP D+PE  +I  + EPWI  TI+ P++YLGSIL
Sbjct: 362 DLDLTATAPSVVYRVTDKHRVTKEVHNPNDLPESHEILGVEEPWIAATIMVPDQYLGSIL 421

Query: 429 KLCQERRGIQIDMSHLDNRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDYRDSD 488
            LC  +RG ++D+S+  + A++ Y LPL EV+FDFYD LKSVSKGYAS D+ V  Y  ++
Sbjct: 422 ALCNSKRGEKVDLSYTGSMALLKYRLPLAEVVFDFYDSLKSVSKGYASLDWYVDGYVPTE 481

Query: 489 LVKLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGGRIIAR 548
           + KLTIL+N+E +DALS ++H+S  E RGR ICE+LK+LIP+Q +++AIQAA+G +I+AR
Sbjct: 482 ISKLTILINSEPVDALSCIIHKSKVESRGREICERLKDLIPRQQYKVAIQAAVGAKIVAR 541

Query: 549 ETVKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISILK 602
           ET+   RKDVTAK YG D+TRK KLLEKQK+GKKR+R  G V++PQSAFI  LK
Sbjct: 542 ETISPYRKDVTAKVYGRDVTRKMKLLEKQKKGKKRLRSIGNVNVPQSAFIQALK 595


>gi|88607108|ref|YP_505344.1| GTP-binding protein LepA [Anaplasma phagocytophilum HZ]
 gi|119371328|sp|Q2GJV7|LEPA_ANAPZ RecName: Full=Elongation factor 4; Short=EF-4; AltName:
           Full=Ribosomal back-translocase LepA
 gi|88598171|gb|ABD43641.1| GTP-binding protein LepA [Anaplasma phagocytophilum HZ]
          Length = 598

 Score =  772 bits (1993), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 362/597 (60%), Positives = 468/597 (78%), Gaps = 2/597 (0%)

Query: 9   SRIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVRL 68
           S IRNF+I+AHIDHGKSTLADR I+ C  L ER+M  QVLD+MDIERERGITIKAQTVRL
Sbjct: 4   SSIRNFAIIAHIDHGKSTLADRLIESCDALAERDMKEQVLDSMDIERERGITIKAQTVRL 63

Query: 69  NYTSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQAID 128
            YTS   + Y LNL+DTPGHVDF+YEVSRSL+ACEGSLLV+D++QGVEAQTLANVY+AI+
Sbjct: 64  KYTSKAGEVYYLNLVDTPGHVDFSYEVSRSLAACEGSLLVIDSSQGVEAQTLANVYKAIE 123

Query: 129 NNHEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERIVQQLP 188
           NNHEIITVLNK DL SADP++VK Q+E  IG+   DALLVSAKTG GI  +LE I+++LP
Sbjct: 124 NNHEIITVLNKVDLVSADPEKVKSQVETIIGLDASDALLVSAKTGIGINDVLEAIIERLP 183

Query: 189 SPTSPEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVERIGI 248
           +P   E   APLKA+L+DSWY+ YLG+++LVRI +G L KG  I +M T A Y V+ +G+
Sbjct: 184 APEGDE--EAPLKAVLVDSWYDPYLGIVILVRIKDGVLKKGMKICMMSTGAVYTVDNVGV 241

Query: 249 LTPKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVVFCGL 308
            TP    ++AL  GEIG + A IKE+   +VGDT+T+D+     ALPGF+   PVVFC L
Sbjct: 242 FTPHKKMVDALSVGEIGFITAGIKELLACKVGDTVTEDARRCAEALPGFRATCPVVFCSL 301

Query: 309 FPVDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERLEREF 368
           FPVDA  FE+LR A+ KL+LNDASF+F++E+STALG+GFRCGFLG+LHLE++QERLEREF
Sbjct: 302 FPVDAGSFEHLREALGKLQLNDASFTFDIESSTALGYGFRCGFLGMLHLEVVQERLEREF 361

Query: 369 SLNLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEYLGSIL 428
            L+L  T+PSVVY++       + + NP D+PE  +I ++ EPWI  TI+ P++YLGS+L
Sbjct: 362 DLDLTATAPSVVYKVTDKRNVTRDIHNPNDLPEAHEILKVEEPWIMATIMVPDQYLGSML 421

Query: 429 KLCQERRGIQIDMSHLDNRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDYRDSD 488
            LC  +RG ++D+S+  N A++ Y LPL E++FDFYDRLKS+SKGYASFD+ +  Y  ++
Sbjct: 422 ALCNGKRGERVDLSYTGNMALLQYRLPLAEIVFDFYDRLKSISKGYASFDWQMDGYMPAE 481

Query: 489 LVKLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGGRIIAR 548
           + KLT L+N+E +DAL+ ++H+S  E RGR ICE+LK+LIP+Q ++IAIQAA+G +I+AR
Sbjct: 482 VSKLTFLINSELVDALACIIHKSKIESRGREICERLKDLIPRQQYKIAIQAAVGSKIVAR 541

Query: 549 ETVKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISILKTDN 605
           ET+   RKDVTAK YG D+TRK KLLEKQK+GKKR+R  G + +PQSAFI  L+  +
Sbjct: 542 ETISPYRKDVTAKVYGRDVTRKMKLLEKQKKGKKRLRSIGNITVPQSAFIQALQVKD 598


>gi|269958851|ref|YP_003328639.1| GTP-binding protein LepA [Anaplasma centrale str. Israel]
 gi|269848681|gb|ACZ49325.1| GTP-binding protein LepA [Anaplasma centrale str. Israel]
          Length = 599

 Score =  771 bits (1990), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 357/594 (60%), Positives = 469/594 (78%), Gaps = 2/594 (0%)

Query: 9   SRIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVRL 68
           S IRNF+I+AHIDHGKSTLADR I+ C  L++R+M  QVLD+MDIERERGITIKAQTVRL
Sbjct: 5   STIRNFAIIAHIDHGKSTLADRLIEACNALSDRDMKDQVLDSMDIERERGITIKAQTVRL 64

Query: 69  NYTSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQAID 128
            Y + D   Y LNL+DTPGHVDF+YEVSRSL+ACEGSLLV+D++QGVEAQTLANVY+AI+
Sbjct: 65  TYAAKDGVVYHLNLVDTPGHVDFSYEVSRSLAACEGSLLVIDSSQGVEAQTLANVYKAIE 124

Query: 129 NNHEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERIVQQLP 188
           N+HEI+TVLNKADL S+DP+RVK Q+EE IG+    ALL+SAKTG GI  +LE IV +LP
Sbjct: 125 NDHEIVTVLNKADLASSDPERVKSQVEEIIGLDASGALLISAKTGMGISDVLEAIVHRLP 184

Query: 189 SPTSPEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVERIGI 248
           +P     ANAPLKA+L+DSWY+ YLG+++L+R+ +G L +G  + ++ T A YQV+ +G+
Sbjct: 185 APVG--DANAPLKAILVDSWYDPYLGIVILLRVKDGVLKRGMKVAMLSTGAVYQVDNVGV 242

Query: 249 LTPKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVVFCGL 308
            TP    +++L  GEIG + A IKE++  +VGDT+T+DS    +  PGF+   PVVFC L
Sbjct: 243 FTPNKQMVDSLSVGEIGFITAGIKEIADCKVGDTLTEDSRRCDNPFPGFRATCPVVFCSL 302

Query: 309 FPVDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERLEREF 368
           FPVDA+ FE+LR A+ KL+LND+SF+F++E+STALG+GFRCGFLG+LHLE++QERLEREF
Sbjct: 303 FPVDASSFEHLREALGKLQLNDSSFTFDMESSTALGYGFRCGFLGMLHLEVVQERLEREF 362

Query: 369 SLNLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEYLGSIL 428
            L+L  T+PSVVY +       +++ NP D+PE  +I  + EPWI  TI+ P++YLGSIL
Sbjct: 363 DLDLTATAPSVVYRVTDKHRVTKEVHNPNDLPESHEILGVEEPWIAATIMVPDQYLGSIL 422

Query: 429 KLCQERRGIQIDMSHLDNRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDYRDSD 488
            LC  +RG ++D+S+  + A++ Y LPL EV+FDFYD LKSVSKGYAS D+ V  Y  ++
Sbjct: 423 ALCNSKRGEKVDLSYTGSMALLKYRLPLAEVVFDFYDSLKSVSKGYASLDWYVDGYVPTE 482

Query: 489 LVKLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGGRIIAR 548
           + KLTIL+N+E +DALS ++H+S  E RGR ICE+LK+LIP+Q +++AIQAA+G +I+AR
Sbjct: 483 ISKLTILINSEPVDALSCIIHKSKVESRGREICERLKDLIPRQQYKVAIQAAVGAKIVAR 542

Query: 549 ETVKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISILK 602
           ET+   RKDVTAK YG D+TRK KLLEKQK+GKKR+R  G V++PQSAFI  LK
Sbjct: 543 ETISPYRKDVTAKVYGRDVTRKMKLLEKQKKGKKRLRSIGNVNVPQSAFIQALK 596


>gi|57239084|ref|YP_180220.1| GTP-binding protein LepA [Ehrlichia ruminantium str. Welgevonden]
 gi|58579027|ref|YP_197239.1| GTP-binding protein LepA [Ehrlichia ruminantium str. Welgevonden]
 gi|81557319|sp|Q5HBH4|LEPA_EHRRW RecName: Full=Elongation factor 4; Short=EF-4; AltName:
           Full=Ribosomal back-translocase LepA
 gi|57161163|emb|CAH58076.1| GTP-binding protein LepA [Ehrlichia ruminantium str. Welgevonden]
 gi|58417653|emb|CAI26857.1| GTP-binding protein LepA [Ehrlichia ruminantium str. Welgevonden]
          Length = 598

 Score =  771 bits (1990), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 359/592 (60%), Positives = 473/592 (79%), Gaps = 2/592 (0%)

Query: 11  IRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVRLNY 70
           IRNF+I+AHIDHGKSTLADR I+ C GL +REM  QVLD+MDIERERGITIKAQTVRL Y
Sbjct: 6   IRNFAIIAHIDHGKSTLADRLIEECNGLEKREMKDQVLDSMDIERERGITIKAQTVRLMY 65

Query: 71  TSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQAIDNN 130
           T+ D K Y LNL+DTPGHVDF+YEVSRSL+ACEGSLLVVD+TQGVEAQTLANVY+AID+N
Sbjct: 66  TAKDGKVYYLNLMDTPGHVDFSYEVSRSLAACEGSLLVVDSTQGVEAQTLANVYKAIDSN 125

Query: 131 HEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERIVQQLPSP 190
           HEII VLNK DL S+DPD+VK QIEE IGI   ++LLVSAK+G GI  +LE IV +LP+P
Sbjct: 126 HEIIPVLNKIDLASSDPDKVKSQIEEIIGIDASESLLVSAKSGIGIKDVLEAIVSRLPAP 185

Query: 191 TSPEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVERIGILT 250
           +     + PLKA+L+D+WY++YLG+++L+R+++G + KG  I +M +NA YQV+ IGI T
Sbjct: 186 SG--NFDNPLKAILVDTWYDTYLGIVILLRVVDGVIKKGMKIVMMSSNAVYQVDNIGIFT 243

Query: 251 PKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVVFCGLFP 310
           P    ++ L  GEIG + ASIKE+S  ++GDTIT++     + +PGF+ I PVVFC +FP
Sbjct: 244 PHKKIVDQLSVGEIGFITASIKELSDCKIGDTITEEQRRCDNPMPGFRTIHPVVFCSIFP 303

Query: 311 VDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERLEREFSL 370
            +A  FE LR A+ KL+LNDASF+F++E S ALG+GFRCGFLG+LHLE+IQERLEREF+L
Sbjct: 304 NEAGDFERLREALKKLQLNDASFTFDIEVSNALGYGFRCGFLGMLHLEVIQERLEREFNL 363

Query: 371 NLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEYLGSILKL 430
           +L  T+P VVY++   +G ++++ NP D  +V  IA ++EPWI  TI+ P++YLG ++ L
Sbjct: 364 DLTATAPGVVYQIISKNGILREVHNPHDFGDVQDIASIKEPWICATIMVPDQYLGVVMSL 423

Query: 431 CQERRGIQIDMSHLDNRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDYRDSDLV 490
           C  +RG ++D+S+  N A++ Y LPL+EV+FDFYDR+KS+SKGYAS D+ +  Y DS++ 
Sbjct: 424 CNNKRGEKVDLSYSGNTALLKYRLPLSEVVFDFYDRIKSISKGYASLDWEMDGYMDSEIA 483

Query: 491 KLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGGRIIARET 550
           KLTIL+N+E +DAL+ +VH+S  E+RGR IC +LK+LIP+Q ++IAIQAA+G +IIARET
Sbjct: 484 KLTILINSEPVDALACIVHKSKVEQRGREICLRLKDLIPRQQYKIAIQAAVGSKIIARET 543

Query: 551 VKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISILK 602
           +   RKDVTAK YGGD+TR+ KLLEKQK+GKKR+R  G V++P +AFI  LK
Sbjct: 544 ISPYRKDVTAKLYGGDVTRRMKLLEKQKKGKKRLRAIGNVNVPHNAFIQALK 595


>gi|68171416|ref|ZP_00544807.1| Small GTP-binding protein domain:GTP-binding protein LepA
           [Ehrlichia chaffeensis str. Sapulpa]
 gi|88658022|ref|YP_507527.1| GTP-binding protein LepA [Ehrlichia chaffeensis str. Arkansas]
 gi|119371348|sp|Q2GGA6|LEPA_EHRCR RecName: Full=Elongation factor 4; Short=EF-4; AltName:
           Full=Ribosomal back-translocase LepA
 gi|67999158|gb|EAM85817.1| Small GTP-binding protein domain:GTP-binding protein LepA
           [Ehrlichia chaffeensis str. Sapulpa]
 gi|88599479|gb|ABD44948.1| GTP-binding protein LepA [Ehrlichia chaffeensis str. Arkansas]
          Length = 598

 Score =  770 bits (1988), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 359/594 (60%), Positives = 472/594 (79%), Gaps = 2/594 (0%)

Query: 9   SRIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVRL 68
           S IRNF+I+AHIDHGKSTLADR I+ C GL EREM  QVLD+MDIERERGITIKAQTVRL
Sbjct: 4   SHIRNFAIIAHIDHGKSTLADRLIEECNGLDEREMKDQVLDSMDIERERGITIKAQTVRL 63

Query: 69  NYTSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQAID 128
            Y + D + Y LNL+DTPGHVDF+YEVSRSL+ACEGSLL+VD++QGVEAQTLANVY+AID
Sbjct: 64  AYKAKDGQTYYLNLMDTPGHVDFSYEVSRSLAACEGSLLIVDSSQGVEAQTLANVYKAID 123

Query: 129 NNHEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERIVQQLP 188
           +NHEII VLNK DL S+DPD+VK QIE+ IGI   ++LLVSAK+G GI  +LE IV +LP
Sbjct: 124 SNHEIIPVLNKIDLASSDPDKVKLQIEDMIGIDASESLLVSAKSGIGIQDVLEAIVSRLP 183

Query: 189 SPTSPEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVERIGI 248
           +P+    +  PLKA+L+D+WY++YLG+++L+RI +G + KG  I +M  NA YQV+ +GI
Sbjct: 184 APSGK--SENPLKAILVDTWYDTYLGIVILLRIKDGVIRKGMKIVMMSNNAVYQVDNVGI 241

Query: 249 LTPKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVVFCGL 308
            TP    ++ L  GEIG + ASIKE+S  +VGDTIT++    +  LPGF+ I PVVFC +
Sbjct: 242 FTPHKKVVDQLSVGEIGFITASIKELSDCKVGDTITEEQRRCSEPLPGFRTIHPVVFCSI 301

Query: 309 FPVDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERLEREF 368
           FP +A +FE LR A+ KL+LNDASF+FE+E S ALG+GFRCGFLG+LHLE+IQERLEREF
Sbjct: 302 FPNEAGEFERLREALKKLQLNDASFTFEIEVSNALGYGFRCGFLGMLHLEVIQERLEREF 361

Query: 369 SLNLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEYLGSIL 428
           +L+L  T+P V+Y++    G ++K+ NP D  E   IA ++EPWI  TI+ P++YLG I+
Sbjct: 362 NLDLTATAPGVIYQVTTRSGDVRKVHNPHDFGESQDIANIKEPWICATIMVPDQYLGVIM 421

Query: 429 KLCQERRGIQIDMSHLDNRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDYRDSD 488
            LC  +RG ++D+S+  N A++ Y LPL+EV+FDFYDR+KS+SKGYAS D+ + +Y DS+
Sbjct: 422 SLCNNKRGEKLDLSYSGNTALLKYRLPLSEVVFDFYDRIKSMSKGYASLDWEMDEYLDSE 481

Query: 489 LVKLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGGRIIAR 548
           + KL+IL+N+E +DAL+ ++H+S  E+RGR IC +LK+LIP+Q ++IAIQAA+GGRI+AR
Sbjct: 482 IAKLSILINSEPVDALACIIHKSKVEQRGREICLRLKDLIPRQQYKIAIQAAVGGRIVAR 541

Query: 549 ETVKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISILK 602
           ET+   RKDVTAK YGGD+TR+ KLLEKQK+GKKR+R  G V++P +AFI  LK
Sbjct: 542 ETISPYRKDVTAKLYGGDVTRRMKLLEKQKKGKKRLRSIGNVNVPHNAFIQALK 595


>gi|148264548|ref|YP_001231254.1| GTP-binding protein LepA [Geobacter uraniireducens Rf4]
 gi|189046442|sp|A5G4G3|LEPA_GEOUR RecName: Full=Elongation factor 4; Short=EF-4; AltName:
           Full=Ribosomal back-translocase LepA
 gi|146398048|gb|ABQ26681.1| GTP-binding protein LepA [Geobacter uraniireducens Rf4]
          Length = 599

 Score =  768 bits (1982), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 362/598 (60%), Positives = 469/598 (78%), Gaps = 3/598 (0%)

Query: 8   LSRIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVR 67
           L  IRNFSI+AHIDHGKSTLADR +++   L+EREM +Q LD MD+ERERGITIKAQ VR
Sbjct: 3   LENIRNFSIIAHIDHGKSTLADRLLEYTGALSEREMQNQFLDKMDLERERGITIKAQAVR 62

Query: 68  LNYTSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQAI 127
           LNY + + KDY LNLIDTPGHVDFTYEVSRSLSACEG+LLVVDA+QGVEAQTLANVY A+
Sbjct: 63  LNYRAANGKDYILNLIDTPGHVDFTYEVSRSLSACEGALLVVDASQGVEAQTLANVYLAL 122

Query: 128 DNNHEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERIVQQL 187
           +N+ ++  VLNK DLP+ADP+RVK++IE+ IG+   DA+L SAK G G   +LE IV ++
Sbjct: 123 ENDLDVFPVLNKIDLPAADPERVKQEIEDIIGLDAHDAVLASAKEGIGTREILEEIVTKI 182

Query: 188 PSPTSPEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVERIG 247
           P P     +N PLKALL DSWY+ Y GV+VLVRI++G + KG  I+LM     Y+V ++G
Sbjct: 183 PPPQG--DSNKPLKALLFDSWYDQYQGVIVLVRILDGMVKKGDKIQLMSNRRNYEVLKVG 240

Query: 248 ILTPKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVVFCG 307
           + +P M ++ AL  GE+G +IA IK+V   +VGDTIT   +P    LPGFK +QP+VF G
Sbjct: 241 VFSPAMCEVAALSAGEVGFIIAGIKDVQDAKVGDTITSLHNPCDGPLPGFKEVQPMVFSG 300

Query: 308 LFPVDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERLERE 367
           L+P+D +Q+E LR A+ KL+LND+SFS+E E S ALGFGFRCGFLGLLH+EIIQERLERE
Sbjct: 301 LYPIDTSQYEQLRDALAKLKLNDSSFSYEPETSLALGFGFRCGFLGLLHMEIIQERLERE 360

Query: 368 FSLNLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEYLGSI 427
           F+L+LI T+P+VVY+++  DGS+  + +   +P V +I  + EP+I  +I  PNE++G I
Sbjct: 361 FNLDLITTAPTVVYKVHRLDGSIITIESANQLPPVQEIQYVEEPFILASIHVPNEFVGGI 420

Query: 428 LKLCQERRGIQIDMSHLD-NRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDYRD 486
           L LC+E+RG+Q ++ +L   R M++YELPLNEV+ DFYDRLKS++KGYAS DY  +DYR 
Sbjct: 421 LALCEEKRGVQREIKYLTPTRVMVIYELPLNEVVLDFYDRLKSITKGYASLDYEHLDYRR 480

Query: 487 SDLVKLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGGRII 546
           S+L +L I++N E +DALS+++H+  +  RGR +  K+K LIP+QMF+IAIQAAIG ++I
Sbjct: 481 SNLERLNIMINGEVVDALSLIIHKDKAYFRGRDLVSKMKELIPRQMFEIAIQAAIGNKVI 540

Query: 547 ARETVKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISILKTD 604
           ARETVKA RKDV AKCYGGDITRKRKLLEKQKEGKKRM+  G V++PQ AF++ILK +
Sbjct: 541 ARETVKAMRKDVLAKCYGGDITRKRKLLEKQKEGKKRMKNVGNVELPQEAFLAILKVE 598


>gi|114331758|ref|YP_747980.1| GTP-binding protein LepA [Nitrosomonas eutropha C91]
 gi|122313491|sp|Q0AF67|LEPA_NITEC RecName: Full=Elongation factor 4; Short=EF-4; AltName:
           Full=Ribosomal back-translocase LepA
 gi|114308772|gb|ABI60015.1| GTP-binding protein LepA [Nitrosomonas eutropha C91]
          Length = 598

 Score =  768 bits (1982), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 359/600 (59%), Positives = 471/600 (78%), Gaps = 4/600 (0%)

Query: 8   LSRIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVR 67
           +  IRNFSI+AHIDHGKSTLADR IQ C GL++REM +QVLD+MD+ERERGITIKAQT  
Sbjct: 2   IQHIRNFSIIAHIDHGKSTLADRIIQFCGGLSDREMEAQVLDSMDLERERGITIKAQTAA 61

Query: 68  LNYTSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQAI 127
           L Y + D  +Y LNLIDTPGHVDF+YEVSRSLSACEG+LLVVDA+QGVEAQT+AN Y AI
Sbjct: 62  LYYQAKDGVNYLLNLIDTPGHVDFSYEVSRSLSACEGALLVVDASQGVEAQTVANCYTAI 121

Query: 128 DNNHEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERIVQQL 187
           +   E+I VLNK DLP+ADPDRV  +IE+ IGI    AL +SAKTGEGI  +LE IV ++
Sbjct: 122 EQGVEVIPVLNKIDLPAADPDRVIAEIEDIIGIEARSALHISAKTGEGISEVLEMIVARI 181

Query: 188 PSPTSPEGA-NAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVERI 246
           P P   EG  +APL+AL+IDSW++SY+GV++LVR+++G L  G  + LM   A Y  E +
Sbjct: 182 PPP---EGEIDAPLRALIIDSWFDSYVGVVMLVRVMDGILKPGSKLLLMSNKANYLCEEV 238

Query: 247 GILTPKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVVFC 306
           G+  PK ++ E+L  GE+G +I+ IK++   +VGDT+T    P +  L GFK I+P VF 
Sbjct: 239 GVFQPKAVNRESLSAGEVGFIISGIKDLKSAKVGDTVTLVDHPASEPLDGFKEIKPQVFA 298

Query: 307 GLFPVDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERLER 366
           GL+PV++ Q++ LR A+ KLRLNDAS  FE E S ALGFGFRCGFLGLLHL+I+QERLER
Sbjct: 299 GLYPVESNQYDALRAALEKLRLNDASLHFEPETSQALGFGFRCGFLGLLHLDIVQERLER 358

Query: 367 EFSLNLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEYLGS 426
           E+ ++LI T+P+VVY++ +HDG + ++ NP  +PE++ I E+REP I  TI+ P EY+G+
Sbjct: 359 EYDMDLITTAPTVVYQVVLHDGKIVEIENPSRLPELSSIEEIREPVITATILVPEEYVGA 418

Query: 427 ILKLCQERRGIQIDMSHLDNRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDYRD 486
           ++ LC  +RG+Q +M ++  + M+VYELPLNEV+ DF+D+LKSVS+GYAS DY   ++R 
Sbjct: 419 VITLCTGKRGVQENMQYMGRQVMLVYELPLNEVVMDFFDKLKSVSRGYASLDYEFKEFRV 478

Query: 487 SDLVKLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGGRII 546
           +DLVKL IL+NNE +DALS++VHR+ S++RGR + +K++ LIP+QMF IA+QAAIG  I+
Sbjct: 479 ADLVKLDILINNERVDALSLIVHRASSQQRGRELAQKMRELIPRQMFDIAVQAAIGAHIV 538

Query: 547 ARETVKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISILKTDNE 606
           ARE VKA RK+V AKCYGGDITRKRKLLEKQK GKKRM+R G V+IPQ+AF++IL+ D +
Sbjct: 539 ARENVKALRKNVLAKCYGGDITRKRKLLEKQKAGKKRMKRVGNVEIPQAAFLAILQVDGK 598


>gi|40063420|gb|AAR38231.1| GTP-binding protein LepA [uncultured marine bacterium 580]
          Length = 596

 Score =  767 bits (1981), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 358/598 (59%), Positives = 472/598 (78%), Gaps = 2/598 (0%)

Query: 8   LSRIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVR 67
           +  IRNFSI+AHIDHGKSTLADR IQHC GL +REM +QVLD+MD+ERERGITIKAQTV 
Sbjct: 1   MKNIRNFSIIAHIDHGKSTLADRIIQHCGGLADREMEAQVLDSMDLERERGITIKAQTVT 60

Query: 68  LNYTSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQAI 127
           L+Y + D + Y  NLIDTPGHVDFTYEVSRSLSACEG +LVVDA+QGVEAQT+AN Y A+
Sbjct: 61  LSYKAKDGELYVFNLIDTPGHVDFTYEVSRSLSACEGGVLVVDASQGVEAQTVANCYTAL 120

Query: 128 DNNHEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERIVQQL 187
           D N E+  VLNK DL SA+PDRVKK+IE+ IGI  +DA+L SAKTG+GI  +LE IV ++
Sbjct: 121 DQNVEVFPVLNKIDLASAEPDRVKKEIEDVIGIEADDAILCSAKTGQGIEDVLETIVHKV 180

Query: 188 PSPTSPEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVERIG 247
           P+P        PLKAL+ID+W+++Y+GV++LVR+I+G++     I LM T  +Y  E +G
Sbjct: 181 PAPIGD--IKKPLKALIIDAWFDNYVGVVMLVRVIDGEIKAKDKIHLMATKDEYACESVG 238

Query: 248 ILTPKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVVFCG 307
           I TPK I  ++L  GE+G +IA IK++  T+VGDTIT   +    ALPGFK IQP VF G
Sbjct: 239 IFTPKSIVRDSLGAGEVGFVIAGIKDLESTKVGDTITLSKNKADEALPGFKEIQPQVFAG 298

Query: 308 LFPVDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERLERE 367
           L+P+++ QF+ LRTA+ KL+LNDAS +FE ENSTALGFGFRCGFLGLLH++IIQERLERE
Sbjct: 299 LYPIESNQFDALRTALEKLKLNDASLNFEPENSTALGFGFRCGFLGLLHMDIIQERLERE 358

Query: 368 FSLNLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEYLGSI 427
           + + LI T+P+VVYEL + +  +  + NP  +P+++ I E+REP I + I+ P++Y+G +
Sbjct: 359 YEMELITTAPTVVYELLLKNDDVISVENPSRLPDLSTIEEIREPIINLNILLPHDYVGPV 418

Query: 428 LKLCQERRGIQIDMSHLDNRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDYRDS 487
           +KL  E+RGIQ +M ++  + MI YE+PLNEV+ DF+DRLKSVS+GYAS DY  +++R +
Sbjct: 419 MKLVNEKRGIQKNMQYMGRQVMITYEIPLNEVVLDFFDRLKSVSRGYASMDYEFMEFRAA 478

Query: 488 DLVKLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGGRIIA 547
           DL+KL I+VN + +DALS++VHRS S  +GR +  K+++LIP+QMF +AIQ+AIG  IIA
Sbjct: 479 DLIKLDIMVNGDRVDALSLIVHRSNSISKGRELASKMRSLIPRQMFDVAIQSAIGANIIA 538

Query: 548 RETVKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISILKTDN 605
           RET+KA RK+V AKCYGGD++RKRKLLEKQK GKKRM++ G V+IPQ AF++IL+ D+
Sbjct: 539 RETIKALRKNVIAKCYGGDVSRKRKLLEKQKAGKKRMKQVGNVEIPQEAFLAILQVDD 596


>gi|212703956|ref|ZP_03312084.1| hypothetical protein DESPIG_02009 [Desulfovibrio piger ATCC 29098]
 gi|212672659|gb|EEB33142.1| hypothetical protein DESPIG_02009 [Desulfovibrio piger ATCC 29098]
          Length = 637

 Score =  767 bits (1980), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 359/604 (59%), Positives = 473/604 (78%), Gaps = 4/604 (0%)

Query: 5   PTP-LSRIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKA 63
           P P L  IRNF I+AHIDHGKSTLADR ++  + +++RE   Q LD MD+ERERGITIKA
Sbjct: 36  PMPSLDHIRNFCIIAHIDHGKSTLADRILELTKVVSQREARQQYLDKMDLERERGITIKA 95

Query: 64  QTVRLNYTSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANV 123
           QTVR+ Y + + ++Y+LNLIDTPGHVDF YEVSRSL+ACEG+LLVVDATQGVEAQTLANV
Sbjct: 96  QTVRIPYVAANGEEYELNLIDTPGHVDFNYEVSRSLAACEGALLVVDATQGVEAQTLANV 155

Query: 124 YQAIDNNHEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERI 183
           Y A+D++HEI+ VLNK DLPSA+ DRVK++IEE IG+   DAL VSAKTG G+  +LE I
Sbjct: 156 YLALDHDHEIVPVLNKIDLPSAEVDRVKEEIEEAIGLDCTDALPVSAKTGLGVDAVLEAI 215

Query: 184 VQQLPSPTSPEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQV 243
           V +LP+P      +APLKAL+ DSWY+SY GV+VL R+++G++  G  +RLM T  +Y+V
Sbjct: 216 VHRLPAPGG--DLDAPLKALIFDSWYDSYQGVVVLFRVVDGRVKLGDMVRLMSTGKEYEV 273

Query: 244 ERIGILTPKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPV 303
            R+G+ +P+  D++ L  GE+G +  SIK +   RVGDTIT  ++P T  +PGFK ++P+
Sbjct: 274 LRLGVFSPEATDVKELLAGEVGFLCGSIKSLGDARVGDTITLAANPATEPVPGFKEVKPM 333

Query: 304 VFCGLFPVDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQER 363
           VFCGL+P ++  +ENL+ A+ KL+LNDA+FSFE E S ALGFGFRCGFLGLLH+EIIQER
Sbjct: 334 VFCGLYPSESDDYENLKAALEKLQLNDAAFSFEPETSQALGFGFRCGFLGLLHMEIIQER 393

Query: 364 LEREFSLNLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEY 423
           LEREF ++LI T+PSV+Y +   DG   ++ NP  +P+ TKI  L EP++ + I  PNEY
Sbjct: 394 LEREFEVDLIATAPSVIYRVDTTDGKTLEIDNPAHLPDSTKIKALYEPYVSMDIHVPNEY 453

Query: 424 LGSILKLCQERRGIQIDMSHL-DNRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVI 482
           +G+++KLC+++RG Q ++ +L  NR ++ YELP  E+++DF+DRLKS ++GYAS DY  I
Sbjct: 454 VGNVMKLCEDKRGTQKNLHYLAANRVVVTYELPFAEIVYDFFDRLKSCTRGYASMDYQPI 513

Query: 483 DYRDSDLVKLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIG 542
           DYR+SDLV+L IL+N+E +DAL+++VHR  +   GR +  KLK  IP+Q+FQ+AIQAAIG
Sbjct: 514 DYRESDLVRLDILLNSEPVDALAVIVHRDRAYTYGRSLALKLKRTIPRQLFQVAIQAAIG 573

Query: 543 GRIIARETVKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISILK 602
            +IIARETV A RKDVTAKCYGGDITRKRKLLEKQKEGKKRM+R G V++PQ AF++ LK
Sbjct: 574 QKIIARETVSAFRKDVTAKCYGGDITRKRKLLEKQKEGKKRMKRMGNVELPQEAFLAALK 633

Query: 603 TDNE 606
             +E
Sbjct: 634 VGDE 637


>gi|220905455|ref|YP_002480767.1| GTP-binding protein LepA [Desulfovibrio desulfuricans subsp.
           desulfuricans str. ATCC 27774]
 gi|254808728|sp|B8J444|LEPA_DESDA RecName: Full=Elongation factor 4; Short=EF-4; AltName:
           Full=Ribosomal back-translocase LepA
 gi|219869754|gb|ACL50089.1| GTP-binding protein LepA [Desulfovibrio desulfuricans subsp.
           desulfuricans str. ATCC 27774]
          Length = 601

 Score =  766 bits (1979), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 356/597 (59%), Positives = 469/597 (78%), Gaps = 3/597 (0%)

Query: 11  IRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVRLNY 70
           IRNF I+AHIDHGKSTLADR ++  + +++RE   Q LD MD+ERERGITIKAQTVR+ Y
Sbjct: 7   IRNFCIIAHIDHGKSTLADRILELTQVVSQREARQQYLDRMDLERERGITIKAQTVRIPY 66

Query: 71  TSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQAIDNN 130
            + D ++Y+LNLIDTPGHVDF YEVSRSL+ACEG+LLVVDATQGVEAQTLANVY A+D++
Sbjct: 67  IAADGQEYELNLIDTPGHVDFNYEVSRSLAACEGALLVVDATQGVEAQTLANVYLALDHD 126

Query: 131 HEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERIVQQLPSP 190
           HE+I VLNK DLPSA+ DRVK +IEE+IG+    AL VSAKTG G+  +LE IV  LP+P
Sbjct: 127 HEVIPVLNKIDLPSAEVDRVKAEIEESIGLDCSQALPVSAKTGMGVDAVLEAIVHHLPAP 186

Query: 191 TSPEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVERIGILT 250
                A  PLKAL+ DSWY+SY GV+VL RI++G + KG ++RLM T  +Y+V R+G+ +
Sbjct: 187 KGDRAA--PLKALIFDSWYDSYQGVVVLFRIMDGSVRKGDTVRLMSTGKEYEVLRLGVFS 244

Query: 251 PKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVVFCGLFP 310
           P+  D++ L+ GE+G +  SIKE+   RVGDTIT    P  +A+PGFK ++ +VFCGL+P
Sbjct: 245 PEPTDVKELFAGEVGFLCGSIKELGDARVGDTITHADRPAETAVPGFKEVKAMVFCGLYP 304

Query: 311 VDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERLEREFSL 370
            ++  +ENL+ A+ KL+LNDA+FS+E E S ALGFGFRCGFLGLLH+EIIQERLEREF +
Sbjct: 305 TESEDYENLKAALEKLQLNDAAFSYEPETSQALGFGFRCGFLGLLHMEIIQERLEREFEV 364

Query: 371 NLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEYLGSILKL 430
            LI T+PSVVY++   DG   ++ NP  +P+ TKI  L EP++ + I  PNEY+G+++KL
Sbjct: 365 GLIATAPSVVYKVVTMDGKTLEIDNPSHLPDPTKIDTLYEPYVSMDIHVPNEYVGNVMKL 424

Query: 431 CQERRGIQIDMSHL-DNRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDYRDSDL 489
           C+E+RG Q ++ +L  NR ++ YELP  E+++DF+DRLKS ++GYAS DY+ +DYR SDL
Sbjct: 425 CEEKRGTQKNLHYLAANRVVVTYELPFAEIVYDFFDRLKSATRGYASMDYHPLDYRASDL 484

Query: 490 VKLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGGRIIARE 549
           V+L I++N+E +DAL+++VHR  +   GRG+  KLK  IP+Q+FQ+AIQAAIG +IIARE
Sbjct: 485 VRLDIMLNSEPVDALAVIVHRDRAYTYGRGLALKLKRTIPRQLFQVAIQAAIGQKIIARE 544

Query: 550 TVKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISILKTDNE 606
           TV A RKDVTAKCYGGDI+RKRKLLEKQKEGK+RM+R G V++PQ AF++ LK  +E
Sbjct: 545 TVSAFRKDVTAKCYGGDISRKRKLLEKQKEGKRRMKRMGNVELPQEAFLAALKVGDE 601


>gi|117924213|ref|YP_864830.1| GTP-binding protein LepA [Magnetococcus sp. MC-1]
 gi|166987754|sp|A0L631|LEPA_MAGSM RecName: Full=Elongation factor 4; Short=EF-4; AltName:
           Full=Ribosomal back-translocase LepA
 gi|117607969|gb|ABK43424.1| GTP-binding protein LepA [Magnetococcus sp. MC-1]
          Length = 598

 Score =  766 bits (1978), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 357/598 (59%), Positives = 470/598 (78%), Gaps = 3/598 (0%)

Query: 8   LSRIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVR 67
           L  IRNFSI+AHIDHGKSTLADR IQ    L+ER+M  QVLD+MDIERERGITIKAQ+VR
Sbjct: 3   LDHIRNFSIIAHIDHGKSTLADRLIQFTGALSERDMKEQVLDSMDIERERGITIKAQSVR 62

Query: 68  LNYTSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQAI 127
           LNY + D K Y LNLIDTPGHVDFTYEVSRSL+ACEG+LL+VDA QGVEAQT+ANVY A+
Sbjct: 63  LNYKAKDGKTYVLNLIDTPGHVDFTYEVSRSLAACEGALLIVDAAQGVEAQTMANVYLAL 122

Query: 128 DNNHEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERIVQQL 187
           +++ EII VLNK DLPSA+P+RV++QIEE IG+   +A+L SAK+G GI  +LE IV+++
Sbjct: 123 EHDLEIIPVLNKIDLPSAEPERVREQIEEVIGLDASEAILASAKSGIGIEEILEAIVKRV 182

Query: 188 PSPTSPEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVERIG 247
           P P      +AP KAL++DSWY++YLGV+ L R+ +G L  G+ IR MG    Y ++ +G
Sbjct: 183 PPPKG--DLDAPAKALVVDSWYDNYLGVVSLARVYDGVLKAGEKIRFMGVGMDYPLDNVG 240

Query: 248 ILTPKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVVFCG 307
            LTP +  +  L  GE+G ++A IK++S  RVGDTIT    P  S LPGF+P + +VF G
Sbjct: 241 FLTPVLTKVAELKAGEVGCIMAGIKKLSDARVGDTITTVRRPCASQLPGFQPAKSMVFAG 300

Query: 308 LFPVDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERLERE 367
           L+PVD+  +E+L+ A+ KL +NDAS ++E+E S ALGFGFRCGFLG+LH+EIIQERLERE
Sbjct: 301 LYPVDSADYEDLKDALEKLAINDASLNYEVETSPALGFGFRCGFLGMLHMEIIQERLERE 360

Query: 368 FSLNLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEYLGSI 427
           F L+L+ T+P+VVY +   DG +  + +P D+P  TK   + EP+I   I+ P EY+G +
Sbjct: 361 FDLDLVTTAPTVVYRVKQTDGQIMDIRSPGDLPPTTKREYIEEPYILANIMVPAEYMGPV 420

Query: 428 LKLCQERRGIQIDMSHL-DNRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDYRD 486
           ++LC +RRG Q DMS++ D R M+ YE+P++EV+ DF+DRLKS++KGYAS DY+++DYR 
Sbjct: 421 MQLCTDRRGTQKDMSYISDTRVMVQYEMPMSEVVMDFFDRLKSMTKGYASLDYHLLDYRM 480

Query: 487 SDLVKLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGGRII 546
           SDLVKL IL+N + +DALS++VHR++S+ RGR + +K+K LI +QMF +A+QA IGG+II
Sbjct: 481 SDLVKLDILINGDPVDALSVIVHRNISQYRGRELAKKMKELIHRQMFDVAVQACIGGKII 540

Query: 547 ARETVKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISILKTD 604
           ARETVKA RK+VTAKCYGGDITRKRKLLEKQK GKKRM++ G+V+IPQ AF+++LK D
Sbjct: 541 ARETVKALRKNVTAKCYGGDITRKRKLLEKQKAGKKRMKQVGKVEIPQEAFLAVLKVD 598


>gi|254468443|ref|ZP_05081849.1| GTP-binding protein LepA [beta proteobacterium KB13]
 gi|207087253|gb|EDZ64536.1| GTP-binding protein LepA [beta proteobacterium KB13]
          Length = 598

 Score =  766 bits (1977), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 359/596 (60%), Positives = 467/596 (78%), Gaps = 2/596 (0%)

Query: 11  IRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVRLNY 70
           IRNFSI+AHIDHGKSTLADR IQ C GL +REM  QVLD+MD+ERERGITIKAQTV L Y
Sbjct: 5   IRNFSIIAHIDHGKSTLADRLIQSCGGLADREMDDQVLDSMDLERERGITIKAQTVTLKY 64

Query: 71  TSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQAIDNN 130
            + D +DY LNLIDTPGHVDFTYEVSRSL+ACEG LLVVDA+QGVEAQT+AN Y A+D N
Sbjct: 65  KAKDNQDYILNLIDTPGHVDFTYEVSRSLAACEGGLLVVDASQGVEAQTVANCYTALDQN 124

Query: 131 HEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERIVQQLPSP 190
            E+ TVLNK DL SADPDRVK +IE+ IGI   DA+  SAKTG GIP +LE+IV  +P+P
Sbjct: 125 VEVFTVLNKIDLASADPDRVKTEIEDVIGIDATDAIPCSAKTGLGIPDILEKIVSFVPAP 184

Query: 191 TSPEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVERIGILT 250
                 N PL+AL+ID+W+++Y+GV++LVRI+ G L     + LM +   Y  ++IGI T
Sbjct: 185 KG--DPNNPLQALIIDAWFDNYVGVVMLVRIVEGSLATKDKVTLMSSGRNYAADQIGIFT 242

Query: 251 PKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVVFCGLFP 310
           PK +  + L  GE+G +IA IKE++  +VGDTIT   +P    LPGF+ I+P VF GL+P
Sbjct: 243 PKPLIQDKLVAGEVGFVIAGIKELATAKVGDTITGTQNPAKKPLPGFREIKPQVFAGLYP 302

Query: 311 VDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERLEREFSL 370
           V++ QFE LRT++ KL LND+S +FE ENS+ALGFGFRCGFLGLLH++IIQERLERE+ +
Sbjct: 303 VESNQFEALRTSLEKLSLNDSSLNFEPENSSALGFGFRCGFLGLLHMDIIQERLEREYEM 362

Query: 371 NLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEYLGSILKL 430
            LI T+P+VVYEL + +G ++++ NP  +P+++ I ++REP I + ++ P +Y+G ++ L
Sbjct: 363 ELITTAPTVVYELLLKNGEVEQIENPSKLPDLSTIEQIREPIITLNVLLPQDYVGPVMTL 422

Query: 431 CQERRGIQIDMSHLDNRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDYRDSDLV 490
             E+RGIQ +M +L  + M+ YE+PLNEV+ DF+D+LKSVS+GYAS DY+ +++R SDLV
Sbjct: 423 ANEKRGIQKNMQYLGRQVMLTYEIPLNEVVLDFFDKLKSVSRGYASMDYDFLEFRGSDLV 482

Query: 491 KLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGGRIIARET 550
           KL ILVN E +DALS +VHR  S+ RGR +  K++ LIP+QMF +AIQAAIG  II+RET
Sbjct: 483 KLDILVNGERVDALSTIVHRLNSKFRGRDLAAKMRELIPRQMFDVAIQAAIGANIISRET 542

Query: 551 VKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISILKTDNE 606
           VKA RK+V AKCYGGD++RKRKLLEKQKEGKKRM++ G V+IPQ AF++ILK D++
Sbjct: 543 VKAMRKNVLAKCYGGDVSRKRKLLEKQKEGKKRMKQVGNVEIPQEAFLAILKVDDK 598


>gi|189424679|ref|YP_001951856.1| GTP-binding protein LepA [Geobacter lovleyi SZ]
 gi|238692140|sp|B3E9R0|LEPA_GEOLS RecName: Full=Elongation factor 4; Short=EF-4; AltName:
           Full=Ribosomal back-translocase LepA
 gi|189420938|gb|ACD95336.1| GTP-binding protein LepA [Geobacter lovleyi SZ]
          Length = 600

 Score =  764 bits (1972), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 360/600 (60%), Positives = 462/600 (77%), Gaps = 3/600 (0%)

Query: 8   LSRIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVR 67
           +S+IRNFSI+AHIDHGKSTLADR +++   LT REM SQ LD MD+ERERGITIKAQTVR
Sbjct: 3   ISKIRNFSIIAHIDHGKSTLADRLLEYTGALTAREMQSQFLDKMDLERERGITIKAQTVR 62

Query: 68  LNYTSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQAI 127
           LNYT+ D   Y LNLIDTPGHVDFTYEVSRSL+ACEG LLVVDA+QGVEAQTLANVY A+
Sbjct: 63  LNYTADDGNTYVLNLIDTPGHVDFTYEVSRSLAACEGGLLVVDASQGVEAQTLANVYLAL 122

Query: 128 DNNHEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERIVQQL 187
           DN+ E+  VLNK DLP+A+P+RVK +IEE IGI   DA+L SAK G G   +LE IV+++
Sbjct: 123 DNDLEVFPVLNKIDLPAAEPERVKHEIEEIIGIDAHDAVLASAKEGIGTREILEEIVKKI 182

Query: 188 PSPTSPEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVERIG 247
           P+P       APLKALL DSWY+ Y GV++LVR+  G L KG  I+LM TN  Y+  ++G
Sbjct: 183 PAPQGD--VAAPLKALLFDSWYDQYQGVIILVRLFEGSLKKGDKIQLMSTNKAYEALKVG 240

Query: 248 ILTPKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVVFCG 307
           + +P M+++  L  GE+G +IA IK+V+  +VGDT+T         L GFK ++P+VF G
Sbjct: 241 VFSPVMVEVPQLTAGEVGFVIAGIKDVADAKVGDTVTLLHRQCAEMLGGFKEVKPMVFSG 300

Query: 308 LFPVDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERLERE 367
           L+P+D  Q+E LR A+ KL+LND+SFSFE E S ALGFGFRCGFLGLLH+EIIQERLERE
Sbjct: 301 LYPIDTAQYEQLRDALAKLKLNDSSFSFEPETSVALGFGFRCGFLGLLHMEIIQERLERE 360

Query: 368 FSLNLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEYLGSI 427
           F L+LI T+P+VVY ++  +G +  + +   MPE+     L EP+I   I  PN+Y+G +
Sbjct: 361 FGLDLITTAPTVVYRVHKMNGDVYSIQSANQMPELQSTEYLEEPFILAHIHVPNDYVGGV 420

Query: 428 LKLCQERRGIQIDMSHLD-NRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDYRD 486
           L LC+++RG+Q ++ +L   R MI+YELPLNE++ DFYDRLKS++KGYAS DY  ++YR 
Sbjct: 421 LALCEDKRGVQREIKYLTPTRVMIIYELPLNEIVLDFYDRLKSITKGYASLDYEHLEYRR 480

Query: 487 SDLVKLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGGRII 546
           SDLV++ +L+N E +DALS+++HR  +  RGR +  K+K LI +QMF++AIQAAIG +II
Sbjct: 481 SDLVRMNVLINGEVVDALSLILHRDKAYFRGRDLVSKMKELISRQMFEVAIQAAIGSKII 540

Query: 547 ARETVKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISILKTDNE 606
           ARETVKA RKDV AKCYGGDITRKRKLLEKQKEGKKRM+  G V++PQ AF++ILK D++
Sbjct: 541 ARETVKAMRKDVLAKCYGGDITRKRKLLEKQKEGKKRMKNVGNVELPQEAFLAILKVDDK 600


>gi|303325907|ref|ZP_07356350.1| GTP-binding protein LepA [Desulfovibrio sp. 3_1_syn3]
 gi|302863823|gb|EFL86754.1| GTP-binding protein LepA [Desulfovibrio sp. 3_1_syn3]
          Length = 601

 Score =  764 bits (1972), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 358/598 (59%), Positives = 466/598 (77%), Gaps = 3/598 (0%)

Query: 10  RIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVRLN 69
           RIRNF I+AHIDHGKSTLADR ++  R ++ RE   Q LD MD+ERERGITIKAQTVR+ 
Sbjct: 6   RIRNFCIIAHIDHGKSTLADRILELTRVVSAREARQQYLDRMDLERERGITIKAQTVRIP 65

Query: 70  YTSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQAIDN 129
           Y + D K+Y+LNLIDTPGHVDF YEVSRSL+ACEG+LLVVDATQGVEAQTLANVY A+D+
Sbjct: 66  YVAADGKEYELNLIDTPGHVDFNYEVSRSLAACEGALLVVDATQGVEAQTLANVYLALDH 125

Query: 130 NHEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERIVQQLPS 189
           +HEI+ VLNK DLPSA+ +RVK +IEE+IG+   +AL VSAKTG G+  +LE IV++LP+
Sbjct: 126 DHEIVPVLNKIDLPSAEVERVKAEIEESIGLDCSEALPVSAKTGMGVDAVLEAIVKRLPA 185

Query: 190 PTSPEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVERIGIL 249
           P      +APLKAL+ DSWY+SY GV+ L R+++G +  G +IRLM T  +Y+V R+G+ 
Sbjct: 186 PRG--NPDAPLKALIFDSWYDSYQGVVTLFRVVDGAVRLGDTIRLMSTGKEYEVLRLGVF 243

Query: 250 TPKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVVFCGLF 309
           +P+  D+  L  GE+G +  SIKE+   RVGDTIT   +P    +PGFK ++P+VFCGL+
Sbjct: 244 SPEAADVRELTAGEVGFLCGSIKELGDARVGDTITLADNPAAEPVPGFKEVKPMVFCGLY 303

Query: 310 PVDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERLEREFS 369
           P ++  +ENL+ A+ KL+LNDA+FSFE E S ALGFGFRCGFLGLLH+EIIQERLEREF 
Sbjct: 304 PTESDDYENLKAALEKLQLNDAAFSFEPETSQALGFGFRCGFLGLLHMEIIQERLEREFE 363

Query: 370 LNLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEYLGSILK 429
           + LI T+PSVVY++   DG   ++ NP  +P+ TK + L EP++ + I  PNEY+G+++K
Sbjct: 364 VGLIATAPSVVYKVDTVDGKTLEIDNPSHLPDPTKTSALYEPYVSMDIHVPNEYVGNVMK 423

Query: 430 LCQERRGIQIDMSHL-DNRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDYRDSD 488
           LC+E+RG Q ++ +L  NR ++ YE+P  E+++DF+DRLKS ++GYAS DY  IDYR SD
Sbjct: 424 LCEEKRGTQKNLHYLAANRVVVTYEMPFAEIVYDFFDRLKSATRGYASMDYQPIDYRVSD 483

Query: 489 LVKLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGGRIIAR 548
           LV+L IL+N E +DAL+++VHR  +   GR +  KLK  IP+Q+FQ+AIQAAIG +IIAR
Sbjct: 484 LVRLDILLNGEPVDALAVIVHRDKAYTYGRSLALKLKRTIPRQLFQVAIQAAIGQKIIAR 543

Query: 549 ETVKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISILKTDNE 606
           ETV A RKDVTAKCYGGDITRKRKLLEKQKEGKKRM+R G V++PQ AF++ LK  +E
Sbjct: 544 ETVSAFRKDVTAKCYGGDITRKRKLLEKQKEGKKRMKRMGNVELPQEAFLAALKVGDE 601


>gi|198283246|ref|YP_002219567.1| GTP-binding protein LepA [Acidithiobacillus ferrooxidans ATCC
           53993]
 gi|218667461|ref|YP_002425829.1| GTP-binding protein LepA [Acidithiobacillus ferrooxidans ATCC
           23270]
 gi|226732748|sp|B7J9J8|LEPA_ACIF2 RecName: Full=Elongation factor 4; Short=EF-4; AltName:
           Full=Ribosomal back-translocase LepA
 gi|238689980|sp|B5EQB5|LEPA_ACIF5 RecName: Full=Elongation factor 4; Short=EF-4; AltName:
           Full=Ribosomal back-translocase LepA
 gi|198247767|gb|ACH83360.1| GTP-binding protein LepA [Acidithiobacillus ferrooxidans ATCC
           53993]
 gi|218519674|gb|ACK80260.1| GTP-binding protein LepA [Acidithiobacillus ferrooxidans ATCC
           23270]
          Length = 600

 Score =  763 bits (1970), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 354/601 (58%), Positives = 465/601 (77%), Gaps = 4/601 (0%)

Query: 6   TPLSRIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQT 65
           T    IRNFSI+AH+DHGKSTLAD+FI+ C  LTEREMSSQVLD MDIERERGITIKAQ+
Sbjct: 2   TEQQHIRNFSIIAHVDHGKSTLADQFIRLCGALTEREMSSQVLDTMDIERERGITIKAQS 61

Query: 66  VRLNYTSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQ 125
           VRL + + D ++YQ NLIDTPGHVDF+YEVSRSL+ACEG+LLVVDA+QGVEAQ++AN Y 
Sbjct: 62  VRLQFRAADGQEYQFNLIDTPGHVDFSYEVSRSLAACEGALLVVDASQGVEAQSVANCYT 121

Query: 126 AIDNNHEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERIVQ 185
           A+++N EI+ VLNK DLP+ADP+RV+++IE  +G+  +DA+  SAK G GI  +LER+V+
Sbjct: 122 ALEHNLEILPVLNKIDLPAADPERVRREIEAIVGLPADDAVEASAKEGTGIREILERVVE 181

Query: 186 QLPSPTS-PEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVE 244
           ++P P   PE A   L+AL+IDSW+++YLG +VLVR++NG +  GQ I  M     Y VE
Sbjct: 182 RIPPPQGDPEAA---LQALIIDSWFDNYLGTVVLVRVMNGSIRPGQRILTMVGQKPYVVE 238

Query: 245 RIGILTPKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVV 304
           ++G+ TPK + + AL  G +G +IA ++ +   RVGDT+T+   P ++ LPGF+ +QP V
Sbjct: 239 KVGVFTPKSLMVPALETGAVGFVIAGVRTIEGARVGDTLTEQDRPASAPLPGFREVQPQV 298

Query: 305 FCGLFPVDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERL 364
           F GL+PVD+  +E+ R A+ KLRLNDA+  FE E S ALGFGFRCGFLGLLH+EI+QERL
Sbjct: 299 FTGLYPVDSADYESFREALQKLRLNDAALQFEPETSQALGFGFRCGFLGLLHMEIVQERL 358

Query: 365 EREFSLNLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEYL 424
           ERE+ L LI T+P+V+YE+   DG + K+SNP ++P   KIA++REP I   I+ P  YL
Sbjct: 359 EREYQLELISTAPTVIYEVLTTDGQVLKISNPAELPAAQKIADIREPVITANILVPETYL 418

Query: 425 GSILKLCQERRGIQIDMSHLDNRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDY 484
           G ++ LC+ERRG Q +M     + M+ YELP NEV+ DF+DRLKSVS+GYAS DY    +
Sbjct: 419 GPVIALCEERRGRQKNMQFTGGQVMLRYELPHNEVVLDFFDRLKSVSRGYASMDYEFARF 478

Query: 485 RDSDLVKLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGGR 544
               LVK+ IL+N E +DALS +VHR VSE+RGR +  +L++LIP+QMF++AIQAAIG R
Sbjct: 479 ESGPLVKMDILINGEKLDALSWIVHRDVSERRGRELVVRLRDLIPRQMFEVAIQAAIGAR 538

Query: 545 IIARETVKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISILKTD 604
           +IARE+VKA RK+V AKCYGGDI+RKRKLLEKQKEGKKRM++ G V+IPQ AF+++LK+D
Sbjct: 539 VIARESVKALRKNVLAKCYGGDISRKRKLLEKQKEGKKRMKQVGHVEIPQEAFLAVLKSD 598

Query: 605 N 605
            
Sbjct: 599 K 599


>gi|218288640|ref|ZP_03492917.1| GTP-binding protein LepA [Alicyclobacillus acidocaldarius LAA1]
 gi|218241297|gb|EED08472.1| GTP-binding protein LepA [Alicyclobacillus acidocaldarius LAA1]
          Length = 602

 Score =  761 bits (1966), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 358/595 (60%), Positives = 470/595 (78%), Gaps = 3/595 (0%)

Query: 11  IRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVRLNY 70
           IRNFSI+AHIDHGKSTLADR ++    ++ REM  Q+LD +D+ERERGITIK Q VRLNY
Sbjct: 10  IRNFSIIAHIDHGKSTLADRILEFTGAVSPREMQDQLLDQLDLERERGITIKLQAVRLNY 69

Query: 71  TSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQAIDNN 130
            + D ++Y LNLIDTPGHVDFTYEVSRSL+ACEG+LLVVDA+QGVEAQTLANVY AIDNN
Sbjct: 70  RAKDGQEYVLNLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLANVYLAIDNN 129

Query: 131 HEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERIVQQLPSP 190
            EII V+NK DLPSADP+RVK+QIE+ IG+   DA+L SAK G GI  +LER+V ++P+P
Sbjct: 130 LEIIPVINKIDLPSADPERVKQQIEDVIGLDASDAVLASAKAGVGIEEVLERVVTRIPAP 189

Query: 191 TSPEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVERIGILT 250
           +     +APLKAL+ DS Y+SY GV+V +R+ +G + KG  I++M T+ +++V+ +G+  
Sbjct: 190 SG--DPDAPLKALIFDSHYDSYRGVIVYIRVFDGAIQKGMRIKMMSTDKEFEVDEVGVFR 247

Query: 251 PKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVVFCGLFP 310
           PKM  ++ L  GE+G   ASIK V  TRVGDT+TD   P    LPG++ I P+VFCGL+P
Sbjct: 248 PKMTPVDRLEAGEVGYFAASIKNVRDTRVGDTVTDALRPAAEPLPGYRKINPMVFCGLYP 307

Query: 311 VDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERLEREFSL 370
           VD+  +E+LR A+ KL LNDA+ ++E E S+ALGFGFRCGFLG+LH+EI+QERLERE+ L
Sbjct: 308 VDSADYEDLREALEKLELNDAALTYEPETSSALGFGFRCGFLGMLHMEIVQERLEREYGL 367

Query: 371 NLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEYLGSILKL 430
            LI T+PSVVY +Y  DG+M+++ NP  MP   +I  + EP+++ TI  P EY+G+I++L
Sbjct: 368 TLITTAPSVVYRVYRTDGTMEEIDNPSKMPSPDRIERIEEPFVRATIFAPKEYVGNIMEL 427

Query: 431 CQERRGIQIDMSHLDN-RAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDYRDSDL 489
           CQE+RG   DM +LD+ R  IVY+LPL E+++DF+DRLKS +KGYAS DY  I YR S+L
Sbjct: 428 CQEKRGQFQDMQYLDDTRTTIVYDLPLAEIVYDFFDRLKSSTKGYASLDYEFIGYRPSNL 487

Query: 490 VKLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGGRIIARE 549
           VKL IL+N E +DALS +VH+  + +RGR +CEKLK +IP+Q+F++ IQAAIG R+IARE
Sbjct: 488 VKLDILLNGEVVDALSFIVHKDKAYERGRIVCEKLKEIIPRQLFEVPIQAAIGSRVIARE 547

Query: 550 TVKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISILKTD 604
           T++A RK+V AKCYGGDITRKRKLLEKQKEGKKRM++ GRV++PQ AF+++LK +
Sbjct: 548 TIRAMRKNVLAKCYGGDITRKRKLLEKQKEGKKRMKQVGRVEVPQEAFMAVLKME 602


>gi|261855989|ref|YP_003263272.1| GTP-binding protein LepA [Halothiobacillus neapolitanus c2]
 gi|261836458|gb|ACX96225.1| GTP-binding protein LepA [Halothiobacillus neapolitanus c2]
          Length = 602

 Score =  761 bits (1966), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 360/597 (60%), Positives = 479/597 (80%), Gaps = 2/597 (0%)

Query: 8   LSRIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVR 67
           LS IRNFSI+AHIDHGKSTL+DR IQ C GLT REM  QVLD+MDIERERGITIKAQ+V 
Sbjct: 5   LSLIRNFSIIAHIDHGKSTLSDRIIQLCGGLTAREMDVQVLDSMDIERERGITIKAQSVS 64

Query: 68  LNYTSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQAI 127
           L+YTS   K Y+LN IDTPGHVDF+YEVSRSL+ACEG+LLVVDA+QGVEAQ++AN Y AI
Sbjct: 65  LDYTSRSGKVYRLNFIDTPGHVDFSYEVSRSLAACEGALLVVDASQGVEAQSVANCYTAI 124

Query: 128 DNNHEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERIVQQL 187
           D    ++ VLNK DLPSA+P+RVK++IE+ IGI  E A+L SAKTG GI  +LER+++++
Sbjct: 125 DLGLTVVPVLNKIDLPSAEPERVKQEIEDVIGIDAEHAVLTSAKTGVGIEDVLERLIEEI 184

Query: 188 PSPTSPEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVERIG 247
           P+P   E    PLKAL+IDSW+++Y+GV+ LVR+I+G +   + I+ MGT   +QVE++G
Sbjct: 185 PAPVGIE--EGPLKALIIDSWFDNYVGVVALVRVIDGAIVPKRKIKAMGTGDIFQVEKVG 242

Query: 248 ILTPKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVVFCG 307
           + TPK +  E LY G++G +IA IK +   +VGDT+TD  +  T+ALPGFK +QP VF G
Sbjct: 243 VFTPKTLPREGLYAGDVGFVIAGIKNIDSAKVGDTLTDAENGATAALPGFKEMQPRVFSG 302

Query: 308 LFPVDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERLERE 367
           L+PV+   +ENLR A+ KLRLNDA+  FE E S ALGFGFRCGFLGLLH+EI+QERLERE
Sbjct: 303 LYPVEGEDYENLREALRKLRLNDAALHFEPEVSQALGFGFRCGFLGLLHMEIVQERLERE 362

Query: 368 FSLNLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEYLGSI 427
           + L+LI T+P+VVYE+  +DGS  ++ NP  +P V+ I ELREP I+ +I  P+EY+G++
Sbjct: 363 YDLDLITTAPTVVYEIVENDGSTYRIHNPAQLPNVSNIKELREPIIEASIFCPDEYVGAV 422

Query: 428 LKLCQERRGIQIDMSHLDNRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDYRDS 487
           + LC E+RG+Q ++S+   +  +V+ELPL EV+ DF+DRLKSVS+GYASFDY  + ++D+
Sbjct: 423 IGLCIEKRGVQKNLSYAGKQVTLVFELPLGEVVLDFFDRLKSVSRGYASFDYKFVRFQDA 482

Query: 488 DLVKLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGGRIIA 547
           DLVK+ +L+N E +DALS++VHRS+++ RGR + EKLK LIPQQMF++A+QAAIG +IIA
Sbjct: 483 DLVKMDMLINGEIVDALSLIVHRSIAQGRGRDLSEKLKELIPQQMFEVAVQAAIGAKIIA 542

Query: 548 RETVKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISILKTD 604
           R TVKA RK+V AKCYGGD++RKRKLL+KQK+GKKRM++ G+V++PQ AF+++L+ D
Sbjct: 543 RSTVKALRKNVLAKCYGGDVSRKRKLLDKQKKGKKRMKQIGQVEVPQEAFLAVLQMD 599


>gi|258511967|ref|YP_003185401.1| GTP-binding protein LepA [Alicyclobacillus acidocaldarius subsp.
           acidocaldarius DSM 446]
 gi|257478693|gb|ACV59012.1| GTP-binding protein LepA [Alicyclobacillus acidocaldarius subsp.
           acidocaldarius DSM 446]
          Length = 602

 Score =  761 bits (1965), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 358/595 (60%), Positives = 470/595 (78%), Gaps = 3/595 (0%)

Query: 11  IRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVRLNY 70
           IRNFSI+AHIDHGKSTLADR ++    ++ REM  Q+LD +D+ERERGITIK Q VRLNY
Sbjct: 10  IRNFSIIAHIDHGKSTLADRILEFTGAVSPREMQDQLLDQLDLERERGITIKLQAVRLNY 69

Query: 71  TSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQAIDNN 130
            + D ++Y LNLIDTPGHVDFTYEVSRSL+ACEG+LLVVDA+QGVEAQTLANVY AIDNN
Sbjct: 70  RAKDGQEYVLNLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLANVYLAIDNN 129

Query: 131 HEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERIVQQLPSP 190
            EII V+NK DLPSADP+RVK+QIE+ IG+   DA+L SAK G GI  +LER+V ++P+P
Sbjct: 130 LEIIPVINKIDLPSADPERVKQQIEDVIGLDASDAVLASAKAGIGIEEVLERVVTRIPAP 189

Query: 191 TSPEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVERIGILT 250
           +     +APLKAL+ DS Y+SY GV+V +R+ +G + KG  I++M T+ +++V+ +G+  
Sbjct: 190 SG--DPDAPLKALIFDSHYDSYRGVIVYIRVFDGAIQKGMRIKMMSTDKEFEVDEVGVFR 247

Query: 251 PKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVVFCGLFP 310
           PKM  ++ L  GE+G   ASIK V  TRVGDT+TD   P    LPG++ I P+VFCGL+P
Sbjct: 248 PKMTPVDRLEAGEVGYFAASIKNVRDTRVGDTVTDALRPAAEPLPGYRKINPMVFCGLYP 307

Query: 311 VDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERLEREFSL 370
           VD+  +E+LR A+ KL LNDA+ ++E E S+ALGFGFRCGFLG+LH+EI+QERLERE+ L
Sbjct: 308 VDSADYEDLREALEKLELNDAALTYEPETSSALGFGFRCGFLGMLHMEIVQERLEREYGL 367

Query: 371 NLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEYLGSILKL 430
            LI T+PSVVY +Y  DG+M+++ NP  MP   +I  + EP+++ TI  P EY+G+I++L
Sbjct: 368 TLITTAPSVVYRVYRTDGTMEEIDNPSKMPSPDRIERIEEPFVRATIFAPKEYVGNIMEL 427

Query: 431 CQERRGIQIDMSHLDN-RAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDYRDSDL 489
           CQE+RG   DM +LD+ R  IVY+LPL E+++DF+DRLKS +KGYAS DY  I YR S+L
Sbjct: 428 CQEKRGQFQDMQYLDDTRTTIVYDLPLAEIVYDFFDRLKSSTKGYASLDYEFIGYRPSNL 487

Query: 490 VKLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGGRIIARE 549
           VKL IL+N E +DALS +VH+  + +RGR +CEKLK +IP+Q+F++ IQAAIG R+IARE
Sbjct: 488 VKLDILLNGEAVDALSFIVHKDKAYERGRIVCEKLKEIIPRQLFEVPIQAAIGSRVIARE 547

Query: 550 TVKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISILKTD 604
           T++A RK+V AKCYGGDITRKRKLLEKQKEGKKRM++ GRV++PQ AF+++LK +
Sbjct: 548 TIRAMRKNVLAKCYGGDITRKRKLLEKQKEGKKRMKQVGRVEVPQEAFMAVLKME 602


>gi|322419219|ref|YP_004198442.1| GTP-binding protein LepA [Geobacter sp. M18]
 gi|320125606|gb|ADW13166.1| GTP-binding protein LepA [Geobacter sp. M18]
          Length = 599

 Score =  761 bits (1964), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 358/599 (59%), Positives = 465/599 (77%), Gaps = 3/599 (0%)

Query: 8   LSRIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVR 67
           +  IRNFSI+AHIDHGKSTLADR ++    L+ RE   Q LD MD+ERERGITIKAQTVR
Sbjct: 3   IEHIRNFSIIAHIDHGKSTLADRLLEFTGTLSSREKQDQFLDKMDLERERGITIKAQTVR 62

Query: 68  LNYTSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQAI 127
           LNY + D KDY LNLIDTPGHVDFTYEVSRSL+ACEG LLVVDA+QGVEAQTLANVY A+
Sbjct: 63  LNYRADDGKDYVLNLIDTPGHVDFTYEVSRSLTACEGGLLVVDASQGVEAQTLANVYLAL 122

Query: 128 DNNHEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERIVQQL 187
           D N E+  VLNK DLP+A+P+RVK +IEE IG+ T DA+L SAK G G   +LE IV+++
Sbjct: 123 DANLEVFVVLNKIDLPAAEPERVKAEIEEIIGLDTHDAVLASAKEGIGTKDILEEIVKKI 182

Query: 188 PSPTSPEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVERIG 247
           P P      + PLKALL DSWY+ Y GV++LVR+++G L KG  I+LM     Y+V + G
Sbjct: 183 PPPQG--DPSKPLKALLFDSWYDQYQGVIILVRLVDGTLKKGDKIQLMSNRKTYEVLKAG 240

Query: 248 ILTPKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVVFCG 307
           + +P M +  AL  GE+G +IA I+EV+  +VGDT+T   +P  +ALPG+K ++P+VF G
Sbjct: 241 VFSPDMRETAALSAGEVGFVIAGIREVADAKVGDTVTLLHNPCDAALPGYKEVKPMVFSG 300

Query: 308 LFPVDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERLERE 367
           L+P+D +Q+E LR A+ KL+LND+SFS++ E S ALGFGFRCGFLGLLH+EIIQERLERE
Sbjct: 301 LYPIDTSQYEQLRDALAKLKLNDSSFSYDPETSLALGFGFRCGFLGLLHMEIIQERLERE 360

Query: 368 FSLNLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEYLGSI 427
           F+L LI T+P+VVY ++  DGS+  + +   +P   +IA + EP+I  +I  PN+++G I
Sbjct: 361 FNLELITTAPTVVYRVHGTDGSLINIQSANQLPPTQEIAYVEEPFILASIHVPNDFVGGI 420

Query: 428 LKLCQERRGIQIDMSHLD-NRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDYRD 486
           L LC+E+RG+Q ++ +L   R M+VYELPLNEV+ DFYDRLKS++KGYAS DY ++DYR 
Sbjct: 421 LALCEEKRGVQREIKYLTPTRVMVVYELPLNEVVLDFYDRLKSITKGYASLDYELLDYRQ 480

Query: 487 SDLVKLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGGRII 546
           S+LV+L I++N E +DALS+++H+  +  RGR +  K+K LIP+QMF+IAIQAA+G ++I
Sbjct: 481 SELVRLNIMINGEVVDALSLIIHKDKAYYRGRELVSKMKELIPRQMFEIAIQAAVGTKVI 540

Query: 547 ARETVKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISILKTDN 605
           ARETVKA RKDV AKCYGGDITRKRKLLEKQKEGKKRM+  G V++PQ AF++ILK + 
Sbjct: 541 ARETVKAMRKDVLAKCYGGDITRKRKLLEKQKEGKKRMKNVGNVELPQEAFLAILKVEG 599


>gi|222056368|ref|YP_002538730.1| GTP-binding protein LepA [Geobacter sp. FRC-32]
 gi|254808734|sp|B9M4U5|LEPA_GEOSF RecName: Full=Elongation factor 4; Short=EF-4; AltName:
           Full=Ribosomal back-translocase LepA
 gi|221565657|gb|ACM21629.1| GTP-binding protein LepA [Geobacter sp. FRC-32]
          Length = 599

 Score =  760 bits (1962), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 360/598 (60%), Positives = 467/598 (78%), Gaps = 3/598 (0%)

Query: 8   LSRIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVR 67
           L  IRNFSI+AHIDHGKSTLADR +++   LTEREM +QVLD MD+ERERGITIKAQ VR
Sbjct: 3   LDNIRNFSIIAHIDHGKSTLADRLLEYTGALTEREMQNQVLDKMDLERERGITIKAQAVR 62

Query: 68  LNYTSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQAI 127
           LNY + D + Y LNLIDTPGHVDFTYEVSRSLSACEG+LLVVDA+QGVEAQTLANVY A+
Sbjct: 63  LNYQANDGRQYILNLIDTPGHVDFTYEVSRSLSACEGALLVVDASQGVEAQTLANVYLAL 122

Query: 128 DNNHEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERIVQQL 187
           +N+ ++  VLNK DLP+A+P+RVK++IE+ IG+   DA+L SAK G G   +LE IV ++
Sbjct: 123 ENDLDVFPVLNKIDLPAAEPERVKQEIEDIIGLDAHDAVLASAKEGIGTREILEEIVNKI 182

Query: 188 PSPTSPEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVERIG 247
           P P     A  PLKALL DSWY+ Y GV+VLVRI++G + KG  I+LM     Y+V ++G
Sbjct: 183 PPPRG--DAAKPLKALLFDSWYDQYQGVIVLVRILDGSVKKGDKIQLMSNRRNYEVLKVG 240

Query: 248 ILTPKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVVFCG 307
           + +P M ++ +L  GE+G +I  IK+V   +VGDTIT+  +P  + L GFK +QP+VF G
Sbjct: 241 VFSPAMCEVASLSAGEVGFIIGGIKDVQDAKVGDTITNLHNPCDAPLSGFKEVQPMVFSG 300

Query: 308 LFPVDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERLERE 367
           L+P+D +Q+E LR A+ KL+LND+SFS+E E S ALGFGFRCGFLGLLH+EIIQERLERE
Sbjct: 301 LYPIDTSQYEQLRDALAKLKLNDSSFSYEPETSLALGFGFRCGFLGLLHMEIIQERLERE 360

Query: 368 FSLNLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEYLGSI 427
           F+L+LI T+P+VVY+++  DGS+  + +   +P   +I  + EP+I  +I  PNE++G I
Sbjct: 361 FNLDLITTAPTVVYKVHRLDGSIITIESANQLPPTQEIEFVEEPFILASIHVPNEFVGGI 420

Query: 428 LKLCQERRGIQIDMSHLD-NRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDYRD 486
           L LC+E+RG+Q ++ +L   R MIVYELPLNEV+ DFYDRLKS++KGYAS DY  +DYR 
Sbjct: 421 LALCEEKRGVQREIKYLTPTRVMIVYELPLNEVVLDFYDRLKSITKGYASLDYEHLDYRR 480

Query: 487 SDLVKLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGGRII 546
           S+L +L I++N E +DALS+++H+  +  RGR +  K+K LIP+QMF+IAIQAAIG ++I
Sbjct: 481 SNLERLNIMINGEVVDALSLIIHKEKAYYRGRDLVSKMKELIPRQMFEIAIQAAIGNKVI 540

Query: 547 ARETVKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISILKTD 604
           ARETVKA RKDV AKCYGGDITRKRKLLEKQKEGKKRM+  G V++PQ AF++ILK +
Sbjct: 541 ARETVKALRKDVLAKCYGGDITRKRKLLEKQKEGKKRMKNVGNVELPQEAFLAILKVE 598


>gi|121534796|ref|ZP_01666616.1| GTP-binding protein LepA [Thermosinus carboxydivorans Nor1]
 gi|121306591|gb|EAX47513.1| GTP-binding protein LepA [Thermosinus carboxydivorans Nor1]
          Length = 598

 Score =  759 bits (1961), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 350/597 (58%), Positives = 475/597 (79%), Gaps = 3/597 (0%)

Query: 9   SRIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVRL 68
           S IRNFSI+AHIDHGKSTLADR I++   L+EREM  QVLD +++ERERGITIKAQ VRL
Sbjct: 4   SHIRNFSIIAHIDHGKSTLADRIIEYTGALSEREMEDQVLDQLELERERGITIKAQAVRL 63

Query: 69  NYTSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQAID 128
           NYT+ D + Y LNLIDTPGHVDFTYEVSRSL+ACEG+LLVVDA+QG+EAQTLANVY A++
Sbjct: 64  NYTARDGQTYMLNLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGIEAQTLANVYLALE 123

Query: 129 NNHEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERIVQQLP 188
           +N EII V+NK DLP+ADP++VK++IE+ IG+   +A+LVSAK G GI  +LE I++++P
Sbjct: 124 HNLEIIPVINKIDLPNADPEKVKQEIEDVIGLDASEAVLVSAKAGIGIEDVLEAIIKKIP 183

Query: 189 SPTSPEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVERIGI 248
            P +   A  PL+AL+ DS ++SY GV+  VR+++G++  G  I++M T+ K++V  +G+
Sbjct: 184 PPRT--DATKPLRALIFDSHFDSYKGVIAYVRVMDGKIVPGMKIKMMATDKKFEVTEVGV 241

Query: 249 LTPKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVVFCGL 308
             P + +++ L PGE+G + ASIK V  TRVGDTITD  +P T  LPG++ I P+V+CGL
Sbjct: 242 FRPYLANVDELGPGEVGFVAASIKNVKDTRVGDTITDADNPATEPLPGYRKITPMVYCGL 301

Query: 309 FPVDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERLEREF 368
           +PVD++ ++ LR A+ KL+LNDAS  FE E S ALGFGFRCGFLGLLH+++IQERLERE+
Sbjct: 302 YPVDSSDYDALRDALEKLKLNDASLVFEPETSVALGFGFRCGFLGLLHMDVIQERLEREY 361

Query: 369 SLNLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEYLGSIL 428
           +L LI T+P+V+Y++Y  +G +  + NP  +P   +I  + EP+++ +II PN+Y+G+++
Sbjct: 362 NLTLITTAPNVIYKVYKTNGEILDIDNPARLPTPQEIDHIEEPYVRASIIVPNDYVGAVM 421

Query: 429 KLCQERRGIQIDMSHLD-NRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDYRDS 487
           +L QE+RG   DM +LD  R M+ YELPL+E+I+D++DRLKS ++GYAS DY +I YR S
Sbjct: 422 ELSQEKRGEFKDMRYLDMTRVMLTYELPLSEIIYDYFDRLKSATRGYASLDYELIGYRAS 481

Query: 488 DLVKLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGGRIIA 547
           +LVKL IL+N + +DALS++VHR  ++ RGR + EKLK +IP+QMF+I IQAAIG ++IA
Sbjct: 482 NLVKLDILLNGDPVDALSVIVHRDRAQARGRQLVEKLKEIIPRQMFEIPIQAAIGNKVIA 541

Query: 548 RETVKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISILKTD 604
           RETV+A RKDV AKCYGGDITRKRKLLEKQKEGKKRM++ G V++PQ AF++ILK D
Sbjct: 542 RETVRALRKDVLAKCYGGDITRKRKLLEKQKEGKKRMKQVGSVEVPQEAFMAILKMD 598


>gi|114320500|ref|YP_742183.1| GTP-binding protein LepA [Alkalilimnicola ehrlichii MLHE-1]
 gi|119371326|sp|Q0A8Z4|LEPA_ALHEH RecName: Full=Elongation factor 4; Short=EF-4; AltName:
           Full=Ribosomal back-translocase LepA
 gi|114226894|gb|ABI56693.1| GTP-binding protein LepA [Alkalilimnicola ehrlichii MLHE-1]
          Length = 627

 Score =  759 bits (1961), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 352/600 (58%), Positives = 469/600 (78%), Gaps = 4/600 (0%)

Query: 8   LSRIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVR 67
           ++RIRNFSI+AHIDHGKSTLADRFIQH   L+ REM+ QVLD+MD+ERERGITIKAQ+V 
Sbjct: 29  MNRIRNFSIIAHIDHGKSTLADRFIQHSGALSNREMAEQVLDSMDLERERGITIKAQSVS 88

Query: 68  LNYTSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQAI 127
           L Y + D + Y+LN IDTPGHVDF+YEVSRSL ACEG+LLVVDA+QGVEAQ++AN Y A+
Sbjct: 89  LEYRAKDGQTYELNFIDTPGHVDFSYEVSRSLFACEGALLVVDASQGVEAQSVANCYTAV 148

Query: 128 DNNHEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERIVQQL 187
           D   EII VLNK DLPS+DP RV +QIEE IG+  E+AL +SAKTGEGI  LLE +VQ++
Sbjct: 149 DQGLEIIPVLNKIDLPSSDPQRVIQQIEEIIGLDGEEALKISAKTGEGIEELLEALVQRV 208

Query: 188 PSPTS-PEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVERI 246
           P+P   PE A   LKAL+IDSW+++YLGV+ LVR+ +G L KG  IR+M T  ++QV+ +
Sbjct: 209 PAPKGDPEAA---LKALIIDSWFDNYLGVVALVRVFDGALKKGDRIRVMSTGREFQVDEL 265

Query: 247 GILTPKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVVFC 306
           G  TPK +  + L  G++G ++A IK++    VGDT+T    P  S +PGFK +QP VF 
Sbjct: 266 GFFTPKRVLRDRLDTGQVGFVVAGIKDIDGAPVGDTLTSAQKPADSPVPGFKKVQPRVFA 325

Query: 307 GLFPVDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERLER 366
           G+FP  +  FEN RTA+ KLRLNDAS  FE E S ALGFGFRCGFLG+LH+EI+QERLER
Sbjct: 326 GVFPTSSDDFENFRTALEKLRLNDASLHFEPETSQALGFGFRCGFLGMLHMEIVQERLER 385

Query: 367 EFSLNLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEYLGS 426
           E+ L+LI T+P+VV+E+   DG    + NP ++P   KI ++REP I  +I+ P E++G+
Sbjct: 386 EYGLDLITTAPTVVHEVLTTDGETLYIHNPSELPAPNKIEDIREPIIAASILVPEEHVGN 445

Query: 427 ILKLCQERRGIQIDMSHLDNRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDYRD 486
           ++KLC E+RG+Q +M ++ N+  +VYE+P+ EV+ DF+DRLKSVS+G+ASFDY    ++ 
Sbjct: 446 VIKLCVEKRGVQKEMQYVGNQISLVYEMPMGEVVLDFFDRLKSVSRGFASFDYEFKRFQS 505

Query: 487 SDLVKLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGGRII 546
           +DLVK+ +L+N + +DAL+++VHR  ++ RGR + +KLK +IP+QMF++AIQAAIG  +I
Sbjct: 506 ADLVKVDVLINGDKVDALAVIVHRDQAQSRGRELTDKLKEIIPRQMFEVAIQAAIGNHVI 565

Query: 547 ARETVKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISILKTDNE 606
           AR TVKA RK+VTAKCYGGDI+RKRKLLEKQK GKKRM++ G+V+IPQ AF+++L+ DN+
Sbjct: 566 ARSTVKALRKNVTAKCYGGDISRKRKLLEKQKAGKKRMKQVGKVEIPQEAFLAVLQVDNK 625


>gi|197118266|ref|YP_002138693.1| GTP-binding protein LepA [Geobacter bemidjiensis Bem]
 gi|238690864|sp|B5EB36|LEPA_GEOBB RecName: Full=Elongation factor 4; Short=EF-4; AltName:
           Full=Ribosomal back-translocase LepA
 gi|197087626|gb|ACH38897.1| membrane GTPase LepA [Geobacter bemidjiensis Bem]
          Length = 599

 Score =  759 bits (1959), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 355/599 (59%), Positives = 465/599 (77%), Gaps = 3/599 (0%)

Query: 8   LSRIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVR 67
           +  IRNFSI+AHIDHGKSTLADR ++    ++ RE   Q LD MD+ERERGITIKAQTVR
Sbjct: 3   IEHIRNFSIIAHIDHGKSTLADRLLEFTGTVSAREKQDQFLDKMDLERERGITIKAQTVR 62

Query: 68  LNYTSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQAI 127
           LNY + D KDY LNLIDTPGHVDFTYEVSRSL+ACEG LLVVDA+QGVEAQTLANVY A+
Sbjct: 63  LNYRADDGKDYILNLIDTPGHVDFTYEVSRSLTACEGGLLVVDASQGVEAQTLANVYLAL 122

Query: 128 DNNHEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERIVQQL 187
           D N E+  VLNK DLP+A+P+RVK +IEE IG+ T DA+L SAK G G   +LE IV+++
Sbjct: 123 DANLEVFVVLNKIDLPAAEPERVKAEIEEIIGLDTHDAVLASAKEGIGTKDILEEIVKKI 182

Query: 188 PSPTSPEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVERIG 247
           P P     A  P+KALL DSWY+ Y GV++LVR+++G + KG  I+LM     Y+V + G
Sbjct: 183 PPPKG--DATKPMKALLFDSWYDQYQGVIILVRLVDGTVKKGDKIQLMSNRKSYEVLKAG 240

Query: 248 ILTPKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVVFCG 307
           + +P+M +   L  GE+G +IA I+EV+  +VGDT+T   +P  +ALPG+K ++P+VF G
Sbjct: 241 VFSPEMRETPMLSAGEVGFIIAGIREVADAKVGDTVTLLHNPCDAALPGYKEVKPMVFSG 300

Query: 308 LFPVDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERLERE 367
           L+P+D +Q+E LR A+ KL+LND+SFS++ E S ALGFGFRCGFLGLLH+EIIQERLERE
Sbjct: 301 LYPIDTSQYEQLRDALAKLKLNDSSFSYDPETSLALGFGFRCGFLGLLHMEIIQERLERE 360

Query: 368 FSLNLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEYLGSI 427
           F+L LI T+P+VVY ++  DGS+  + +   +P   +IA + EP+I  +I  PN+++G I
Sbjct: 361 FNLELITTAPTVVYRVHGTDGSLTSIQSANQLPPTQEIAYVEEPFILASIHVPNDFVGGI 420

Query: 428 LKLCQERRGIQIDMSHLD-NRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDYRD 486
           L LC+E+RG+Q ++ +L   R M+VYELPLNEV+ DFYDRLKS++KGYAS DY ++DYR 
Sbjct: 421 LALCEEKRGVQREIKYLTPTRVMVVYELPLNEVVLDFYDRLKSITKGYASLDYELLDYRQ 480

Query: 487 SDLVKLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGGRII 546
           S+LV+L I++N E +DALS+++H+  +  RGR +  K+K LIP+QMF+IAIQAA+G ++I
Sbjct: 481 SELVRLNIMINGEVVDALSLIIHKDKAYYRGRELVSKMKELIPRQMFEIAIQAAVGTKVI 540

Query: 547 ARETVKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISILKTDN 605
           ARETVKA RKDV AKCYGGDITRKRKLLEKQKEGKKRM+  G V++PQ AF++ILK + 
Sbjct: 541 ARETVKAMRKDVLAKCYGGDITRKRKLLEKQKEGKKRMKNVGNVELPQEAFLAILKVEG 599


>gi|119371353|sp|Q39US7|LEPA_GEOMG RecName: Full=Elongation factor 4; Short=EF-4; AltName:
           Full=Ribosomal back-translocase LepA
          Length = 599

 Score =  758 bits (1958), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 359/598 (60%), Positives = 462/598 (77%), Gaps = 3/598 (0%)

Query: 8   LSRIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVR 67
           +  IRNFSI+AHIDHGKSTLADR +++   L+ERE   Q LD MD+ERERGITIKAQTVR
Sbjct: 3   IENIRNFSIIAHIDHGKSTLADRLLEYTGALSERERQDQFLDKMDLERERGITIKAQTVR 62

Query: 68  LNYTSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQAI 127
           LNY + D KDY LNLIDTPGHVDFTYEVSRSL+ACEG LLVVDA+QGVEAQTLANVY AI
Sbjct: 63  LNYRADDGKDYVLNLIDTPGHVDFTYEVSRSLAACEGGLLVVDASQGVEAQTLANVYLAI 122

Query: 128 DNNHEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERIVQQL 187
           DNN E+  VLNK DLP+A+P+RVK +IEE IG+   DA+L SAK G G   +LE IV+++
Sbjct: 123 DNNLEVFPVLNKIDLPAAEPERVKHEIEEIIGLDAHDAVLASAKEGIGTREILEEIVKKI 182

Query: 188 PSPTSPEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVERIG 247
           P P     A  PLKALL DSWY+ Y GV++L R+I+G L KG  I+L+ T   Y+  ++G
Sbjct: 183 PPPEGDPAA--PLKALLFDSWYDQYQGVIILARLIDGILKKGDKIQLVSTGRSYEALKVG 240

Query: 248 ILTPKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVVFCG 307
           +  P M ++  L  GE+G +IA IK+V+  ++GDT+T    P T+ L GFK ++P+VF G
Sbjct: 241 VFAPVMREVPQLSAGEVGFVIAGIKDVADAKIGDTVTHTLKPCTTPLGGFKEVKPMVFSG 300

Query: 308 LFPVDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERLERE 367
           L+P+D +Q+E LR A+ KL+LND+SFS+E E S ALGFGFRCGFLGLLH+EIIQERLERE
Sbjct: 301 LYPIDTSQYEQLRDALAKLKLNDSSFSYEPETSLALGFGFRCGFLGLLHMEIIQERLERE 360

Query: 368 FSLNLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEYLGSI 427
           F+L+LI T+P+VVY ++   G M  + +   +P   +I  + EP+I  +I TPNE++G I
Sbjct: 361 FNLDLITTAPTVVYRVHRIKGDMISIESANQLPPTQEIDYVEEPFILASIHTPNEFVGGI 420

Query: 428 LKLCQERRGIQIDMSHLD-NRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDYRD 486
           L LC+E+RG+Q ++ +L   R MI+YELPLNEV+ DFYDRLKS++KGYAS DY  +DYR 
Sbjct: 421 LALCEEKRGVQREIKYLTPTRVMIIYELPLNEVVLDFYDRLKSITKGYASLDYEHLDYRR 480

Query: 487 SDLVKLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGGRII 546
           S+LV++ I++N E +DALS+++HR  +  RGR +  K+K LIP+QMF++AIQAAIG ++I
Sbjct: 481 SELVRMNIMINGEVVDALSLIIHRDKAYYRGRDLVSKMKELIPRQMFEVAIQAAIGAKVI 540

Query: 547 ARETVKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISILKTD 604
           ARETVKA RKDV AKCYGGDITRKRKLLEKQKEGKKRM+  G V++PQ AF++ILK +
Sbjct: 541 ARETVKALRKDVLAKCYGGDITRKRKLLEKQKEGKKRMKNVGNVELPQEAFLAILKVE 598


>gi|78222975|ref|YP_384722.1| GTP-binding protein LepA [Geobacter metallireducens GS-15]
 gi|78194230|gb|ABB31997.1| GTP-binding protein LepA [Geobacter metallireducens GS-15]
          Length = 629

 Score =  758 bits (1958), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 359/598 (60%), Positives = 462/598 (77%), Gaps = 3/598 (0%)

Query: 8   LSRIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVR 67
           +  IRNFSI+AHIDHGKSTLADR +++   L+ERE   Q LD MD+ERERGITIKAQTVR
Sbjct: 33  IENIRNFSIIAHIDHGKSTLADRLLEYTGALSERERQDQFLDKMDLERERGITIKAQTVR 92

Query: 68  LNYTSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQAI 127
           LNY + D KDY LNLIDTPGHVDFTYEVSRSL+ACEG LLVVDA+QGVEAQTLANVY AI
Sbjct: 93  LNYRADDGKDYVLNLIDTPGHVDFTYEVSRSLAACEGGLLVVDASQGVEAQTLANVYLAI 152

Query: 128 DNNHEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERIVQQL 187
           DNN E+  VLNK DLP+A+P+RVK +IEE IG+   DA+L SAK G G   +LE IV+++
Sbjct: 153 DNNLEVFPVLNKIDLPAAEPERVKHEIEEIIGLDAHDAVLASAKEGIGTREILEEIVKKI 212

Query: 188 PSPTSPEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVERIG 247
           P P     A  PLKALL DSWY+ Y GV++L R+I+G L KG  I+L+ T   Y+  ++G
Sbjct: 213 PPPEGDPAA--PLKALLFDSWYDQYQGVIILARLIDGILKKGDKIQLVSTGRSYEALKVG 270

Query: 248 ILTPKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVVFCG 307
           +  P M ++  L  GE+G +IA IK+V+  ++GDT+T    P T+ L GFK ++P+VF G
Sbjct: 271 VFAPVMREVPQLSAGEVGFVIAGIKDVADAKIGDTVTHTLKPCTTPLGGFKEVKPMVFSG 330

Query: 308 LFPVDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERLERE 367
           L+P+D +Q+E LR A+ KL+LND+SFS+E E S ALGFGFRCGFLGLLH+EIIQERLERE
Sbjct: 331 LYPIDTSQYEQLRDALAKLKLNDSSFSYEPETSLALGFGFRCGFLGLLHMEIIQERLERE 390

Query: 368 FSLNLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEYLGSI 427
           F+L+LI T+P+VVY ++   G M  + +   +P   +I  + EP+I  +I TPNE++G I
Sbjct: 391 FNLDLITTAPTVVYRVHRIKGDMISIESANQLPPTQEIDYVEEPFILASIHTPNEFVGGI 450

Query: 428 LKLCQERRGIQIDMSHLD-NRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDYRD 486
           L LC+E+RG+Q ++ +L   R MI+YELPLNEV+ DFYDRLKS++KGYAS DY  +DYR 
Sbjct: 451 LALCEEKRGVQREIKYLTPTRVMIIYELPLNEVVLDFYDRLKSITKGYASLDYEHLDYRR 510

Query: 487 SDLVKLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGGRII 546
           S+LV++ I++N E +DALS+++HR  +  RGR +  K+K LIP+QMF++AIQAAIG ++I
Sbjct: 511 SELVRMNIMINGEVVDALSLIIHRDKAYYRGRDLVSKMKELIPRQMFEVAIQAAIGAKVI 570

Query: 547 ARETVKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISILKTD 604
           ARETVKA RKDV AKCYGGDITRKRKLLEKQKEGKKRM+  G V++PQ AF++ILK +
Sbjct: 571 ARETVKALRKDVLAKCYGGDITRKRKLLEKQKEGKKRMKNVGNVELPQEAFLAILKVE 628


>gi|300311258|ref|YP_003775350.1| GTP-binding elongation factor protein [Herbaspirillum seropedicae
           SmR1]
 gi|300074043|gb|ADJ63442.1| GTP-binding elongation factor protein [Herbaspirillum seropedicae
           SmR1]
          Length = 597

 Score =  758 bits (1957), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 356/600 (59%), Positives = 464/600 (77%), Gaps = 4/600 (0%)

Query: 8   LSRIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVR 67
           ++ IRNFSI+AHIDHGKSTLADR IQ C GL+ REM +QVLD+MDIERERGITIKAQT  
Sbjct: 1   MNNIRNFSIIAHIDHGKSTLADRIIQLCGGLSNREMEAQVLDSMDIERERGITIKAQTAA 60

Query: 68  LNYTSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQAI 127
           L+Y + D + Y LNLIDTPGHVDF+YEVSRSLSACEG+LLVVDA+QGVEAQT+AN Y A+
Sbjct: 61  LSYKAKDGQIYNLNLIDTPGHVDFSYEVSRSLSACEGALLVVDASQGVEAQTVANCYTAL 120

Query: 128 DNNHEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERIVQQL 187
           D   E++ VLNK DLPSADPD  K +IE+ IGI   DA   SAKTG G+  +LE IV ++
Sbjct: 121 DLGVEVVPVLNKIDLPSADPDNAKSEIEDVIGIDASDATPCSAKTGLGVEDVLEAIVAKV 180

Query: 188 PSPTS-PEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVERI 246
           P+P   PE   APL+AL+IDSW+++Y+GV++LVRI+NG L     I LM T  +Y  E I
Sbjct: 181 PAPKGDPE---APLQALIIDSWFDNYVGVVMLVRIVNGTLRPKDKILLMATETQYLTESI 237

Query: 247 GILTPKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVVFC 306
           G+ TPK    EAL  G++G +IA IKE+   RVGDTIT  S P  + LPGFK +QP VF 
Sbjct: 238 GVFTPKSQSREALTAGQVGFVIAGIKELKSARVGDTITLASKPAPAPLPGFKEVQPQVFA 297

Query: 307 GLFPVDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERLER 366
           GLFPV+A Q++ LR ++ KL+LNDA+  +E E S ALGFGFRCGFLGLLH+EI+QERLER
Sbjct: 298 GLFPVEANQYDALRDSLEKLKLNDAALMYEPEVSQALGFGFRCGFLGLLHMEIVQERLER 357

Query: 367 EFSLNLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEYLGS 426
           EF ++LI T+P+VVYE+   DG++  + NP  MPEV+KI E+REP + V +  P EY+GS
Sbjct: 358 EFDMDLITTAPTVVYEVQQRDGTLLMVDNPSKMPEVSKIEEIREPIVTVNLYMPQEYVGS 417

Query: 427 ILKLCQERRGIQIDMSHLDNRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDYRD 486
           ++ LC ++RGIQ++MS+   +  + YE+P+ E++ DF+DRLKS S+GYAS DY   +YR 
Sbjct: 418 VITLCTQKRGIQMNMSYHGKQVQLTYEMPMAEIVLDFFDRLKSTSRGYASMDYEFKEYRA 477

Query: 487 SDLVKLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGGRII 546
           +D+VK+ +L+N+E +DAL+I+VHR+ ++ RGR +  K++ LIP+QMF +AIQAAIG  II
Sbjct: 478 ADVVKVDMLINSEKVDALAIIVHRAAAQIRGRQVAAKMRELIPRQMFDVAIQAAIGATII 537

Query: 547 ARETVKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISILKTDNE 606
           +RE VKA RK+V AKCYGGDI+RKRKLLEKQK GKKRM++ G V+IPQ AF++IL+ +++
Sbjct: 538 SRENVKAMRKNVLAKCYGGDISRKRKLLEKQKAGKKRMKQVGSVEIPQEAFLAILQVEDK 597


>gi|237748855|ref|ZP_04579335.1| GTP-binding protein lepA [Oxalobacter formigenes OXCC13]
 gi|229380217|gb|EEO30308.1| GTP-binding protein lepA [Oxalobacter formigenes OXCC13]
          Length = 597

 Score =  757 bits (1955), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 352/600 (58%), Positives = 466/600 (77%), Gaps = 4/600 (0%)

Query: 8   LSRIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVR 67
           +  IRNFSI+AHIDHGKSTLADR IQ C GL++REM +QVLD+MD+ERERGITIKAQT  
Sbjct: 1   MKNIRNFSIIAHIDHGKSTLADRIIQLCGGLSDREMEAQVLDSMDLERERGITIKAQTAA 60

Query: 68  LNYTSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQAI 127
           LNY + D + Y LNLIDTPGHVDF+YEVSRSLSACEG+LLVVDA+QGVEAQT+AN Y A+
Sbjct: 61  LNYKARDGQVYNLNLIDTPGHVDFSYEVSRSLSACEGALLVVDASQGVEAQTVANCYTAL 120

Query: 128 DNNHEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERIVQQL 187
           D N E++ VLNK DLPSADPD  K +IE+ IGI + DA+L SAKTG G+  +LE I+ ++
Sbjct: 121 DLNVEVVPVLNKIDLPSADPDNAKSEIEDVIGIDSSDAVLASAKTGLGVEDILESIIAKI 180

Query: 188 PSPTSPEG-ANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVERI 246
           P P   EG   APL+AL+IDSW+++Y+GV++LVRI NG L     IRLM T ++Y  E I
Sbjct: 181 PPP---EGDPAAPLQALIIDSWFDNYVGVVMLVRIKNGTLKPKDRIRLMATGSEYLAESI 237

Query: 247 GILTPKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVVFC 306
           G+ +P+ +  ++L  G++G +IA IKE++  +VGDTIT  S P +  LPGFK +QP VF 
Sbjct: 238 GVFSPRSVSKDSLSAGQVGFIIAGIKELTAAKVGDTITLASRPASEPLPGFKEVQPQVFA 297

Query: 307 GLFPVDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERLER 366
           GLFPV+A Q++ LR ++ KL+LNDAS  +E E S ALGFGFRCGFLGLLH+EI+QERLER
Sbjct: 298 GLFPVEANQYDALRDSLEKLKLNDASLQYEPEVSQALGFGFRCGFLGLLHMEIVQERLER 357

Query: 367 EFSLNLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEYLGS 426
           EF ++LI T+P+VVYE+ + +G M  + NP  MP+  +I E+REP + V +  P EY+G 
Sbjct: 358 EFGMDLITTAPTVVYEVILKNGDMLMVDNPSKMPDPARIEEVREPIVTVNLYMPQEYVGP 417

Query: 427 ILKLCQERRGIQIDMSHLDNRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDYRD 486
           I+ LC ++RGIQ+DM +   +  +VYELP+ E++ DF+D++KS+S+GYAS +Y   +YR 
Sbjct: 418 IMTLCNQKRGIQMDMHYHGKQVRLVYELPMAEIVLDFFDKMKSISRGYASMEYEFKEYRS 477

Query: 487 SDLVKLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGGRII 546
           SD+VK+ +L+N + +DAL+I+VHR+ S+ RGR +  K++ LIP+QMF +AIQAAIG  II
Sbjct: 478 SDVVKVDMLINGDKVDALAIIVHRANSQYRGRAVAAKMRELIPRQMFDVAIQAAIGSTII 537

Query: 547 ARETVKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISILKTDNE 606
           +RE VKA RK+V AKCYGGDITRKRKLLEKQK GKKRM++ G V++PQ AF++IL+ D +
Sbjct: 538 SRENVKALRKNVLAKCYGGDITRKRKLLEKQKAGKKRMKQVGSVEVPQEAFLAILQVDEK 597


>gi|39996368|ref|NP_952319.1| GTP-binding protein LepA [Geobacter sulfurreducens PCA]
 gi|46396178|sp|P60789|LEPA_GEOSL RecName: Full=Elongation factor 4; Short=EF-4; AltName:
           Full=Ribosomal back-translocase LepA
 gi|39983248|gb|AAR34642.1| GTP-binding protein LepA [Geobacter sulfurreducens PCA]
 gi|298505378|gb|ADI84101.1| membrane GTPase LepA [Geobacter sulfurreducens KN400]
          Length = 600

 Score =  757 bits (1955), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 357/597 (59%), Positives = 462/597 (77%), Gaps = 3/597 (0%)

Query: 11  IRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVRLNY 70
           IRNFSI+AHIDHGKSTLADR +++   LTEREM  Q LD MD+ERERGITIKAQTVRL Y
Sbjct: 6   IRNFSIIAHIDHGKSTLADRLLEYTGALTEREMQDQFLDKMDLERERGITIKAQTVRLTY 65

Query: 71  TSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQAIDNN 130
            + D  DY LNLIDTPGHVDFTYEVSRSL+ACEG+LLVVDA+QGVEAQTLANVY AIDNN
Sbjct: 66  RADDGNDYILNLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTLANVYLAIDNN 125

Query: 131 HEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERIVQQLPSP 190
            E+  VLNK DLP+A+P+RVK +IEE IG+   DA++ SAK G G   +LE IV+++P P
Sbjct: 126 LEVFPVLNKIDLPAAEPERVKHEIEEIIGLDAHDAVMASAKEGIGTREILEEIVKKIPPP 185

Query: 191 TSPEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVERIGILT 250
                A  PLKALL DSWY+ Y GV++LVR+I+G + KG  I+L+ T   Y+  ++G+  
Sbjct: 186 EGDPAA--PLKALLFDSWYDQYQGVIILVRVIDGTVKKGDKIQLVSTGRSYEALKVGVFA 243

Query: 251 PKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVVFCGLFP 310
           P M ++  L  GE+G +IA IK+V+  ++GDT+T    P  + L GFK ++P+VF GL+P
Sbjct: 244 PVMREVPQLAAGEVGFLIAGIKDVADAKIGDTVTHALKPCVTPLGGFKEVKPMVFSGLYP 303

Query: 311 VDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERLEREFSL 370
           +D  Q+E LR A+ KL+LND+SFSFE E S ALGFGFRCGFLGLLH+EIIQERLEREF+L
Sbjct: 304 IDTAQYEQLRDALAKLKLNDSSFSFEPETSLALGFGFRCGFLGLLHMEIIQERLEREFNL 363

Query: 371 NLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEYLGSILKL 430
           +LI T+P+VVY+++   G +  + +   +P + +I  + EP+I  +I TPNE++G IL L
Sbjct: 364 DLITTAPTVVYKVHRIKGDVITIESANQLPPLQEIDYIEEPFILASIHTPNEFVGGILSL 423

Query: 431 CQERRGIQIDMSHLD-NRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDYRDSDL 489
           C+E+RG+Q ++ +L   R MI+YELPLNEV+ DFYDRLKS++KGYAS DY  ++YR SDL
Sbjct: 424 CEEKRGVQREIKYLTPTRVMIIYELPLNEVVLDFYDRLKSITKGYASLDYEHLNYRRSDL 483

Query: 490 VKLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGGRIIARE 549
           V++ IL+N E +DALS+++HR  +  RGR +  K+K LIP+QMF++ IQAAIG ++IARE
Sbjct: 484 VRMNILINGEAVDALSLIIHRDKAYYRGRDLVSKMKELIPRQMFEVVIQAAIGAKVIARE 543

Query: 550 TVKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISILKTDNE 606
           TVKA RKDV AKCYGGDITRKRKLLEKQKEGKKRM+  G V++PQ AF++ILK + +
Sbjct: 544 TVKALRKDVLAKCYGGDITRKRKLLEKQKEGKKRMKNVGNVELPQEAFLAILKVEEK 600


>gi|54294757|ref|YP_127172.1| GTP-binding protein LepA [Legionella pneumophila str. Lens]
 gi|81601292|sp|Q5WVI1|LEPA_LEGPL RecName: Full=Elongation factor 4; Short=EF-4; AltName:
           Full=Ribosomal back-translocase LepA
 gi|53754589|emb|CAH16073.1| hypothetical protein lpl1834 [Legionella pneumophila str. Lens]
          Length = 610

 Score =  757 bits (1955), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 354/599 (59%), Positives = 464/599 (77%), Gaps = 2/599 (0%)

Query: 8   LSRIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVR 67
           L+RIRNFSI+AHIDHGKSTLADRFIQ C GLTEREMSSQVLD+MDIERERGITIKAQ V 
Sbjct: 13  LNRIRNFSIIAHIDHGKSTLADRFIQICGGLTEREMSSQVLDSMDIERERGITIKAQCVS 72

Query: 68  LNYTSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQAI 127
           LNYT+TD K Y LN IDTPGHVDF+YEVSRSL+ACEG++LVVDA QGVEAQTLA  Y AI
Sbjct: 73  LNYTATDGKTYLLNFIDTPGHVDFSYEVSRSLAACEGAILVVDAAQGVEAQTLAVCYTAI 132

Query: 128 DNNHEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERIVQQL 187
           D +  ++ VLNK DLP A+P+RV  +IE+ IG+  +DA+ VSAK+G G+  +LE +V  +
Sbjct: 133 DQSLTVLPVLNKIDLPQAEPERVISEIEDIIGLDAQDAIRVSAKSGLGVNDVLEALVANI 192

Query: 188 PSPTSPEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVERIG 247
           P P      +APL+AL+IDSW++SYLGV+ LVRI+NG + KG  +R+M T   Y+V+++G
Sbjct: 193 PPPKG--DVHAPLQALIIDSWFDSYLGVVSLVRIVNGSIRKGDKMRVMSTGRAYEVDQVG 250

Query: 248 ILTPKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVVFCG 307
           I TPK   ++ALY GE+G ++A IKE+    VGDT+T D +P    LPGF+ ++P V+ G
Sbjct: 251 IFTPKRTKLDALYAGEVGYVVAGIKEIQGAPVGDTLTLDRNPADKVLPGFQRVKPQVYAG 310

Query: 308 LFPVDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERLERE 367
           LFPV +  FE  R A+ KL LNDAS  +E E+S ALGFGFRCGFLG+LH+EIIQERLERE
Sbjct: 311 LFPVSSDDFEAFREALAKLSLNDASLFYEPESSEALGFGFRCGFLGMLHMEIIQERLERE 370

Query: 368 FSLNLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEYLGSI 427
           ++L+LI T+P+VVY++    G    + NP  +P   +I E+ EP ++  I+ P +YLG I
Sbjct: 371 YNLDLISTAPTVVYQIVTQKGETLLIDNPSHLPPTPQIKEMYEPIVRANILVPQDYLGPI 430

Query: 428 LKLCQERRGIQIDMSHLDNRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDYRDS 487
           + LC ERRG+Q+ M++      +VY++P++EV+ DF+DRLKSVS+GYAS DYN   ++ +
Sbjct: 431 ITLCVERRGVQVSMTYSGRHVSVVYDIPMSEVVSDFFDRLKSVSRGYASLDYNFQRFQIA 490

Query: 488 DLVKLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGGRIIA 547
           DLVK+ IL+N+E +DAL+++VHR  +  RG+ I EK++ LIP+QMF +AIQAAIG  IIA
Sbjct: 491 DLVKMDILINSERVDALAVIVHRDSAHSRGKLIAEKMQQLIPRQMFDVAIQAAIGSHIIA 550

Query: 548 RETVKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISILKTDNE 606
           R+TVKA RK+VTAKCYGGD+TRKRKLLEKQK GKKRM++ G V+IPQ AF+++ +TD +
Sbjct: 551 RQTVKALRKNVTAKCYGGDVTRKRKLLEKQKAGKKRMKQVGHVEIPQEAFMAVFQTDKK 609


>gi|317486176|ref|ZP_07945015.1| GTP-binding protein LepA [Bilophila wadsworthia 3_1_6]
 gi|316922567|gb|EFV43814.1| GTP-binding protein LepA [Bilophila wadsworthia 3_1_6]
          Length = 601

 Score =  757 bits (1954), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 358/597 (59%), Positives = 463/597 (77%), Gaps = 3/597 (0%)

Query: 11  IRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVRLNY 70
           IRNFSI+AHIDHGKSTLADR ++    ++ERE   Q LD MDIERERGITIKAQ+VR+ Y
Sbjct: 7   IRNFSIIAHIDHGKSTLADRILEITGLVSEREKRDQYLDRMDIERERGITIKAQSVRIPY 66

Query: 71  TSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQAIDNN 130
            S + K Y LNLIDTPGHVDF YEVSRSL+ACEG+LLVVDATQGVEAQTLANVY A+D+N
Sbjct: 67  KSKNGKQYLLNLIDTPGHVDFNYEVSRSLAACEGALLVVDATQGVEAQTLANVYLALDHN 126

Query: 131 HEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERIVQQLPSP 190
           HEII VLNK DLPS+D +RVK +IEE IG+    AL VSAKTG+G+P +LE IV++LP+P
Sbjct: 127 HEIIPVLNKIDLPSSDVERVKSEIEEDIGLDCSKALPVSAKTGDGVPDVLEAIVERLPAP 186

Query: 191 TSPEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVERIGILT 250
                 NAPLKAL+ DSWY+SY GV+V+ RI++G L KG  I L  T   Y+V R+G+ +
Sbjct: 187 EG--NPNAPLKALIFDSWYDSYQGVVVMFRIMDGTLRKGDKIELFATKKTYEVIRLGVFS 244

Query: 251 PKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVVFCGLFP 310
           P+  D++ L  GE+G +  +IKE+   +VGDTIT    P   A+PGFK ++ VVFCGL+P
Sbjct: 245 PESRDMDQLSAGEVGFLCGNIKELGDAKVGDTITLAERPCAEAVPGFKEVKAVVFCGLYP 304

Query: 311 VDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERLEREFSL 370
            D + +E L+ A+ KL+LNDA+FS+E E S ALGFGFRCGFLGLLH+EIIQERLEREF +
Sbjct: 305 SDPSDYEQLKFALEKLQLNDAAFSWEPETSQALGFGFRCGFLGLLHMEIIQERLEREFQV 364

Query: 371 NLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEYLGSILKL 430
           +LI T+PSV+Y +   DG   ++ NP  +P+  +I  L EP++++ I  P++Y+G+++KL
Sbjct: 365 DLIATAPSVIYRVETTDGKTTEIDNPSKLPDPARITNLYEPYVRIDIHVPSDYVGNVMKL 424

Query: 431 CQERRGIQIDMSHL-DNRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDYRDSDL 489
           C+E+RGIQ +M +L  NR +I YELP  E++FDF+DRLKS ++GYAS DY VIDYR S+L
Sbjct: 425 CEEKRGIQKNMGYLAQNRVVITYELPFAEIVFDFFDRLKSATRGYASMDYEVIDYRASNL 484

Query: 490 VKLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGGRIIARE 549
           V+L IL+N E +DAL+++VH+  S   GR +  KLK  IP+QMF++AIQAAIG ++IARE
Sbjct: 485 VRLDILLNGEAVDALAVIVHKDKSYAYGRALALKLKRTIPRQMFEVAIQAAIGQKVIARE 544

Query: 550 TVKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISILKTDNE 606
           T+ A RK+VTAKCYGGDITRKRKLLEKQKEGKKRM+R G V++PQ AF++ L+  +E
Sbjct: 545 TISALRKNVTAKCYGGDITRKRKLLEKQKEGKKRMKRMGNVELPQEAFLAALQVGDE 601


>gi|311232959|gb|ADP85813.1| GTP-binding protein LepA [Desulfovibrio vulgaris RCH1]
          Length = 607

 Score =  756 bits (1953), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 351/597 (58%), Positives = 467/597 (78%), Gaps = 3/597 (0%)

Query: 11  IRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVRLNY 70
           IRNFSI+AHIDHGKSTLADR ++    +++RE   Q LD MD+ERERGITIKAQTVR+ +
Sbjct: 13  IRNFSIIAHIDHGKSTLADRILEVTGLVSDREKRDQYLDRMDLERERGITIKAQTVRIPF 72

Query: 71  TSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQAIDNN 130
           TS   + Y LNLIDTPGHVDF YEVSRSL+AC+G+LLVVDA+QGVEAQTLANVY A+D++
Sbjct: 73  TSKTGRKYILNLIDTPGHVDFNYEVSRSLAACDGALLVVDASQGVEAQTLANVYLALDHD 132

Query: 131 HEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERIVQQLPSP 190
           H+II VLNK DLPS+D DRVK +IEE+IG+   DA+ VSAKTG  +  +LE IV++LP+P
Sbjct: 133 HDIIPVLNKIDLPSSDVDRVKAEIEESIGLDCTDAIAVSAKTGMNVDKVLEAIVERLPAP 192

Query: 191 TSPEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVERIGILT 250
                 NAPLKAL+ DSWY+SY GV+VL R+++G L KG  +R+  T   Y+V R+G+ +
Sbjct: 193 EG--NLNAPLKALIFDSWYDSYQGVVVLFRVMDGVLRKGDRVRMFATEKSYEVIRLGVFS 250

Query: 251 PKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVVFCGLFP 310
           P ++D+  L  GE+G + A+IKE+   +VGDTIT    P +  +PGFK +QP+VFCGL+P
Sbjct: 251 PDIVDVAELGAGEVGFLCANIKELGDAKVGDTITHTDRPASEPVPGFKEVQPMVFCGLYP 310

Query: 311 VDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERLEREFSL 370
            DA ++E L+ ++ KL+LNDA+FS+E E S ALGFGFRCGFLGLLH+EIIQERLEREF +
Sbjct: 311 TDAAEYEPLKASLEKLQLNDAAFSYEPETSQALGFGFRCGFLGLLHMEIIQERLEREFQV 370

Query: 371 NLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEYLGSILKL 430
           +LI T+PSV+Y++   DG  Q + NP  +P+ T+I  L EP++++ I  PNE++G++LKL
Sbjct: 371 DLIATAPSVIYKVETVDGKTQDIDNPSKLPDPTRITSLYEPYVRMDIHVPNEFVGNVLKL 430

Query: 431 CQERRGIQIDMSHL-DNRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDYRDSDL 489
           C+E+RGIQ +M ++  NR +I YELP  E++FDF+DRLKS +KGYAS DY  +DYR+S L
Sbjct: 431 CEEKRGIQKNMGYIAANRVVITYELPFAEIVFDFFDRLKSGTKGYASMDYEPVDYRESSL 490

Query: 490 VKLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGGRIIARE 549
           V+L IL+N E +DAL+++VHR  +   GR +  KLK  IP+Q+F++AIQAAIG ++IARE
Sbjct: 491 VRLDILINGEAVDALAVIVHRDKAYHYGRALALKLKRTIPRQLFEVAIQAAIGQKVIARE 550

Query: 550 TVKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISILKTDNE 606
           T+ A RK+VTAKCYGGDITRKRKLLEKQKEGK+RM+R G V++PQ AF++ L+  +E
Sbjct: 551 TISAMRKNVTAKCYGGDITRKRKLLEKQKEGKRRMKRMGNVELPQEAFLAALQVGDE 607


>gi|254448857|ref|ZP_05062313.1| GTP-binding protein LepA [gamma proteobacterium HTCC5015]
 gi|198261547|gb|EDY85836.1| GTP-binding protein LepA [gamma proteobacterium HTCC5015]
          Length = 597

 Score =  756 bits (1953), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 347/600 (57%), Positives = 473/600 (78%), Gaps = 4/600 (0%)

Query: 8   LSRIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVR 67
           +  IRNFSI+AHIDHGKST+ADRFIQ C GLT+REM+ QVLD+MD+ERERGITIKAQ+V 
Sbjct: 1   MKHIRNFSIIAHIDHGKSTIADRFIQVCGGLTDREMNEQVLDSMDLERERGITIKAQSVT 60

Query: 68  LNYTSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQAI 127
           L+Y + D + Y+LN IDTPGHVDF+YEVSRSL+ACEG+LLVVDA+QGVEAQ++AN Y AI
Sbjct: 61  LDYQARDGETYRLNFIDTPGHVDFSYEVSRSLAACEGALLVVDASQGVEAQSVANCYTAI 120

Query: 128 DNNHEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERIVQQL 187
           + + E++ VLNK DLP+ADP+RV +++E  IGI   +AL VSAKTG GI  LLE +V+Q+
Sbjct: 121 EQDLEVVPVLNKIDLPAADPERVIEEVENVIGIEAVNALHVSAKTGLGIEDLLEAMVEQI 180

Query: 188 PSPTS-PEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVERI 246
           P P   PE   +PLKAL+IDSW+++YLGV+ LVRI+ G +TK   I++M +   +QVE +
Sbjct: 181 PPPEGDPE---SPLKALIIDSWFDNYLGVVSLVRIVEGSVTKKDKIKIMASGRSFQVEEV 237

Query: 247 GILTPKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVVFC 306
           G+ TPK +  + L  GE+G +IA IKE+    VGDTIT +++P    LPGFK +QP VF 
Sbjct: 238 GVFTPKRLSRKTLSAGEVGYIIAGIKEIEAAPVGDTITLENTPAAEPLPGFKEVQPRVFA 297

Query: 307 GLFPVDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERLER 366
           G++P+ A  +E+ R A+ KLRLNDA+  FE E S ALGFGFRCGFLG+LH+EIIQERLER
Sbjct: 298 GVYPISADDYESFREALQKLRLNDAALHFEPETSQALGFGFRCGFLGMLHMEIIQERLER 357

Query: 367 EFSLNLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEYLGS 426
           E+ L+LI T+P+V+YE+    G + ++ NP D+PEV  I E+REP I  +I+ P++Y+G+
Sbjct: 358 EYDLDLITTAPTVIYEVESTQGELLEIHNPSDLPEVNTINEIREPIIAASILVPSDYVGN 417

Query: 427 ILKLCQERRGIQIDMSHLDNRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDYRD 486
           ++ LC E+RG+QI+M +L N+  + YELP+ EV+ DF+DRLKSVS+G+ASFDY+   ++ 
Sbjct: 418 VIGLCVEKRGVQINMQYLGNQVQLDYELPMAEVVLDFFDRLKSVSRGFASFDYDFKRFQA 477

Query: 487 SDLVKLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGGRII 546
           +DLV++ +L+N E +DAL+++ HR  S++RGR + EKL+ LIP+QMF++A+QAAIG  II
Sbjct: 478 ADLVRVDVLINGEKVDALAVIAHREHSQRRGREVIEKLQKLIPRQMFEVALQAAIGNHII 537

Query: 547 ARETVKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISILKTDNE 606
           AR  VKA RK+V AKCYGGD++RKRKLLEKQK GK+RM++ G+V++PQ AF+S+L+ DN+
Sbjct: 538 ARTNVKALRKNVLAKCYGGDVSRKRKLLEKQKAGKRRMKQIGKVEVPQEAFLSVLQVDND 597


>gi|304403918|ref|ZP_07385580.1| GTP-binding protein LepA [Paenibacillus curdlanolyticus YK9]
 gi|304346896|gb|EFM12728.1| GTP-binding protein LepA [Paenibacillus curdlanolyticus YK9]
          Length = 605

 Score =  756 bits (1953), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 348/596 (58%), Positives = 468/596 (78%), Gaps = 3/596 (0%)

Query: 10  RIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVRLN 69
           +IRNFSI+AHIDHGKSTLADR ++    L+ REM  QVLD MD+ERERGITIK Q VRL 
Sbjct: 10  KIRNFSIIAHIDHGKSTLADRILEFTGALSSREMQEQVLDQMDLERERGITIKLQAVRLG 69

Query: 70  YTSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQAIDN 129
           Y + D ++Y LNLIDTPGHVDFTYEVSRS++ACEG+LLVVDA QG+EAQTLANVY A+D+
Sbjct: 70  YKADDGEEYILNLIDTPGHVDFTYEVSRSMAACEGALLVVDAAQGIEAQTLANVYLALDS 129

Query: 130 NHEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERIVQQLPS 189
           N EI+ V+NK DLPSA+P+RVK++IE+ IG+   DA+L SAK G GI  +LE++VQ++P+
Sbjct: 130 NLEILPVINKIDLPSAEPERVKQEIEDVIGLDASDAVLASAKAGIGIKEILEQVVQKVPA 189

Query: 190 PTSPEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVERIGIL 249
           PT     + PLKAL+ DS Y+ Y GV+V VR+I+G +  G+ IR M T A+++V  +G  
Sbjct: 190 PTG--NPDDPLKALIFDSHYDPYKGVIVYVRVIDGSIKAGKKIRFMATGAEFEVIEVGAF 247

Query: 250 TPKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVVFCGLF 309
            P+M  ++ L  G++G ++A IK V  TRVGDT+T+   P   ALPG++ I P+VFCGL+
Sbjct: 248 KPRMSIVDELAVGDVGFVVAGIKNVKDTRVGDTVTEAKRPAPEALPGYRKINPMVFCGLY 307

Query: 310 PVDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERLEREFS 369
           P++   + +LR A+ KL LNDAS  +E E STALGFGFRCGFLGLLH+EIIQER+EREF+
Sbjct: 308 PIETQDYNDLREALEKLELNDASLRYEPETSTALGFGFRCGFLGLLHMEIIQERIEREFN 367

Query: 370 LNLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEYLGSILK 429
           + LI T+PSVVY +   +G + ++ NP + PEV KI  + EP+++ ++I PN+Y+G+I++
Sbjct: 368 IPLITTAPSVVYHVTQTNGEVLQIDNPSNYPEVGKIDFVEEPYVKASVIVPNDYVGAIME 427

Query: 430 LCQERRGIQIDMSHLD-NRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDYRDSD 488
           LCQ +RG  ++M +LD NR  + YE+PL+E+++DF+D+LKS +KGYASFDY +  YR S+
Sbjct: 428 LCQGKRGEYVNMEYLDTNRVTLTYEIPLSEIVYDFFDQLKSRTKGYASFDYELAGYRQSN 487

Query: 489 LVKLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGGRIIAR 548
           LVK+ I++NNE +DALSI+VHR  +  RGR ICEK+K LIP+QMF++ IQA+IG ++IAR
Sbjct: 488 LVKMDIMLNNEQVDALSIIVHRDRAYHRGRAICEKMKELIPRQMFEVPIQASIGTKVIAR 547

Query: 549 ETVKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISILKTD 604
           ETVKA RK+V AKCYGGDI+RKRKLLEKQKEGKKRM++ G V++PQ AF+++LK D
Sbjct: 548 ETVKAMRKNVLAKCYGGDISRKRKLLEKQKEGKKRMKQVGSVEVPQEAFMAVLKID 603


>gi|120603304|ref|YP_967704.1| GTP-binding protein LepA [Desulfovibrio vulgaris DP4]
 gi|120563533|gb|ABM29277.1| GTP-binding protein LepA [Desulfovibrio vulgaris DP4]
          Length = 607

 Score =  756 bits (1953), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 351/597 (58%), Positives = 467/597 (78%), Gaps = 3/597 (0%)

Query: 11  IRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVRLNY 70
           IRNFSI+AHIDHGKSTLADR ++    +++RE   Q LD MD+ERERGITIKAQTVR+ +
Sbjct: 13  IRNFSIIAHIDHGKSTLADRILEVTGLVSDREKRDQYLDRMDLERERGITIKAQTVRIPF 72

Query: 71  TSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQAIDNN 130
           TS   + Y LNLIDTPGHVDF YEVSRSL+AC+G+LLVVDA+QGVEAQTLANVY A+D++
Sbjct: 73  TSKTGRKYILNLIDTPGHVDFNYEVSRSLAACDGALLVVDASQGVEAQTLANVYLALDHD 132

Query: 131 HEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERIVQQLPSP 190
           H+II VLNK DLPS+D DRVK +IEE+IG+   DA+ VSAKTG  +  +LE IV++LP+P
Sbjct: 133 HDIIPVLNKIDLPSSDVDRVKAEIEESIGLDCTDAIAVSAKTGMNVDKVLEAIVERLPAP 192

Query: 191 TSPEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVERIGILT 250
                 NAPLKAL+ DSWY+SY GV+VL R+++G L KG  +R+  T   Y+V R+G+ +
Sbjct: 193 EG--NLNAPLKALIFDSWYDSYQGVVVLFRVMDGVLRKGDRVRMFATEKSYEVIRLGVFS 250

Query: 251 PKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVVFCGLFP 310
           P ++D+  L  GE+G + A+IKE+   +VGDTIT    P +  +PGFK +QP+VFCGL+P
Sbjct: 251 PDIVDVAELGAGEVGFLCANIKELGDAKVGDTITHADRPASEPVPGFKEVQPMVFCGLYP 310

Query: 311 VDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERLEREFSL 370
            DA ++E L+ ++ KL+LNDA+FS+E E S ALGFGFRCGFLGLLH+EIIQERLEREF +
Sbjct: 311 TDAAEYEPLKASLEKLQLNDAAFSYEPETSQALGFGFRCGFLGLLHMEIIQERLEREFQV 370

Query: 371 NLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEYLGSILKL 430
           +LI T+PSV+Y++   DG  Q + NP  +P+ T+I  L EP++++ I  PNE++G++LKL
Sbjct: 371 DLIATAPSVIYKVETVDGKTQDIDNPSKLPDPTRITSLYEPYVRMDIHVPNEFVGNVLKL 430

Query: 431 CQERRGIQIDMSHL-DNRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDYRDSDL 489
           C+E+RGIQ +M ++  NR +I YELP  E++FDF+DRLKS +KGYAS DY  +DYR+S L
Sbjct: 431 CEEKRGIQKNMGYIAANRVVITYELPFAEIVFDFFDRLKSGTKGYASMDYEPVDYRESSL 490

Query: 490 VKLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGGRIIARE 549
           V+L IL+N E +DAL+++VHR  +   GR +  KLK  IP+Q+F++AIQAAIG ++IARE
Sbjct: 491 VRLDILINGEAVDALAVIVHRDKAYHYGRALALKLKRTIPRQLFEVAIQAAIGQKVIARE 550

Query: 550 TVKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISILKTDNE 606
           T+ A RK+VTAKCYGGDITRKRKLLEKQKEGK+RM+R G V++PQ AF++ L+  +E
Sbjct: 551 TISAMRKNVTAKCYGGDITRKRKLLEKQKEGKRRMKRMGNVELPQEAFLAALQVGDE 607


>gi|118580746|ref|YP_901996.1| GTP-binding protein LepA [Pelobacter propionicus DSM 2379]
 gi|166224506|sp|A1ARG8|LEPA_PELPD RecName: Full=Elongation factor 4; Short=EF-4; AltName:
           Full=Ribosomal back-translocase LepA
 gi|118503456|gb|ABK99938.1| GTP-binding protein LepA [Pelobacter propionicus DSM 2379]
          Length = 598

 Score =  756 bits (1952), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 360/598 (60%), Positives = 466/598 (77%), Gaps = 3/598 (0%)

Query: 8   LSRIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVR 67
           +SR+RNFSI+AHIDHGKSTLADR ++    L++REM +Q LD MD+ERERGITIKAQTVR
Sbjct: 3   ISRLRNFSIIAHIDHGKSTLADRLLEFTGALSQREMQNQFLDKMDLERERGITIKAQTVR 62

Query: 68  LNYTSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQAI 127
           L Y + D  DY LNLIDTPGHVDFTYEVSRSL+ACEG LLVVDA+QGVEAQTLANVY A+
Sbjct: 63  LTYRADDGNDYVLNLIDTPGHVDFTYEVSRSLAACEGGLLVVDASQGVEAQTLANVYLAL 122

Query: 128 DNNHEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERIVQQL 187
           D N E+  VLNK DLP+ADP+RV ++IEE IGI   DA+L SAK G G   +LE IV+++
Sbjct: 123 DINLEVFPVLNKIDLPAADPERVIQEIEEIIGIDAHDAVLASAKEGIGTHEILEEIVKKI 182

Query: 188 PSPTSPEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVERIG 247
           P P     A+APL+ALL DSWY+ Y GV++LVRI +G L KG  I+LM T + ++  ++G
Sbjct: 183 PPPKG--DASAPLRALLFDSWYDQYQGVIILVRIFDGTLKKGDRIQLMATRSSFEALKVG 240

Query: 248 ILTPKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVVFCG 307
           +  P M++ + L  GE+G +IA IKEV+  +VGDT+T    P +SAL GFK ++P+VF G
Sbjct: 241 VFAPTMVETQQLAAGEVGFVIAGIKEVADAKVGDTVTLQHRPCSSALEGFKEVKPMVFSG 300

Query: 308 LFPVDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERLERE 367
           L+P+D  Q+E LR A+ KL+LND+SFS++ E S ALGFGFRCGFLGLLH+EIIQERLERE
Sbjct: 301 LYPIDTVQYEQLRDALAKLKLNDSSFSYDPETSLALGFGFRCGFLGLLHMEIIQERLERE 360

Query: 368 FSLNLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEYLGSI 427
           F L+LI T+P+VVY ++   G +Q + +   MPE+  +  L EP+I   I  PNE++G +
Sbjct: 361 FGLDLITTAPTVVYRVHRVTGEVQSIESANQMPELQHVEYLEEPFILAHIHVPNEFVGGV 420

Query: 428 LKLCQERRGIQIDMSHL-DNRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDYRD 486
           L LC+++RG+Q ++ +L  NR MI+YELPLNE++ DFYDRLKS++KGYAS DY  +DYR 
Sbjct: 421 LALCEDKRGVQREIKYLTQNRVMIIYELPLNEIVLDFYDRLKSITKGYASLDYEHLDYRK 480

Query: 487 SDLVKLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGGRII 546
           SDLV++ +++N E +DALS+++HR  +  RGR +  K+K LIP+QMF++AIQAAIG +II
Sbjct: 481 SDLVRMNVMINGEVVDALSLILHRDKAYYRGRDLVSKMKELIPRQMFEVAIQAAIGNKII 540

Query: 547 ARETVKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISILKTD 604
           ARETVKA RKDV AKCYGGDITRKRKLLEKQKEGKKRM+  G V++PQ AF++ILK +
Sbjct: 541 ARETVKAMRKDVLAKCYGGDITRKRKLLEKQKEGKKRMKNVGNVELPQDAFLAILKVE 598


>gi|270156958|ref|ZP_06185615.1| effector protein A LepA [Legionella longbeachae D-4968]
 gi|289164618|ref|YP_003454756.1| GTP-binding membrane protein [Legionella longbeachae NSW150]
 gi|269988983|gb|EEZ95237.1| effector protein A LepA [Legionella longbeachae D-4968]
 gi|288857791|emb|CBJ11635.1| GTP-binding membrane protein [Legionella longbeachae NSW150]
          Length = 601

 Score =  756 bits (1951), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 351/600 (58%), Positives = 468/600 (78%), Gaps = 4/600 (0%)

Query: 8   LSRIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVR 67
           L RIRNFSI+AHIDHGKSTLADRFIQ C GLTEREMS+QVLD+MDIERERGITIKAQ V 
Sbjct: 4   LKRIRNFSIIAHIDHGKSTLADRFIQICGGLTEREMSAQVLDSMDIERERGITIKAQCVS 63

Query: 68  LNYTSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQAI 127
           LNY + D K Y LN IDTPGHVDF+YEVSRSL+ACEG++LVVDA QGVEAQT+A  Y AI
Sbjct: 64  LNYMAKDGKTYLLNFIDTPGHVDFSYEVSRSLAACEGAILVVDAAQGVEAQTVAVCYTAI 123

Query: 128 DNNHEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERIVQQL 187
           D +  ++ VLNK DLP A+P+RV  +IE+ IG+   DA+ VSAK G G+  +LE +V+ +
Sbjct: 124 DQSLSVLPVLNKIDLPQAEPERVISEIEDIIGVDAHDAIRVSAKVGLGVEDVLEALVKHI 183

Query: 188 PSPTSPEG-ANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVERI 246
           P P   EG  NAPL+AL+IDSW++SYLGV+ LVRI+NG + KG  +R+M T   Y+V+++
Sbjct: 184 PPP---EGDINAPLQALIIDSWFDSYLGVVSLVRIVNGSIRKGDKMRVMSTGRSYEVDQV 240

Query: 247 GILTPKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVVFC 306
           GI TPK   ++AL  GE+G ++A IKE+    VGDT+T + +P    LPGF+ ++P V+ 
Sbjct: 241 GIFTPKRTKLDALNAGEVGYVVAGIKEIQGAPVGDTLTLEKNPAEKELPGFQRVKPQVYA 300

Query: 307 GLFPVDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERLER 366
           GLFP+ A  FE  R A+ KL LNDAS  +E E+S ALGFGFRCGFLG+LH+EI+QERLER
Sbjct: 301 GLFPISADDFEAFREALAKLSLNDASLFYEPESSEALGFGFRCGFLGMLHMEIVQERLER 360

Query: 367 EFSLNLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEYLGS 426
           E++L+LI T+P+VVY++    G    + NP  +P + +I E+ EP ++  I+ P +YLGS
Sbjct: 361 EYNLDLISTAPTVVYQIVTQKGETLLIDNPSLLPPIPQIKEMYEPIVRANILVPQDYLGS 420

Query: 427 ILKLCQERRGIQIDMSHLDNRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDYRD 486
           I+ LC ERRG+Q++M++   +  + Y++P++EV+ DF+DRLKSVS+GYAS DYN + +++
Sbjct: 421 IINLCIERRGVQVNMTYSGRQVSVTYDIPMSEVVSDFFDRLKSVSRGYASLDYNFLRFQE 480

Query: 487 SDLVKLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGGRII 546
           +DLVK+ IL+N+E +DALS++VHRS +  RG+ I EK+++LIP+QMF +AIQAA+G  II
Sbjct: 481 ADLVKMDILINSERVDALSVIVHRSSAHSRGKLIAEKMRDLIPRQMFDVAIQAALGSHII 540

Query: 547 ARETVKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISILKTDNE 606
           AR+TVKA RK+VTAKCYGGD+TRKRKLLEKQK GKKRM++ G V+IPQ AF+++ +TD +
Sbjct: 541 ARQTVKALRKNVTAKCYGGDVTRKRKLLEKQKAGKKRMKQVGHVEIPQEAFMAVFQTDKK 600


>gi|46579116|ref|YP_009924.1| GTP-binding protein LepA [Desulfovibrio vulgaris str.
           Hildenborough]
 gi|60390041|sp|Q72E76|LEPA_DESVH RecName: Full=Elongation factor 4; Short=EF-4; AltName:
           Full=Ribosomal back-translocase LepA
 gi|46448529|gb|AAS95183.1| GTP-binding protein LepA [Desulfovibrio vulgaris str.
           Hildenborough]
          Length = 601

 Score =  756 bits (1951), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 351/597 (58%), Positives = 467/597 (78%), Gaps = 3/597 (0%)

Query: 11  IRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVRLNY 70
           IRNFSI+AHIDHGKSTLADR ++    +++RE   Q LD MD+ERERGITIKAQTVR+ +
Sbjct: 7   IRNFSIIAHIDHGKSTLADRILEVTGLVSDREKRDQYLDRMDLERERGITIKAQTVRIPF 66

Query: 71  TSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQAIDNN 130
           TS   + Y LNLIDTPGHVDF YEVSRSL+AC+G+LLVVDA+QGVEAQTLANVY A+D++
Sbjct: 67  TSKTGRKYILNLIDTPGHVDFNYEVSRSLAACDGALLVVDASQGVEAQTLANVYLALDHD 126

Query: 131 HEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERIVQQLPSP 190
           H+II VLNK DLPS+D DRVK +IEE+IG+   DA+ VSAKTG  +  +LE IV++LP+P
Sbjct: 127 HDIIPVLNKIDLPSSDVDRVKAEIEESIGLDCTDAIAVSAKTGMNVDKVLEAIVERLPAP 186

Query: 191 TSPEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVERIGILT 250
                 NAPLKAL+ DSWY+SY GV+VL R+++G L KG  +R+  T   Y+V R+G+ +
Sbjct: 187 EG--NLNAPLKALIFDSWYDSYQGVVVLFRVMDGVLRKGDRVRMFATEKSYEVIRLGVFS 244

Query: 251 PKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVVFCGLFP 310
           P ++D+  L  GE+G + A+IKE+   +VGDTIT    P +  +PGFK +QP+VFCGL+P
Sbjct: 245 PDIVDVAELGAGEVGFLCANIKELGDAKVGDTITHTDRPASEPVPGFKEVQPMVFCGLYP 304

Query: 311 VDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERLEREFSL 370
            DA ++E L+ ++ KL+LNDA+FS+E E S ALGFGFRCGFLGLLH+EIIQERLEREF +
Sbjct: 305 TDAAEYEPLKASLEKLQLNDAAFSYEPETSQALGFGFRCGFLGLLHMEIIQERLEREFQV 364

Query: 371 NLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEYLGSILKL 430
           +LI T+PSV+Y++   DG  Q + NP  +P+ T+I  L EP++++ I  PNE++G++LKL
Sbjct: 365 DLIATAPSVIYKVETVDGKTQDIDNPSKLPDPTRITSLYEPYVRMDIHVPNEFVGNVLKL 424

Query: 431 CQERRGIQIDMSHL-DNRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDYRDSDL 489
           C+E+RGIQ +M ++  NR +I YELP  E++FDF+DRLKS +KGYAS DY  +DYR+S L
Sbjct: 425 CEEKRGIQKNMGYIAANRVVITYELPFAEIVFDFFDRLKSGTKGYASMDYEPVDYRESSL 484

Query: 490 VKLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGGRIIARE 549
           V+L IL+N E +DAL+++VHR  +   GR +  KLK  IP+Q+F++AIQAAIG ++IARE
Sbjct: 485 VRLDILINGEAVDALAVIVHRDKAYHYGRALALKLKRTIPRQLFEVAIQAAIGQKVIARE 544

Query: 550 TVKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISILKTDNE 606
           T+ A RK+VTAKCYGGDITRKRKLLEKQKEGK+RM+R G V++PQ AF++ L+  +E
Sbjct: 545 TISAMRKNVTAKCYGGDITRKRKLLEKQKEGKRRMKRMGNVELPQEAFLAALQVGDE 601


>gi|313673952|ref|YP_004052063.1| gtp-binding protein lepa [Calditerrivibrio nitroreducens DSM 19672]
 gi|312940708|gb|ADR19900.1| GTP-binding protein LepA [Calditerrivibrio nitroreducens DSM 19672]
          Length = 600

 Score =  756 bits (1951), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 352/597 (58%), Positives = 466/597 (78%), Gaps = 3/597 (0%)

Query: 11  IRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVRLNY 70
           IRNFSI+AHIDHGKSTLADR I++   + +R M  Q+LD+MDIERERGITIKAQTVRL Y
Sbjct: 6   IRNFSIIAHIDHGKSTLADRLIEYTGAIDKRLMKDQLLDSMDIERERGITIKAQTVRLQY 65

Query: 71  TSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQAIDNN 130
           T+ D   YQLNLIDTPGHVDFTYEVSRSL+ACEG+LLVVDA+QGVEAQT+ANVY AI+ N
Sbjct: 66  TADDGNTYQLNLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTIANVYMAIEQN 125

Query: 131 HEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERIVQQLPSP 190
            E+I V+NK DLPSAD +RVKK+IE+ IGI    A+  SAK G GI  +LE +V+ +P P
Sbjct: 126 LELIPVINKIDLPSADVERVKKEIEDVIGIDASHAVPASAKEGIGIKEILESVVKYIPEP 185

Query: 191 TSPEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVERIGILT 250
                 N+PLKA++ DSWY+SY GV++L+R+I+G+L  G +   M  + +Y V+++G+ T
Sbjct: 186 KG--DINSPLKAMVFDSWYDSYQGVIILIRVIDGELKVGDTFCFMSNDKEYNVDKVGVFT 243

Query: 251 PKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVVFCGLFP 310
           P   +++ L  GE+G +I+ IKE+   R+GDT+TD  + T    PGFK ++PVVFCG +P
Sbjct: 244 PLAKNVDKLSAGEVGFVISGIKELKDVRIGDTLTDPKNRTKEPFPGFKHVKPVVFCGFYP 303

Query: 311 VDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERLEREFSL 370
           VD   FE+LR A+ KL LND+SF++E ENS ALGFGFRCGFLGLLH+EIIQERLEREF L
Sbjct: 304 VDTKDFEDLRDALEKLSLNDSSFTYEPENSAALGFGFRCGFLGLLHMEIIQERLEREFDL 363

Query: 371 NLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEYLGSILKL 430
           NLI T+P V+Y++Y  +G + ++ NP+  P   +I+ + EP I+ TII PNEY+G++++L
Sbjct: 364 NLITTAPMVIYKVYKTNGEVVEVDNPVKFPNPGEISYIEEPIIKATIIVPNEYVGNVIQL 423

Query: 431 CQERRGIQIDMSHLDN-RAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDYRDSDL 489
            Q RRG Q +M ++ + R ++ YE+PL E++ DFYD+LKS++KGYASFDY    YR++D+
Sbjct: 424 LQSRRGFQKNMHYMSSTRVILEYEVPLCEIVLDFYDKLKSITKGYASFDYEHAGYREADM 483

Query: 490 VKLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGGRIIARE 549
           VKL IL+N E +DALSI+VHR  +  +GR + EK+K +IP+QMF+IAIQAA+G ++IAR 
Sbjct: 484 VKLDILINGEPVDALSIIVHRDQAYYKGRDLVEKMKEVIPRQMFEIAIQAALGNKVIARS 543

Query: 550 TVKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISILKTDNE 606
           TVKA RK+VTAKCYGGDITRKRKLLEKQKEGKKRM+  G+V+IPQ AF+++LK + +
Sbjct: 544 TVKAFRKNVTAKCYGGDITRKRKLLEKQKEGKKRMKMVGKVEIPQEAFLAVLKINED 600


>gi|52842093|ref|YP_095892.1| GTP-binding protein LepA [Legionella pneumophila subsp. pneumophila
           str. Philadelphia 1]
 gi|54297786|ref|YP_124155.1| GTP-binding protein LepA [Legionella pneumophila str. Paris]
 gi|148359413|ref|YP_001250620.1| hypothetical protein LPC_1317 [Legionella pneumophila str. Corby]
 gi|296107459|ref|YP_003619160.1| Membrane GTPase LepA [Legionella pneumophila 2300/99 Alcoy]
 gi|81601773|sp|Q5X443|LEPA_LEGPA RecName: Full=Elongation factor 4; Short=EF-4; AltName:
           Full=Ribosomal back-translocase LepA
 gi|81603284|sp|Q5ZUD2|LEPA_LEGPH RecName: Full=Elongation factor 4; Short=EF-4; AltName:
           Full=Ribosomal back-translocase LepA
 gi|166223206|sp|A5ID24|LEPA_LEGPC RecName: Full=Elongation factor 4; Short=EF-4; AltName:
           Full=Ribosomal back-translocase LepA
 gi|52629204|gb|AAU27945.1| GTP binding elongation factor LepA [Legionella pneumophila subsp.
           pneumophila str. Philadelphia 1]
 gi|53751571|emb|CAH12989.1| hypothetical protein lpp1837 [Legionella pneumophila str. Paris]
 gi|148281186|gb|ABQ55274.1| hypothetical protein LPC_1317 [Legionella pneumophila str. Corby]
 gi|295649361|gb|ADG25208.1| Membrane GTPase LepA [Legionella pneumophila 2300/99 Alcoy]
          Length = 610

 Score =  755 bits (1950), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 353/599 (58%), Positives = 463/599 (77%), Gaps = 2/599 (0%)

Query: 8   LSRIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVR 67
           L+RIRNFSI+AHIDHGKSTLADRFIQ C GLTEREMSSQVLD+MDIERERGITIKAQ V 
Sbjct: 13  LNRIRNFSIIAHIDHGKSTLADRFIQICGGLTEREMSSQVLDSMDIERERGITIKAQCVS 72

Query: 68  LNYTSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQAI 127
           LNYT+ D K Y LN IDTPGHVDF+YEVSRSL+ACEG++LVVDA QGVEAQTLA  Y AI
Sbjct: 73  LNYTAKDGKTYLLNFIDTPGHVDFSYEVSRSLAACEGAILVVDAAQGVEAQTLAVCYTAI 132

Query: 128 DNNHEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERIVQQL 187
           D +  ++ VLNK DLP A+P+RV  +IE+ IG+  +DA+ VSAK+G G+  +LE +V  +
Sbjct: 133 DQSLTVLPVLNKIDLPQAEPERVISEIEDIIGLDAQDAIRVSAKSGLGVNDVLEALVANI 192

Query: 188 PSPTSPEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVERIG 247
           P P      +APL+AL+IDSW++SYLGV+ LVRI+NG + KG  +R+M T   Y+V+++G
Sbjct: 193 PPPKG--DVHAPLQALIIDSWFDSYLGVVSLVRIVNGAIRKGDKMRVMSTGRAYEVDQVG 250

Query: 248 ILTPKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVVFCG 307
           I TPK   ++ALY GE+G ++A IKE+    VGDT+T D +P    LPGF+ ++P V+ G
Sbjct: 251 IFTPKRTKLDALYAGEVGYVVAGIKEIQGAPVGDTLTLDRNPADKVLPGFQRVKPQVYAG 310

Query: 308 LFPVDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERLERE 367
           LFPV +  FE  R A+ KL LNDAS  +E E+S ALGFGFRCGFLG+LH+EIIQERLERE
Sbjct: 311 LFPVSSDDFEAFREALAKLSLNDASLFYEPESSEALGFGFRCGFLGMLHMEIIQERLERE 370

Query: 368 FSLNLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEYLGSI 427
           ++L+LI T+P+VVY++    G    + NP  +P   +I E+ EP ++  I+ P +YLG I
Sbjct: 371 YNLDLISTAPTVVYQIVTQKGETLLIDNPSHLPPTPQIKEMYEPIVRANILVPQDYLGPI 430

Query: 428 LKLCQERRGIQIDMSHLDNRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDYRDS 487
           + LC ERRG+Q+ M++      +VY++P++EV+ DF+DRLKSVS+GYAS DYN   ++ +
Sbjct: 431 ITLCVERRGVQVSMTYSGRHVSVVYDIPMSEVVSDFFDRLKSVSRGYASLDYNFQRFQIA 490

Query: 488 DLVKLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGGRIIA 547
           DLVK+ IL+N+E +DAL+++VHR  +  RG+ I EK++ LIP+QMF +AIQAAIG  IIA
Sbjct: 491 DLVKMDILINSERVDALAVIVHRDSAHSRGKLIAEKMQQLIPRQMFDVAIQAAIGSHIIA 550

Query: 548 RETVKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISILKTDNE 606
           R+TVKA RK+VTAKCYGGD+TRKRKLLEKQK GKKRM++ G V+IPQ AF+++ +TD +
Sbjct: 551 RQTVKALRKNVTAKCYGGDVTRKRKLLEKQKAGKKRMKQVGHVEIPQEAFMAVFQTDKK 609


>gi|307610573|emb|CBX00161.1| hypothetical protein LPW_19061 [Legionella pneumophila 130b]
          Length = 601

 Score =  755 bits (1949), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 353/599 (58%), Positives = 463/599 (77%), Gaps = 2/599 (0%)

Query: 8   LSRIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVR 67
           L+RIRNFSI+AHIDHGKSTLADRFIQ C GLTEREMSSQVLD+MDIERERGITIKAQ V 
Sbjct: 4   LNRIRNFSIIAHIDHGKSTLADRFIQICGGLTEREMSSQVLDSMDIERERGITIKAQCVS 63

Query: 68  LNYTSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQAI 127
           LNYT+ D K Y LN IDTPGHVDF+YEVSRSL+ACEG++LVVDA QGVEAQTLA  Y AI
Sbjct: 64  LNYTAKDGKTYLLNFIDTPGHVDFSYEVSRSLAACEGAILVVDAAQGVEAQTLAVCYTAI 123

Query: 128 DNNHEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERIVQQL 187
           D +  ++ VLNK DLP A+P+RV  +IE+ IG+  +DA+ VSAK+G G+  +LE +V  +
Sbjct: 124 DQSLTVLPVLNKIDLPQAEPERVISEIEDIIGLDAQDAIRVSAKSGLGVNDVLEALVANI 183

Query: 188 PSPTSPEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVERIG 247
           P P      +APL+AL+IDSW++SYLGV+ LVRI+NG + KG  +R+M T   Y+V+++G
Sbjct: 184 PPPKG--DVHAPLQALIIDSWFDSYLGVVSLVRIVNGAIRKGDKMRVMSTGRAYEVDQVG 241

Query: 248 ILTPKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVVFCG 307
           I TPK   ++ALY GE+G ++A IKE+    VGDT+T D +P    LPGF+ ++P V+ G
Sbjct: 242 IFTPKRTKLDALYAGEVGYVVAGIKEIQGAPVGDTLTLDRNPADKVLPGFQRVKPQVYAG 301

Query: 308 LFPVDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERLERE 367
           LFPV +  FE  R A+ KL LNDAS  +E E+S ALGFGFRCGFLG+LH+EIIQERLERE
Sbjct: 302 LFPVSSDDFEAFREALAKLSLNDASLFYEPESSEALGFGFRCGFLGMLHMEIIQERLERE 361

Query: 368 FSLNLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEYLGSI 427
           ++L+LI T+P+VVY++    G    + NP  +P   +I E+ EP ++  I+ P +YLG I
Sbjct: 362 YNLDLISTAPTVVYQIVTQKGETLLIDNPSHLPPTPQIKEMYEPIVRANILVPQDYLGPI 421

Query: 428 LKLCQERRGIQIDMSHLDNRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDYRDS 487
           + LC ERRG+Q+ M++      +VY++P++EV+ DF+DRLKSVS+GYAS DYN   ++ +
Sbjct: 422 ITLCVERRGVQVSMTYSGRHVSVVYDIPMSEVVSDFFDRLKSVSRGYASLDYNFQRFQIA 481

Query: 488 DLVKLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGGRIIA 547
           DLVK+ IL+N+E +DAL+++VHR  +  RG+ I EK++ LIP+QMF +AIQAAIG  IIA
Sbjct: 482 DLVKMDILINSERVDALAVIVHRDSAHSRGKLIAEKMQQLIPRQMFDVAIQAAIGSHIIA 541

Query: 548 RETVKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISILKTDNE 606
           R+TVKA RK+VTAKCYGGD+TRKRKLLEKQK GKKRM++ G V+IPQ AF+++ +TD +
Sbjct: 542 RQTVKALRKNVTAKCYGGDVTRKRKLLEKQKAGKKRMKQVGHVEIPQEAFMAVFQTDKK 600


>gi|254499131|ref|ZP_05111821.1| GTP-binding protein LepA [Legionella drancourtii LLAP12]
 gi|254351670|gb|EET10515.1| GTP-binding protein LepA [Legionella drancourtii LLAP12]
          Length = 600

 Score =  754 bits (1948), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 352/600 (58%), Positives = 468/600 (78%), Gaps = 4/600 (0%)

Query: 8   LSRIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVR 67
           L RIRNFSI+AHIDHGKSTLADRFIQ C GLT+REMSSQVLD+MDIERERGITIKAQ V 
Sbjct: 4   LKRIRNFSIIAHIDHGKSTLADRFIQICGGLTDREMSSQVLDSMDIERERGITIKAQCVS 63

Query: 68  LNYTSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQAI 127
           LNYT+ D K Y LN IDTPGHVDF+YEVSRSL+ACEG++LVVDA QGVEAQT+A  Y AI
Sbjct: 64  LNYTAKDGKIYLLNFIDTPGHVDFSYEVSRSLAACEGAILVVDAAQGVEAQTVAVCYTAI 123

Query: 128 DNNHEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERIVQQL 187
           D +  ++ VLNK DLP A+P+RV  +IE+ IG+   DA+  SAK+G G+  +LE +V  +
Sbjct: 124 DQSLTVLPVLNKIDLPQAEPERVISEIEDIIGVDAHDAIRTSAKSGIGVEDVLEALVANI 183

Query: 188 PSPTSPEG-ANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVERI 246
           P P   EG  +APL+AL+IDSW++SYLGV+ LVRI+NG + KG  +R+M T   Y+V+++
Sbjct: 184 PPP---EGEVDAPLQALIIDSWFDSYLGVVSLVRIVNGSIRKGDKMRIMSTGRSYEVDQV 240

Query: 247 GILTPKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVVFC 306
           GI TPK   ++AL+ GE+G ++A IKE+    VGDT+T + +   SALPGF+ ++P V+ 
Sbjct: 241 GIFTPKRTKLDALHAGEVGYVVAGIKEIQGAPVGDTLTLEKNQAASALPGFQRVKPQVYA 300

Query: 307 GLFPVDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERLER 366
           GLFP+ A  FE  R A+ KL LNDAS  +E E+S ALGFGFRCGFLG+LH+EIIQERLER
Sbjct: 301 GLFPISADDFEAFREALAKLSLNDASLFYEPESSEALGFGFRCGFLGMLHMEIIQERLER 360

Query: 367 EFSLNLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEYLGS 426
           E++L+LI T+P+VVY++    G    + NP  +P  T+I E+ EP ++  I+ P +YLGS
Sbjct: 361 EYNLDLISTAPTVVYQIVTQKGETLLIDNPSHLPPATQIKEMYEPIVRANILVPQDYLGS 420

Query: 427 ILKLCQERRGIQIDMSHLDNRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDYRD 486
           I+ LC ERRG+Q++M++   +  + Y+LP++EV+ DF+DRLKSVS+GYAS DYN + +  
Sbjct: 421 IINLCIERRGVQVNMTYSGRQVSVTYDLPMSEVVSDFFDRLKSVSRGYASLDYNFLRFDP 480

Query: 487 SDLVKLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGGRII 546
           +DLVK+ IL+N+E +DALS++VHR+ S  RG+ I EK+K+LIP+QMF +AIQAA+G  II
Sbjct: 481 ADLVKMDILINSERVDALSVIVHRASSHSRGKIIAEKMKDLIPRQMFDVAIQAALGSHII 540

Query: 547 ARETVKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISILKTDNE 606
           AR+TVKA RK+VTAKCYGGD++RKRKLL+KQK GKKRM++ G V+IPQ AF+++ ++D +
Sbjct: 541 ARQTVKALRKNVTAKCYGGDVSRKRKLLDKQKAGKKRMKQVGHVEIPQEAFMAVFQSDKK 600


>gi|226940387|ref|YP_002795461.1| GTP-binding protein LepA [Laribacter hongkongensis HLHK9]
 gi|254808735|sp|C1D7L2|LEPA_LARHH RecName: Full=Elongation factor 4; Short=EF-4; AltName:
           Full=Ribosomal back-translocase LepA
 gi|226715314|gb|ACO74452.1| LepA [Laribacter hongkongensis HLHK9]
          Length = 597

 Score =  754 bits (1948), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 350/599 (58%), Positives = 469/599 (78%), Gaps = 2/599 (0%)

Query: 8   LSRIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVR 67
           +  IRNFSI+AHIDHGKSTLADRFIQ+C GL  REMS QVLD+MDIE+ERGITIKAQT  
Sbjct: 1   MKNIRNFSIIAHIDHGKSTLADRFIQYCGGLEMREMSEQVLDSMDIEKERGITIKAQTAA 60

Query: 68  LNYTSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQAI 127
           L+Y + D + Y LNLIDTPGHVDF+YEVSRSLSACEG+LLVVDA+QGVEAQT+AN Y AI
Sbjct: 61  LSYKARDGQVYHLNLIDTPGHVDFSYEVSRSLSACEGALLVVDASQGVEAQTVANCYTAI 120

Query: 128 DNNHEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERIVQQL 187
           +   E++ VLNK DLP+A+P+RV ++IE+ IGI   DA+  SAK+G GI  +LE +VQ++
Sbjct: 121 ELGVEVVPVLNKIDLPAAEPERVSQEIEDIIGIEAIDAVRASAKSGIGIEDILETVVQKI 180

Query: 188 PSPTSPEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVERIG 247
           P+P     A+APLKAL+IDSW+++Y+GV++LVR+++G +     I+ M T A++ VE++G
Sbjct: 181 PAPKG--DADAPLKALIIDSWFDNYVGVVMLVRLVDGAVKPKDKIKFMATGAEHLVEQVG 238

Query: 248 ILTPKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVVFCG 307
           + TPK +    L  GE+G +IA IKE+   +VGDTIT  + P   ALPGFK +Q  VF G
Sbjct: 239 VFTPKSVQRSELRAGEVGFIIAGIKELKSAKVGDTITQVARPAAEALPGFKEVQSQVFAG 298

Query: 308 LFPVDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERLERE 367
           L+PV++  ++NLR A+ KL+LNDAS  FE E S ALGFGFRCGFLGLLHLEI+QERLERE
Sbjct: 299 LYPVESHDYDNLRDALEKLQLNDASLKFEPEVSQALGFGFRCGFLGLLHLEIVQERLERE 358

Query: 368 FSLNLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEYLGSI 427
           F ++LI T+P+VVYEL + DG++ ++ NP  +P+ +KI E+REP I  TI+ P +Y+G++
Sbjct: 359 FDMDLITTAPTVVYELLLKDGTVIEVENPSKLPDPSKIEEIREPIITSTILVPQDYVGAV 418

Query: 428 LKLCQERRGIQIDMSHLDNRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDYRDS 487
           + LC ++RG+Q++M ++  + M+ Y+LP+NEV+ DF+D+LKS S+GYAS DY    ++ S
Sbjct: 419 MTLCNQKRGVQVNMQYMGRQVMLTYDLPMNEVVMDFFDKLKSTSRGYASLDYEFKCFQAS 478

Query: 488 DLVKLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGGRIIA 547
           DLVKL ++VN E +DALS++VHR  +  RGR +  K++ LIP+QMF IA+QAAIG  IIA
Sbjct: 479 DLVKLDVMVNGEKVDALSLIVHRQNAIYRGRELVSKMRELIPRQMFDIAVQAAIGNNIIA 538

Query: 548 RETVKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISILKTDNE 606
           RETVKA RK+V AKCYGGDITRK+KLLEKQK GK+RM++ G V+IPQ AF++IL+  ++
Sbjct: 539 RETVKALRKNVLAKCYGGDITRKKKLLEKQKAGKRRMKQVGNVEIPQEAFLAILQVSDK 597


>gi|218887803|ref|YP_002437124.1| GTP-binding protein LepA [Desulfovibrio vulgaris str. 'Miyazaki F']
 gi|226732756|sp|B8DIZ5|LEPA_DESVM RecName: Full=Elongation factor 4; Short=EF-4; AltName:
           Full=Ribosomal back-translocase LepA
 gi|218758757|gb|ACL09656.1| GTP-binding protein LepA [Desulfovibrio vulgaris str. 'Miyazaki F']
          Length = 601

 Score =  754 bits (1947), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 357/597 (59%), Positives = 463/597 (77%), Gaps = 3/597 (0%)

Query: 11  IRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVRLNY 70
           IRNFSI+AHIDHGKSTLADR ++    +++RE   Q LD M++ERERGITIKAQ+VR+ Y
Sbjct: 7   IRNFSIIAHIDHGKSTLADRILEVTGLVSDREKRDQYLDRMELERERGITIKAQSVRIPY 66

Query: 71  TSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQAIDNN 130
           T+ D + Y LNLIDTPGHVDF YEVSRSL+ACEG+LLVVDA+QGVEAQTLANVY A+D+N
Sbjct: 67  TAKDGRKYVLNLIDTPGHVDFNYEVSRSLAACEGALLVVDASQGVEAQTLANVYLALDHN 126

Query: 131 HEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERIVQQLPSP 190
            E+I VLNK DLPSAD DRVK +IEE+IG+   DA+ VSAKTG  +  +LE IV++LP+P
Sbjct: 127 LEVIPVLNKVDLPSADADRVKHEIEESIGLDCSDAVAVSAKTGLNVDKVLEAIVERLPAP 186

Query: 191 TSPEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVERIGILT 250
                 NAPLKAL+ DSWY+SY GV+VL RI++G L KG  I+L  T   Y+V R+G+ +
Sbjct: 187 EG--NLNAPLKALIFDSWYDSYQGVVVLFRIVDGVLRKGDRIKLFATERSYEVIRLGVFS 244

Query: 251 PKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVVFCGLFP 310
           P+++D+  L  GE+G + A+IKE+   +VGDTIT    P    + GFK +QP+VFCGL+P
Sbjct: 245 PEIVDMTELGAGEVGFLCANIKELGDAKVGDTITHVDRPAEVPVEGFKEVQPMVFCGLYP 304

Query: 311 VDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERLEREFSL 370
            D+  +E L+ A+ KL+LNDA+FS+E E S ALGFG+RCGFLGLLH+EIIQERLEREF +
Sbjct: 305 TDSADYEQLKYALEKLQLNDAAFSYEPETSQALGFGYRCGFLGLLHMEIIQERLEREFQV 364

Query: 371 NLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEYLGSILKL 430
            LI T+PSV+Y++   DG    + NP  +P+ TKIA L EP++++ I  PN+Y+G++LKL
Sbjct: 365 ELIATAPSVIYKIDTVDGKKSDIDNPSKLPDPTKIAALYEPYVRMDIHVPNDYVGNVLKL 424

Query: 431 CQERRGIQIDMSHL-DNRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDYRDSDL 489
           C+E+RGIQ +M ++  NR +I YELP  E++FDF+DRLKS +KGYAS DY  IDYR S L
Sbjct: 425 CEEKRGIQKNMGYIASNRVVITYELPFAEIVFDFFDRLKSGTKGYASMDYEFIDYRQSAL 484

Query: 490 VKLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGGRIIARE 549
           VKL IL+N E +DAL+++VHR  +   GR +  KLK  IP+QMF++AIQAAIG +IIARE
Sbjct: 485 VKLDILINGEAVDALAVIVHRDKAYHYGRALALKLKRTIPRQMFEVAIQAAIGQKIIARE 544

Query: 550 TVKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISILKTDNE 606
           ++ A RK+VTAKCYGGDITRKRKLLEKQKEGKKRM+R G V++PQ AF++ L+  +E
Sbjct: 545 SISALRKNVTAKCYGGDITRKRKLLEKQKEGKKRMKRMGNVELPQEAFLAALQVGDE 601


>gi|288941445|ref|YP_003443685.1| GTP-binding protein LepA [Allochromatium vinosum DSM 180]
 gi|288896817|gb|ADC62653.1| GTP-binding protein LepA [Allochromatium vinosum DSM 180]
          Length = 599

 Score =  754 bits (1946), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 358/598 (59%), Positives = 471/598 (78%), Gaps = 3/598 (0%)

Query: 6   TPLSRIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQT 65
           T LS IRNFSI+AHIDHGKST+ADRFIQ    LTEREMSSQVLD+MDIERERGITIKAQ+
Sbjct: 2   TDLSHIRNFSIIAHIDHGKSTIADRFIQISGALTEREMSSQVLDSMDIERERGITIKAQS 61

Query: 66  VRLNYTSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQ 125
           V LNY + D + YQLN IDTPGHVDF+YEVSRSL+ACEG+LLVVDA QGVEAQ++AN Y 
Sbjct: 62  VTLNYKARDGETYQLNFIDTPGHVDFSYEVSRSLAACEGALLVVDAAQGVEAQSVANCYT 121

Query: 126 AIDNNHEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERIVQ 185
           AI+   E++ VLNK DLPSA+P+RV K+IEE IG+  +DAL VSAKTG GIP LLE +V 
Sbjct: 122 AIEQGLEVLPVLNKIDLPSAEPERVIKEIEEIIGLEAQDALRVSAKTGVGIPDLLEALVA 181

Query: 186 QLPSPTSPEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVER 245
           ++P P       APL+AL+IDSW++ Y+GV+ LVR++NG++ +   + ++ T   +QV+ 
Sbjct: 182 RIPPPKG--DVAAPLQALIIDSWFDPYVGVVSLVRVMNGEIRRRDKVLMVSTGRTHQVDN 239

Query: 246 IGILTPKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVVF 305
           +G+ TPK  + + L  GE+G MIA IKE+    VGDTIT    P    LPGFK ++P VF
Sbjct: 240 VGVFTPKKTERDTLRAGEVGYMIAGIKEIDGAPVGDTITLPDRPG-EKLPGFKEMRPRVF 298

Query: 306 CGLFPVDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERLE 365
            GL+ V +  +E+LR A+ KLRLNDA+ ++E E S ALGFGFRCGFLG+LH+EIIQERLE
Sbjct: 299 AGLYTVISDDYEDLREALGKLRLNDAALNYEPEVSQALGFGFRCGFLGMLHMEIIQERLE 358

Query: 366 REFSLNLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEYLG 425
           RE++L+LI T+P+VVYE+   DG   ++ NP D+PE ++I E+REP I+  I+TP +YLG
Sbjct: 359 REYNLDLITTAPTVVYEVLRADGETVRIDNPADLPEPSQIREVREPIIEAHILTPQDYLG 418

Query: 426 SILKLCQERRGIQIDMSHLDNRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDYR 485
           +++ LC E+RGIQ ++ +L  +  + YELP++EV+ DF+DRLKS S+G+ASF+Y    ++
Sbjct: 419 AVINLCIEKRGIQKNIQYLGGQVQVTYELPMSEVVLDFFDRLKSCSRGFASFEYEFKRFQ 478

Query: 486 DSDLVKLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGGRI 545
            SDLVKL +L+N + +D+LS +VHRS+S+ RGR I E++K+LIP+QMF++AIQAAIG +I
Sbjct: 479 ASDLVKLDVLINGDKVDSLSSIVHRSLSQNRGRDITERMKDLIPRQMFEVAIQAAIGSKI 538

Query: 546 IARETVKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISILKT 603
           IAR TVKA RK+VTAKCYGGD TRKRKLLEKQKEGKKRM++ G+VDIPQ AF+++L++
Sbjct: 539 IARSTVKALRKNVTAKCYGGDATRKRKLLEKQKEGKKRMKQVGKVDIPQEAFLAVLQS 596


>gi|295695856|ref|YP_003589094.1| GTP-binding protein LepA [Bacillus tusciae DSM 2912]
 gi|295411458|gb|ADG05950.1| GTP-binding protein LepA [Bacillus tusciae DSM 2912]
          Length = 602

 Score =  753 bits (1944), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 349/596 (58%), Positives = 461/596 (77%), Gaps = 3/596 (0%)

Query: 10  RIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVRLN 69
           RIRNF I+AHIDHGKSTLADR +++   LT REM  QVLD MD+ERERGITIK Q VRL 
Sbjct: 9   RIRNFCIIAHIDHGKSTLADRILEYTGALTAREMHDQVLDQMDLERERGITIKLQAVRLE 68

Query: 70  YTSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQAIDN 129
           Y ++D + Y L+LIDTPGHVDF+YEVSRSL+ACEG+LLVVDA QG+EAQTLANVY A++N
Sbjct: 69  YRASDGETYILHLIDTPGHVDFSYEVSRSLAACEGALLVVDAAQGIEAQTLANVYLALEN 128

Query: 130 NHEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERIVQQLPS 189
           + EII V+NK DLPSA+PDRVK++IEE IG+  E A+L SAK G GI  +LE IV  +P+
Sbjct: 129 DLEIIPVINKIDLPSAEPDRVKREIEEVIGLDAEGAILASAKEGIGIREILEAIVHSVPA 188

Query: 190 PTSPEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVERIGIL 249
           P      +APL+AL+ DS Y++Y GV++ VR++NG L  G  IR+M T A+++V  +G  
Sbjct: 189 PAG--DPDAPLQALIFDSHYDAYKGVIIYVRVVNGTLRPGMKIRMMATGAEFEVVEVGTF 246

Query: 250 TPKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVVFCGLF 309
            PKM  +  L  G++G + A+IK V   RVGDT+TD   P    LPG++ I P+VFCGL+
Sbjct: 247 RPKMTSVPELSVGDVGFVAAAIKNVRDARVGDTVTDALRPAQEPLPGYRKIHPMVFCGLY 306

Query: 310 PVDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERLEREFS 369
           PVD+  +++LR A+ KL LNDAS S+E E S ALGFGFRCGFLGLLH+EI+QERLERE+ 
Sbjct: 307 PVDSNDYQDLREALEKLELNDASLSYEPETSGALGFGFRCGFLGLLHMEIVQERLEREYG 366

Query: 370 LNLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEYLGSILK 429
           L LI T+PSV+Y +Y   G M  + NP  MP+ ++I  + EP+++ +II P +++G++++
Sbjct: 367 LQLITTAPSVIYHVYTTAGEMIPVDNPSRMPDASRIERIEEPYVKASIIVPKDFVGTVME 426

Query: 430 LCQERRGIQIDMSHLD-NRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDYRDSD 488
           LCQE+RG   DM +LD NRA +VY LPL E+++DF+DRLKS +KGYASFDY +  YR SD
Sbjct: 427 LCQEKRGEFQDMQYLDENRATLVYNLPLTEIVYDFFDRLKSSTKGYASFDYELAGYRPSD 486

Query: 489 LVKLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGGRIIAR 548
           LV++ IL+N E +DALS +VHR  + +RGR +CE+LK LIP+Q+F++ IQA+IG R+IAR
Sbjct: 487 LVRMDILINGEPVDALSSIVHRDRAYQRGRALCERLKELIPRQLFEVPIQASIGNRVIAR 546

Query: 549 ETVKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISILKTD 604
           ET++A RK+V AKCYGGDITRKRKLLEKQ+EGKKRM++ G V+IPQ AF+++LK +
Sbjct: 547 ETIRAMRKNVLAKCYGGDITRKRKLLEKQREGKKRMKQVGNVEIPQEAFMAVLKME 602


>gi|224825220|ref|ZP_03698326.1| GTP-binding protein LepA [Lutiella nitroferrum 2002]
 gi|224602891|gb|EEG09068.1| GTP-binding protein LepA [Lutiella nitroferrum 2002]
          Length = 597

 Score =  753 bits (1944), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 351/600 (58%), Positives = 473/600 (78%), Gaps = 4/600 (0%)

Query: 8   LSRIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVR 67
           +  IRNFSI+AHIDHGKSTLADRFIQ C GL  REMS+QVLD+MDIE+ERGITIKAQT  
Sbjct: 1   MKHIRNFSIIAHIDHGKSTLADRFIQFCGGLEMREMSAQVLDSMDIEKERGITIKAQTAA 60

Query: 68  LNYTSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQAI 127
           L Y + D + Y LNLIDTPGHVDF+YEVSRSLSACEG+LLVVDA+QGVEAQT+AN Y AI
Sbjct: 61  LQYKARDGQVYNLNLIDTPGHVDFSYEVSRSLSACEGALLVVDASQGVEAQTVANCYTAI 120

Query: 128 DNNHEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERIVQQL 187
           +   E++ VLNK DLP+A+P+RV ++IE+ IGI   DA+  SAK+G GI  +LE ++ ++
Sbjct: 121 ELGVEVVPVLNKIDLPAAEPERVSQEIEDIIGIEAIDAVRASAKSGIGIEDILETVISKI 180

Query: 188 PSPT-SPEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVERI 246
           P P  +P+G   PLKAL+IDSW+++Y+GV++LVR+I+G L     I+ M T A++  E++
Sbjct: 181 PPPEGNPDG---PLKALIIDSWFDNYVGVVMLVRVIDGSLKPKDKIKFMATGAEHLCEQV 237

Query: 247 GILTPKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVVFC 306
           G+ TPK +   +L  GE+G +IA IKE+   +VGDTIT  ++P + ALPGFK +Q  VF 
Sbjct: 238 GVFTPKSVQRPSLSAGEVGFVIAGIKELKSAKVGDTITLVNNPASEALPGFKEVQSQVFA 297

Query: 307 GLFPVDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERLER 366
           GL+PV++  +++LR A+ KL+LNDAS  FE E S ALGFGFRCGFLGLLHLEI+QERLER
Sbjct: 298 GLYPVESHDYDSLRDALEKLQLNDASLKFEPEVSQALGFGFRCGFLGLLHLEIVQERLER 357

Query: 367 EFSLNLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEYLGS 426
           EF ++LI T+P+VVYE+ M DG++ ++ NP  +P+++KI E+REP I  TI+ P +Y+G+
Sbjct: 358 EFDMDLITTAPTVVYEVLMKDGTVIEVENPSKLPDLSKIDEIREPIITSTILVPQDYVGA 417

Query: 427 ILKLCQERRGIQIDMSHLDNRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDYRD 486
           ++ LC ++RG+Q +M ++  + M+ YELP+NEV+ DF+D+LKS S+GYAS DY   +++ 
Sbjct: 418 VMTLCNQKRGVQRNMQYMGRQVMLTYELPMNEVVMDFFDKLKSTSRGYASLDYEFKEFQA 477

Query: 487 SDLVKLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGGRII 546
           +DLVKL ILVN+E +DALS++VHR+ S+ RGR +  K++ LIP+QMF IA+QAAIG  II
Sbjct: 478 ADLVKLDILVNSEKVDALSLIVHRATSQYRGRELASKMRELIPRQMFDIAVQAAIGSHII 537

Query: 547 ARETVKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISILKTDNE 606
           ARET+KA RK+V AKCYGGDITRK+KLLEKQK GKKRM++ G V+IPQ AF++IL+  ++
Sbjct: 538 ARETIKALRKNVLAKCYGGDITRKKKLLEKQKAGKKRMKQVGNVEIPQEAFLAILQVGDK 597


>gi|253700944|ref|YP_003022133.1| GTP-binding protein LepA [Geobacter sp. M21]
 gi|259494312|sp|C6DZ67|LEPA_GEOSM RecName: Full=Elongation factor 4; Short=EF-4; AltName:
           Full=Ribosomal back-translocase LepA
 gi|251775794|gb|ACT18375.1| GTP-binding protein LepA [Geobacter sp. M21]
          Length = 599

 Score =  753 bits (1944), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 354/599 (59%), Positives = 464/599 (77%), Gaps = 3/599 (0%)

Query: 8   LSRIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVR 67
           +  IRNFSI+AHIDHGKSTLADR ++    ++ RE   Q LD MD+ERERGITIKAQTVR
Sbjct: 3   IEHIRNFSIIAHIDHGKSTLADRLLEFTGTVSSREKQDQFLDKMDLERERGITIKAQTVR 62

Query: 68  LNYTSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQAI 127
           LNY + D KDY LNLIDTPGHVDFTYEVSRSL+ACEG LLVVDA+QGVEAQTLANVY A+
Sbjct: 63  LNYRADDGKDYVLNLIDTPGHVDFTYEVSRSLTACEGGLLVVDASQGVEAQTLANVYLAL 122

Query: 128 DNNHEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERIVQQL 187
           D N E+  VLNK DLP+A+P+RVK +IEE IG+ T DA+L SAK G G   +LE IV+++
Sbjct: 123 DANLEVFVVLNKIDLPAAEPERVKAEIEEIIGLDTHDAVLASAKEGIGTKDILEEIVKKI 182

Query: 188 PSPTSPEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVERIG 247
           P P        PLKALL DSWY+ Y GV++LVRI++G + KG  I+LM     ++V + G
Sbjct: 183 PPPQGDPAK--PLKALLFDSWYDQYQGVIILVRIVDGVVKKGDKIQLMSNKKTHEVLKAG 240

Query: 248 ILTPKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVVFCG 307
           + +P+M + + L  GE+G +IA I+EV+  +VGDT+T   +P  +AL G+K ++P+VF G
Sbjct: 241 VFSPEMRETQQLCAGEVGFIIAGIREVADAKVGDTVTLLHNPCDAALAGYKEVKPMVFSG 300

Query: 308 LFPVDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERLERE 367
           L+P+D +Q+E LR A+ KL+LND+SFS++ E S ALGFGFRCGFLGLLH+EIIQERLERE
Sbjct: 301 LYPIDTSQYEQLRDALAKLKLNDSSFSYDPETSLALGFGFRCGFLGLLHMEIIQERLERE 360

Query: 368 FSLNLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEYLGSI 427
           F+L LI T+P+VVY ++  DGS+  + +   +P   +IA + EP+I  +I  PN+++G I
Sbjct: 361 FNLELITTAPTVVYRVHGTDGSLTTIQSANQLPPTQEIAYVEEPFILASIHVPNDFVGGI 420

Query: 428 LKLCQERRGIQIDMSHLD-NRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDYRD 486
           L LC+E+RG+Q ++ +L   R M+VYELPLNEV+ DFYDRLKS++KGYAS DY ++DYR 
Sbjct: 421 LALCEEKRGVQREIKYLTPTRVMVVYELPLNEVVLDFYDRLKSITKGYASLDYELLDYRQ 480

Query: 487 SDLVKLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGGRII 546
           S+LV+L I++N E +DALS+++H+  +  RGR +  K+K LIP+QMF+IAIQAA+G ++I
Sbjct: 481 SELVRLNIMINGEVVDALSLIIHKDKAYYRGRELVSKMKELIPRQMFEIAIQAAVGTKVI 540

Query: 547 ARETVKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISILKTDN 605
           ARETVKA RKDV AKCYGGDITRKRKLLEKQKEGKKRM+  G V++PQ AF++ILK + 
Sbjct: 541 ARETVKAMRKDVLAKCYGGDITRKRKLLEKQKEGKKRMKNVGNVELPQEAFLAILKVEG 599


>gi|297539128|ref|YP_003674897.1| GTP-binding protein LepA [Methylotenera sp. 301]
 gi|297258475|gb|ADI30320.1| GTP-binding protein LepA [Methylotenera sp. 301]
          Length = 596

 Score =  753 bits (1944), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 347/598 (58%), Positives = 464/598 (77%), Gaps = 2/598 (0%)

Query: 8   LSRIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVR 67
           +  IRNFSI+AHIDHGKSTLADR I  C GL +REM +QVLD+MDIERERGITIKAQT  
Sbjct: 1   MKNIRNFSIIAHIDHGKSTLADRIIHLCGGLADREMEAQVLDSMDIERERGITIKAQTAA 60

Query: 68  LNYTSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQAI 127
           L Y + D + Y LNLIDTPGHVDF+YEVSRSLSACEG+LLVVDA+QGVEAQ++AN Y A+
Sbjct: 61  LQYKADDGQIYNLNLIDTPGHVDFSYEVSRSLSACEGALLVVDASQGVEAQSVANCYTAL 120

Query: 128 DNNHEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERIVQQL 187
           D   E+  VLNK DLPSADP+RV ++IE+ IGI   DA+  SAKTG G+  +LE +++++
Sbjct: 121 DLGVEVTAVLNKIDLPSADPERVMQEIEDVIGIDASDAVRCSAKTGLGVRDVLEAVIKKV 180

Query: 188 PSPTSPEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVERIG 247
           P P        PLKAL+ID+W+++Y+GV++LVR+I+G L     IRLM T+A+Y  E++G
Sbjct: 181 PPPVG--DVTKPLKALVIDAWFDNYVGVVMLVRVIDGVLKPKDKIRLMATHAEYLCEQVG 238

Query: 248 ILTPKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVVFCG 307
           + TPK +   +L  GE+G +I+ IKE++  +VGDT+T    P    L GFK ++P VF G
Sbjct: 239 VFTPKSLQKTSLSAGEVGFVISGIKELAAAKVGDTVTLAGKPAAEPLAGFKEVKPQVFAG 298

Query: 308 LFPVDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERLERE 367
           L+PV++ QFE LRTA+ KL LNDAS  FE ENSTALGFGFRCGFLGLLH+EI+QERLERE
Sbjct: 299 LYPVESNQFEALRTALEKLSLNDASLLFEPENSTALGFGFRCGFLGLLHMEIVQERLERE 358

Query: 368 FSLNLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEYLGSI 427
           + ++LI T+P+VVYEL +  G + ++ NP  +PE++++ E REP I V ++ P +Y+G +
Sbjct: 359 YDMDLITTAPTVVYELLLKSGEVVQIENPSRLPELSRVEETREPVINVNLLMPQDYVGPV 418

Query: 428 LKLCQERRGIQIDMSHLDNRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDYRDS 487
           + LC  +RG+Q +M ++  + M+ YE+PLNEV+ DF+D+LKSVS+GYAS DY  +++R +
Sbjct: 419 MTLCNNKRGLQKNMQYMGRQVMLSYEMPLNEVVLDFFDKLKSVSRGYASMDYEFLEFRAA 478

Query: 488 DLVKLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGGRIIA 547
           DLVKL I+VN E +DALS++VHR  S +RGR +  K++ LIP+QMF +AIQA+IG  IIA
Sbjct: 479 DLVKLDIMVNGERVDALSMIVHRGNSVRRGREVAAKMRELIPRQMFDVAIQASIGANIIA 538

Query: 548 RETVKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISILKTDN 605
           RETVKA RK+V AKCYGGD++RKRKLL+KQKEGKKRM++ G V+IPQ AF++IL+ ++
Sbjct: 539 RETVKAMRKNVIAKCYGGDVSRKRKLLDKQKEGKKRMKQVGNVEIPQEAFLAILRIED 596


>gi|332981293|ref|YP_004462734.1| GTP-binding protein LepA [Mahella australiensis 50-1 BON]
 gi|332698971|gb|AEE95912.1| GTP-binding protein LepA [Mahella australiensis 50-1 BON]
          Length = 598

 Score =  753 bits (1944), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 352/595 (59%), Positives = 461/595 (77%), Gaps = 3/595 (0%)

Query: 11  IRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVRLNY 70
           IRNF I+AHIDHGKSTLADR I+    + +R+M +Q+LD M+IERERGITIKAQ VRL Y
Sbjct: 6   IRNFCIIAHIDHGKSTLADRLIERTGAVAQRDMQAQLLDTMEIERERGITIKAQAVRLAY 65

Query: 71  TSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQAIDNN 130
            + D   YQLNLIDTPGHVDFTYEVSRSL+ACEG++LVVDATQG+EAQTLANVY A++++
Sbjct: 66  RAKDGNIYQLNLIDTPGHVDFTYEVSRSLAACEGAVLVVDATQGIEAQTLANVYLAMEHD 125

Query: 131 HEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERIVQQLPSP 190
            EII V+NK DLPSADPD V+++IEE +G+   DA L+SAK G GI  +LE+IVQ++P P
Sbjct: 126 LEIIPVINKIDLPSADPDMVRREIEEVLGLDAADAPLISAKMGTGIEEVLEQIVQRIPPP 185

Query: 191 TSPEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVERIGILT 250
           T  E  +APLKAL+ DS+Y+ Y G +  VR+ +G +  G +I++M +   + V  +G+  
Sbjct: 186 TGNE--SAPLKALIFDSYYDPYKGAVAYVRVKDGYIQPGMTIKMMSSGMTFDVTEVGVFA 243

Query: 251 PKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVVFCGLFP 310
           P++  IE L  GE+G + AS+K+V  TRVGDTITD   P    LPG+K + P+V+CG++P
Sbjct: 244 PRLQPIERLSVGEVGYVAASMKDVRDTRVGDTITDADHPADKPLPGYKKVTPMVYCGIYP 303

Query: 311 VDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERLEREFSL 370
            D   +E+LR A+ KL+LNDA+  FE ENS ALGFGFRCGFLGLLH+EI+QERLERE+ +
Sbjct: 304 ADGAHYEDLRDALEKLQLNDAALVFEPENSAALGFGFRCGFLGLLHMEIVQERLEREYDM 363

Query: 371 NLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEYLGSILKL 430
           +L+ T+PSV+Y +   DGS   L NP +MP  T+I  + EP ++  I+TP++Y+G+I++L
Sbjct: 364 DLVTTAPSVIYRIVKTDGSEMMLDNPTNMPPTTEIDHIEEPVVEAQIMTPSDYVGAIMEL 423

Query: 431 CQERRGIQIDMSHLD-NRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDYRDSDL 489
           CQERRG+  DMS+LD  R M+ YELPLNE+IF+F+D LKS ++GYAS DY +  Y+++DL
Sbjct: 424 CQERRGVFKDMSYLDEKRVMLRYELPLNEIIFNFFDALKSRTRGYASLDYELKGYKEADL 483

Query: 490 VKLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGGRIIARE 549
           VKL IL+N E +DALS +VHR  +  RGR I EKLK +IP+Q+F+I IQAAIG +IIARE
Sbjct: 484 VKLDILLNGEVVDALSTIVHRDKAYARGRAIAEKLKEVIPRQLFEIPIQAAIGQKIIARE 543

Query: 550 TVKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISILKTD 604
           TV A RKDV AKCYGGD+TRKRKLLEKQKEGKKRMR+ G V++PQ AF+++LK D
Sbjct: 544 TVSALRKDVLAKCYGGDVTRKRKLLEKQKEGKKRMRQVGSVELPQEAFMAVLKVD 598


>gi|323144167|ref|ZP_08078803.1| GTP-binding protein LepA [Succinatimonas hippei YIT 12066]
 gi|322416075|gb|EFY06773.1| GTP-binding protein LepA [Succinatimonas hippei YIT 12066]
          Length = 603

 Score =  753 bits (1943), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 358/598 (59%), Positives = 455/598 (76%), Gaps = 2/598 (0%)

Query: 9   SRIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVRL 68
           S +RNFSI+AHIDHGKSTL+DRFIQ C GLTEREM SQVLD+MDIERERGITIKAQ V L
Sbjct: 8   SFVRNFSIIAHIDHGKSTLSDRFIQECGGLTEREMQSQVLDSMDIERERGITIKAQAVTL 67

Query: 69  NYTSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQAID 128
            Y + D   Y+LN IDTPGHVDF+YEVSRSL ACEG+LLVVDA QGVEAQTLAN YQAID
Sbjct: 68  KYKAKDNNIYELNFIDTPGHVDFSYEVSRSLFACEGALLVVDAGQGVEAQTLANCYQAID 127

Query: 129 NNHEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERIVQQLP 188
            N E+I VLNK DLP+ADPD+V  +IE+ +GI   DA   SAKTG G+  +LER+V+ +P
Sbjct: 128 LNLEVIPVLNKIDLPAADPDKVIDEIEDIVGIEAHDACRCSAKTGVGVIDVLERLVEMVP 187

Query: 189 SPTSPEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVERIGI 248
            P      NAPL+AL+IDS+++ YLGV+ LVR+ NG L KG  I++M T   + VER+GI
Sbjct: 188 PPKG--DPNAPLQALIIDSYFDDYLGVVSLVRVKNGTLKKGDKIKVMSTGQNWDVERLGI 245

Query: 249 LTPKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVVFCGL 308
            TPK +D++ L  GE+G ++  IK +    VGDTIT   +P  + LPGFK  +P V+ G+
Sbjct: 246 STPKRVDVDVLNCGEVGWVVCGIKTIHGAPVGDTITHARNPAEAPLPGFKKAKPQVYAGM 305

Query: 309 FPVDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERLEREF 368
           FPVD   +   R A++KL LNDAS  FE ENS ALGFGFRCGFLG+LH+EIIQERLERE+
Sbjct: 306 FPVDTDDYNAFRDALDKLSLNDASLFFEPENSQALGFGFRCGFLGMLHMEIIQERLEREY 365

Query: 369 SLNLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEYLGSIL 428
           +LNLI T+P+VVYE+ +  G    + +P  +P ++ I+E+REP  +  ++ P  Y+G ++
Sbjct: 366 NLNLITTAPTVVYEILLTSGETIHIDSPAALPPISNISEIREPIAECRMLMPTGYVGPVM 425

Query: 429 KLCQERRGIQIDMSHLDNRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDYRDSD 488
            LCQE+RG+Q  M +  ++  + YELP++EV+ DF+DRLKSVS+GYAS DY    +   D
Sbjct: 426 TLCQEKRGVQTSMVYHGDQVALTYELPMSEVVLDFFDRLKSVSRGYASLDYGFKRFERGD 485

Query: 489 LVKLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGGRIIAR 548
           LV++ IL+ NE +DAL+I+VHRS+++ RGR + EK+K LIP+QMF IAIQAAIGG+IIAR
Sbjct: 486 LVRVDILIANERVDALAIIVHRSIAQSRGRALVEKMKELIPRQMFDIAIQAAIGGQIIAR 545

Query: 549 ETVKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISILKTDNE 606
            TVKA RKDV AKCYGGDITRKRKLLEKQK GKKRM++ GRV++PQ AF++ILK   E
Sbjct: 546 CTVKALRKDVLAKCYGGDITRKRKLLEKQKAGKKRMKQLGRVEVPQEAFLAILKVGKE 603


>gi|237746718|ref|ZP_04577198.1| GTP-binding protein lepA [Oxalobacter formigenes HOxBLS]
 gi|229378069|gb|EEO28160.1| GTP-binding protein lepA [Oxalobacter formigenes HOxBLS]
          Length = 597

 Score =  752 bits (1942), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 349/600 (58%), Positives = 465/600 (77%), Gaps = 4/600 (0%)

Query: 8   LSRIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVR 67
           +  IRNFSI+AHIDHGKSTLADR IQ C GL++REM +QVLD+MD+ERERGITIKAQT  
Sbjct: 1   MKNIRNFSIIAHIDHGKSTLADRIIQLCGGLSDREMEAQVLDSMDLERERGITIKAQTAA 60

Query: 68  LNYTSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQAI 127
           L+Y + D + Y LNLIDTPGHVDF+YEVSRSLSACEG+LLVVDA+QGVEAQT+AN Y A+
Sbjct: 61  LHYKARDGQTYNLNLIDTPGHVDFSYEVSRSLSACEGALLVVDASQGVEAQTVANCYTAL 120

Query: 128 DNNHEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERIVQQL 187
           D N E++ VLNK DLPSADPD  + +IE+ IGI   +A+L SAKTG+G+  +LE I+ ++
Sbjct: 121 DLNVEVLPVLNKIDLPSADPDNARAEIEDVIGIEATEAVLCSAKTGQGVEDILEAIIARV 180

Query: 188 PSPTS-PEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVERI 246
           P P   PE   APL+AL+IDSW+++Y+GV++LVRI NG L   + IRLM T ++Y VE +
Sbjct: 181 PPPEGDPE---APLQALIIDSWFDNYVGVVMLVRIKNGTLKPREKIRLMATGSEYLVENV 237

Query: 247 GILTPKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVVFC 306
           G+ +P+    EAL  G++G +IA IKE+   +VGDT+T  S P    LPGFK +QP VF 
Sbjct: 238 GVFSPRSQSKEALSAGQVGFVIAGIKELKAAKVGDTMTLASRPAGEPLPGFKEVQPQVFA 297

Query: 307 GLFPVDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERLER 366
           GLFPV+A Q++ LR ++ KL+LNDA+  +E E S ALGFGFRCGFLGLLH+EI+QERLER
Sbjct: 298 GLFPVEANQYDALRDSLEKLKLNDAALQYEPEVSQALGFGFRCGFLGLLHMEIVQERLER 357

Query: 367 EFSLNLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEYLGS 426
           EF ++LI T+P+VVYE+ + +G + K+ NP  MP+  +I E+REP + V +  P EY+G 
Sbjct: 358 EFDMDLITTAPTVVYEVVLKNGEVLKVDNPSKMPDPGRIEEIREPIVTVNLYMPQEYVGP 417

Query: 427 ILKLCQERRGIQIDMSHLDNRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDYRD 486
           ++ LC ++RGIQ+DM +   +  + YELP+ E++ DF+DR+KS+S+GYAS +Y   +YR 
Sbjct: 418 VMTLCNQKRGIQVDMHYHGKQVRLTYELPMAEIVLDFFDRMKSISRGYASMEYEFKEYRA 477

Query: 487 SDLVKLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGGRII 546
           SD+VK+ +L+N E +DAL+I+VHR+ S+ RGR +  K++ LIP+QMF +AIQAAIG  II
Sbjct: 478 SDVVKVDMLINGEKVDALAIIVHRANSQFRGRAVAAKMRQLIPRQMFDVAIQAAIGSTII 537

Query: 547 ARETVKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISILKTDNE 606
           +RE VKA RK+V AKCYGGDITRKRKLLEKQK GKKRM++ G V++PQ AF++IL+ D +
Sbjct: 538 SRENVKALRKNVLAKCYGGDITRKRKLLEKQKAGKKRMKQVGSVEVPQEAFLAILQVDEK 597


>gi|253574645|ref|ZP_04851985.1| GTP-binding protein LepA [Paenibacillus sp. oral taxon 786 str.
           D14]
 gi|251845691|gb|EES73699.1| GTP-binding protein LepA [Paenibacillus sp. oral taxon 786 str.
           D14]
          Length = 605

 Score =  752 bits (1941), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 345/598 (57%), Positives = 471/598 (78%), Gaps = 3/598 (0%)

Query: 9   SRIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVRL 68
           ++IRNF I+AHIDHGKSTLADR +++   LT REM  QVLD MD+ERERGITIK Q VRL
Sbjct: 9   AKIRNFCIIAHIDHGKSTLADRILEYTGALTSREMQDQVLDQMDLERERGITIKLQAVRL 68

Query: 69  NYTSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQAID 128
           NY + D ++Y LNLIDTPGHVDFTYEVSRSL+ACEG+LLVVDA QG+EAQTLANVY A+D
Sbjct: 69  NYRADDGEEYVLNLIDTPGHVDFTYEVSRSLAACEGALLVVDAAQGIEAQTLANVYLALD 128

Query: 129 NNHEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERIVQQLP 188
           NN EI+ V+NK DLPSADPDRVK++IE+ IG+   +A+  SAK G GI  +LE++VQ++P
Sbjct: 129 NNLEILPVINKIDLPSADPDRVKQEIEDVIGLDASEAVHASAKAGIGIKEILEQVVQKVP 188

Query: 189 SPTSPEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVERIGI 248
           +PT     + PLKAL+ DS Y+ Y GV+V VR+I+G++  G  I++M T+  ++V  +G 
Sbjct: 189 APTG--DPDKPLKALIFDSHYDPYKGVIVYVRVIDGKIKAGSKIKMMATDKTFEVIEVGA 246

Query: 249 LTPKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVVFCGL 308
             P+M  ++ L  G++G ++A IK V  TRVGDT+TD  +PT   LPG++ I P+V+CGL
Sbjct: 247 FKPRMTIVDELNVGDVGFIVAGIKTVGDTRVGDTVTDAKNPTPEPLPGYRKINPMVYCGL 306

Query: 309 FPVDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERLEREF 368
           +P++ + + +LR A+ KL+LNDAS SFE E S+ALGFGFRCGFLGLLH+++IQER+EREF
Sbjct: 307 YPIETSDYNDLREALEKLQLNDASLSFEPETSSALGFGFRCGFLGLLHMDVIQERIEREF 366

Query: 369 SLNLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEYLGSIL 428
           ++ LI T+PSV+Y++ + +G    + NP + PEV KI  + EP+++ +II PN+Y+G+++
Sbjct: 367 NIPLITTAPSVIYKVTLTNGETISIDNPSNYPEVGKIDYVEEPYVKASIIVPNDYVGTVM 426

Query: 429 KLCQERRGIQIDMSHLD-NRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDYRDS 487
           +LCQ +RG  ++M +LD  R  I Y++PL+E+++DF+D+LKS +KGYASFDY +  YR S
Sbjct: 427 ELCQSKRGEFVNMEYLDTTRVTITYQVPLSEIVYDFFDQLKSSTKGYASFDYELSGYRRS 486

Query: 488 DLVKLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGGRIIA 547
           +LVK+ IL+N E +DALS +VHR  +  RGR ICEKL+ LIP+QMF++ IQA+IG ++IA
Sbjct: 487 NLVKMDILLNGEQVDALSFIVHRDRAYHRGRIICEKLRELIPRQMFEVPIQASIGTKVIA 546

Query: 548 RETVKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISILKTDN 605
           RETVKA RK+V AKCYGGDI+RKRKLLEKQKEGKKRM++ G V++PQ AF+++LK D+
Sbjct: 547 RETVKAMRKNVLAKCYGGDISRKRKLLEKQKEGKKRMKQVGSVEVPQEAFMAVLKIDD 604


>gi|94987162|ref|YP_595095.1| GTP-binding protein LepA [Lawsonia intracellularis PHE/MN1-00]
 gi|119371362|sp|Q1MQF3|LEPA_LAWIP RecName: Full=Elongation factor 4; Short=EF-4; AltName:
           Full=Ribosomal back-translocase LepA
 gi|94731411|emb|CAJ54774.1| membrane GTPase LepA [Lawsonia intracellularis PHE/MN1-00]
          Length = 606

 Score =  751 bits (1940), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 352/597 (58%), Positives = 466/597 (78%), Gaps = 3/597 (0%)

Query: 11  IRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVRLNY 70
           IRNFSI+AHIDHGKSTLADR +++   +++RE   Q LD M++ERERGITIKAQTVR+ Y
Sbjct: 12  IRNFSIIAHIDHGKSTLADRILEYTNLVSDREKRDQYLDKMELERERGITIKAQTVRIPY 71

Query: 71  TSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQAIDNN 130
            + D K Y LNLIDTPGHVDF YEVSRSLSACEGSLLV+D TQGVEAQTLANVY A+++N
Sbjct: 72  ITADGKTYILNLIDTPGHVDFNYEVSRSLSACEGSLLVIDTTQGVEAQTLANVYLALEHN 131

Query: 131 HEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERIVQQLPSP 190
           HE+I +LNK DLPSAD ++VK +IEETIG+    A+ +SAKTG G+  +LE IVQQLP+P
Sbjct: 132 HEVIPILNKIDLPSADIEKVKAEIEETIGLDCSTAISISAKTGLGVDSVLEAIVQQLPAP 191

Query: 191 TSPEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVERIGILT 250
                 N PLKAL+ DSWY++Y GV+VL RI++G + K   I+L  T   Y++ R+G+ +
Sbjct: 192 KG--DPNNPLKALIFDSWYDAYQGVVVLFRIMDGTIKKNDIIKLFSTEKSYEITRLGVFS 249

Query: 251 PKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVVFCGLFP 310
           P+ IDI  L  GE+G +  +IK +   +VGDTIT   +P T A+PGFK IQPVVFCGL+P
Sbjct: 250 PEAIDIPQLSAGEVGFLCGNIKTLGDAKVGDTITLLHNPCTKAIPGFKEIQPVVFCGLYP 309

Query: 311 VDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERLEREFSL 370
            +++ ++ L+ A+ KL+LNDA+FS+E E S ALGFGFRCGFLGLLH+EIIQERLEREF +
Sbjct: 310 SESSDYDILKAALEKLQLNDAAFSWEPETSQALGFGFRCGFLGLLHMEIIQERLEREFQV 369

Query: 371 NLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEYLGSILKL 430
            LI T+PSV+Y++   DG +Q++ NP  +PE+ KI  L EP++ + I  P+E++G++LKL
Sbjct: 370 ELIATAPSVIYKVETTDGKIQEIDNPSKLPELGKIVHLYEPYVHIDIHVPSEFVGNVLKL 429

Query: 431 CQERRGIQIDMSH-LDNRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDYRDSDL 489
           C+E+RGIQ ++++    R +I YELP +E++FDF+DRLKS +KGYAS DY VIDYR S+L
Sbjct: 430 CEEKRGIQKNIAYPAQQRVIITYELPFSEIVFDFFDRLKSATKGYASMDYEVIDYRISNL 489

Query: 490 VKLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGGRIIARE 549
           V+L IL+N E +DAL+++VHR  +   GR +  KLK  IP+QMF++AIQAAIG ++IARE
Sbjct: 490 VRLDILLNGEPVDALAVIVHRDKAYHYGRSLAIKLKKTIPRQMFEVAIQAAIGQKVIARE 549

Query: 550 TVKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISILKTDNE 606
           ++ A RK+VTAKCYGGDITRKRKLLEKQKEGKKRM+R G V++PQ AF++ L+  ++
Sbjct: 550 SISALRKNVTAKCYGGDITRKRKLLEKQKEGKKRMKRMGNVELPQEAFLAALQMGDD 606


>gi|239908581|ref|YP_002955323.1| GTP-binding protein LepA [Desulfovibrio magneticus RS-1]
 gi|239798448|dbj|BAH77437.1| GTP-binding protein LepA [Desulfovibrio magneticus RS-1]
          Length = 600

 Score =  751 bits (1939), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 355/599 (59%), Positives = 462/599 (77%), Gaps = 3/599 (0%)

Query: 9   SRIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVRL 68
           SRIRNFSI+AHIDHGKSTLADR ++    +T REM  Q LD MD+ERERGITIKAQTVR+
Sbjct: 4   SRIRNFSIIAHIDHGKSTLADRILELTGVITAREMREQYLDRMDLERERGITIKAQTVRI 63

Query: 69  NYTSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQAID 128
            Y + D KDY LNLIDTPGHVDF+YEVSRSL+ACEG+LLVVDATQGVEAQTLANV+ A+D
Sbjct: 64  PYKAADGKDYILNLIDTPGHVDFSYEVSRSLAACEGALLVVDATQGVEAQTLANVFLALD 123

Query: 129 NNHEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERIVQQLP 188
           N+ EII VLNK DLPSADP+ VKK IEE IGI   DA+ VSAKTG  +  +LE+I+ ++P
Sbjct: 124 NDLEIIPVLNKIDLPSADPEAVKKDIEEAIGIPCADAVSVSAKTGANVGAVLEQIIARIP 183

Query: 189 SPTSPEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVERIGI 248
            P     A+AP +AL++DSWY+SY GV+VL R++ G +  GQ IR+M T A ++V R+G 
Sbjct: 184 PPKGQ--ADAPFRALVVDSWYDSYQGVVVLFRVMEGSVRLGQRIRMMSTGADFEVIRLGA 241

Query: 249 LTPKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVVFCGL 308
            +P  +DI +  PGE G + A+IK ++  RVGDT+T   +P   ALPGFK ++P+VFCGL
Sbjct: 242 FSPGPVDIPSFGPGEAGFLCANIKTLTDARVGDTVTLAENPAAEALPGFKEVKPMVFCGL 301

Query: 309 FPVDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERLEREF 368
           +PVDA ++E L+ A+ KLRLNDA+F++E E S ALGFGFRCGFLGLLH+EIIQERLEREF
Sbjct: 302 YPVDAAEYEVLKGALEKLRLNDAAFTYEPETSQALGFGFRCGFLGLLHMEIIQERLEREF 361

Query: 369 SLNLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEYLGSIL 428
             NLI T+PSVVY++    G++  + NP  +P+  +IA L EP+ ++ I TPNEY+G + 
Sbjct: 362 GANLIATAPSVVYKVETLSGAVIPVDNPSKLPKTQEIAALYEPFARLEIHTPNEYVGGVF 421

Query: 429 KLCQERRGIQIDMSHLD-NRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDYRDS 487
           KLC+E+RGIQ D+ +L   R +I YELP  E+++DF+DRLKS ++GYAS DY ++DYR S
Sbjct: 422 KLCEEKRGIQKDVRYLTATRVIITYELPFAEIVYDFFDRLKSATRGYASLDYEIVDYRAS 481

Query: 488 DLVKLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGGRIIA 547
           DLVKL I++N + +DAL+++VHR  +   GR +  +LK +IP+Q+F++ IQAAIG +IIA
Sbjct: 482 DLVKLDIMINGDPVDALAVIVHRENAYHYGRALALRLKRVIPRQLFEVIIQAAIGTKIIA 541

Query: 548 RETVKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISILKTDNE 606
           RE      K+V AKCYGGDITRKRKLLEKQKEGKKRM+R G V++PQ AF++ L+  ++
Sbjct: 542 RERNAPVGKNVIAKCYGGDITRKRKLLEKQKEGKKRMKRMGNVELPQEAFLAALRAGDD 600


>gi|325981697|ref|YP_004294099.1| GTP-binding protein LepA [Nitrosomonas sp. AL212]
 gi|325531216|gb|ADZ25937.1| GTP-binding protein LepA [Nitrosomonas sp. AL212]
          Length = 597

 Score =  751 bits (1939), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 345/599 (57%), Positives = 471/599 (78%), Gaps = 2/599 (0%)

Query: 8   LSRIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVR 67
           +  IRNFSI+AHIDHGKSTLADR I  C GL++REM +QVLD+MD+ERERGITIKAQT  
Sbjct: 1   MQHIRNFSIIAHIDHGKSTLADRIIHLCGGLSDREMEAQVLDSMDLERERGITIKAQTAA 60

Query: 68  LNYTSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQAI 127
           L+Y + + + Y LNLIDTPGHVDF+YEVSRSL+ACEG+LLVVDA+QGVEAQT+AN Y AI
Sbjct: 61  LHYKAKNGEIYLLNLIDTPGHVDFSYEVSRSLAACEGALLVVDASQGVEAQTVANCYTAI 120

Query: 128 DNNHEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERIVQQL 187
           + + E++ VLNK DLP+ADP+RV   IEE IGI  +DA+ +SAKTGEG+  +LE ++ ++
Sbjct: 121 EQDVEVVPVLNKIDLPAADPERVISNIEEVIGIDAQDAVKISAKTGEGVEDVLEALIAKI 180

Query: 188 PSPTSPEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVERIG 247
           P+P      NAPLKAL+IDSW+++Y+GV++LVR+++G +  G  I LM + +    E++G
Sbjct: 181 PAPKG--DPNAPLKALIIDSWFDNYVGVVILVRVMDGTVKPGDKILLMASKSVQLCEQVG 238

Query: 248 ILTPKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVVFCG 307
           +  PK    ++L  GE+G +I+ IKE++  +VGDT+T    P  + L GFK I+P VF G
Sbjct: 239 VFVPKSAYRDSLSAGEVGFIISGIKELNIAKVGDTVTSAIHPAANPLQGFKEIKPQVFAG 298

Query: 308 LFPVDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERLERE 367
           L+PV++ Q++ LR+A+ KL+LND+S  FE E S ALGFGFRCGFLGLLH++I+QERLERE
Sbjct: 299 LYPVESNQYDALRSALEKLKLNDSSLHFEPEVSQALGFGFRCGFLGLLHMDIVQERLERE 358

Query: 368 FSLNLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEYLGSI 427
           + ++LI T+P+VVY++ M D ++ ++ NP  +P+++KIAE+REP I  TII P EY+G++
Sbjct: 359 YDMDLITTAPTVVYQVLMRDSTVIEIENPSKIPDLSKIAEIREPIITSTIIVPEEYVGAV 418

Query: 428 LKLCQERRGIQIDMSHLDNRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDYRDS 487
           + LC  +RG Q++M ++  + M+ YE+PLNEV+ DF+DRLKS S+GYAS DY   ++R S
Sbjct: 419 ITLCVSKRGNQVNMQYMGKQVMLTYEMPLNEVVMDFFDRLKSTSRGYASLDYEFKEFRAS 478

Query: 488 DLVKLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGGRIIA 547
           DLVKL IL+N + +DALS+++HRS S+ RGR + +K++ LIP+QMF IA+QAA+G  IIA
Sbjct: 479 DLVKLDILINGDKVDALSLIIHRSSSQYRGRELVQKMRQLIPRQMFDIAVQAAVGAHIIA 538

Query: 548 RETVKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISILKTDNE 606
           RETVKA RK+V AKCYGGDI+RKRKLLEKQK GKKRM+R G V+IPQ AF++IL+ DN+
Sbjct: 539 RETVKALRKNVLAKCYGGDISRKRKLLEKQKAGKKRMKRVGNVEIPQEAFLAILQVDNK 597


>gi|323702395|ref|ZP_08114060.1| GTP-binding protein LepA [Desulfotomaculum nigrificans DSM 574]
 gi|323532701|gb|EGB22575.1| GTP-binding protein LepA [Desulfotomaculum nigrificans DSM 574]
          Length = 603

 Score =  751 bits (1938), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 347/599 (57%), Positives = 465/599 (77%), Gaps = 3/599 (0%)

Query: 7   PLSRIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTV 66
           P  RIRNF I+AHIDHGKSTLADR ++    L++REM+ QVLD MD+ERERGITIK Q V
Sbjct: 4   PQDRIRNFCIIAHIDHGKSTLADRLLETTGALSQREMTEQVLDKMDLERERGITIKLQAV 63

Query: 67  RLNYTSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQA 126
           RL YT+ D ++YQLNLIDTPGHVDFTYEVSRSL+ACEG+LLVVDA+QG+EAQTLANVY A
Sbjct: 64  RLFYTAADGQEYQLNLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGIEAQTLANVYLA 123

Query: 127 IDNNHEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERIVQQ 186
           ++N+ EII V+NK DLPSA+P+RVK++IE+ IG+ T DA+L SAK+G GIP +LE++V +
Sbjct: 124 LENDLEIIPVINKIDLPSAEPERVKQEIEDVIGLDTSDAILASAKSGIGIPEILEQVVTK 183

Query: 187 LPSPTSPEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVERI 246
           +P P      +APL+AL+ DS Y+ Y GV+  +R++ G +  G  IR+M T  +++V+ +
Sbjct: 184 IPPPQG--DLDAPLQALIFDSHYDPYRGVIAYIRVVQGSIKPGMRIRMMATQKEFEVDEV 241

Query: 247 GILTPKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVVFC 306
           G+  P M  ++ L  GE+G + AS+K V   RVGDTIT   +P    LPG++ + P+VFC
Sbjct: 242 GVFRPDMTFVDELRVGEVGFVAASMKNVQDVRVGDTITSADNPAPQPLPGYRKVTPMVFC 301

Query: 307 GLFPVDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERLER 366
           GL+PV+   +E+LR A++KL+LNDAS  +E E S ALGFGFRCGFLGLLH+EIIQERLER
Sbjct: 302 GLYPVETVDYEDLRDALDKLKLNDASLIYEPETSEALGFGFRCGFLGLLHMEIIQERLER 361

Query: 367 EFSLNLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEYLGS 426
           E+ L LI T+PSVVY +    G   ++ NP ++P V KI  + EP+++ TI+ P +++GS
Sbjct: 362 EYGLGLITTAPSVVYRVTTTKGEQLEIDNPSNLPPVNKIEMIEEPYVKATIMVPKDFVGS 421

Query: 427 ILKLCQERRGIQIDMSHLD-NRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDYR 485
           +++LCQ +RGI  +M ++  NR M+ YE+PL+E+I+DF+D+LKS +KGYAS DY +I YR
Sbjct: 422 VMELCQNKRGIYSNMEYMGINRVMLTYEIPLSEIIYDFFDQLKSRTKGYASLDYELIGYR 481

Query: 486 DSDLVKLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGGRI 545
            SDLVKL IL+N E +DALS +VH+  +  RGR + EKL++LIP+ MF+I +QAAIG R+
Sbjct: 482 QSDLVKLDILLNGEPLDALSCIVHKDRAYSRGRALVEKLRSLIPRHMFEIPVQAAIGNRV 541

Query: 546 IARETVKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISILKTD 604
           IARET+KA+RKDV AKCYGGDITRKRKLLEKQKEGKKRM++ G V+IPQ AF+++L  +
Sbjct: 542 IARETIKAQRKDVLAKCYGGDITRKRKLLEKQKEGKKRMKQVGNVEIPQEAFMAVLSIE 600


>gi|261405582|ref|YP_003241823.1| GTP-binding protein LepA [Paenibacillus sp. Y412MC10]
 gi|261282045|gb|ACX64016.1| GTP-binding protein LepA [Paenibacillus sp. Y412MC10]
          Length = 605

 Score =  750 bits (1937), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 343/598 (57%), Positives = 465/598 (77%), Gaps = 3/598 (0%)

Query: 10  RIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVRLN 69
           +IRNF I+AHIDHGKSTLADR ++    LT REM  QVLD MD+ERERGITIK Q VRLN
Sbjct: 10  KIRNFCIIAHIDHGKSTLADRILEFTGALTSREMQEQVLDQMDLERERGITIKLQAVRLN 69

Query: 70  YTSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQAIDN 129
           Y + D ++Y LNLIDTPGHVDFTYEVSRSL+ACEG+LLVVDA QG+EAQTLANVY A+DN
Sbjct: 70  YKADDGEEYILNLIDTPGHVDFTYEVSRSLAACEGALLVVDAAQGIEAQTLANVYLALDN 129

Query: 130 NHEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERIVQQLPS 189
           N EI+ V+NK DLPSADP+RVK+++E+ IG+   DA+L SAK G GI  +LE++VQ++P+
Sbjct: 130 NLEILPVINKIDLPSADPERVKQEVEDVIGLDASDAVLASAKAGIGIKEILEQVVQKVPA 189

Query: 190 PTSPEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVERIGIL 249
           PT    +  PLKAL+ DS Y+ Y GV+V VR+I+G +  G  I++M T   ++V  +G  
Sbjct: 190 PTG--NSEEPLKALIFDSHYDPYKGVIVYVRVIDGSIKAGSKIKMMATGKTFEVIEVGAF 247

Query: 250 TPKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVVFCGLF 309
            P+M  ++ L  G++G ++A IK V  T+VGDT+TD   PT   LPG++ I P+VFCGL+
Sbjct: 248 KPRMSIVDELNVGDVGFIVAGIKSVGDTQVGDTVTDAKRPTAEPLPGYRKINPMVFCGLY 307

Query: 310 PVDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERLEREFS 369
           P++ + + +LR A+ KL+LNDAS SFE E S+ALGFGFRCGFLGLLH+++IQER+EREF+
Sbjct: 308 PIETSDYNDLREALEKLQLNDASLSFEPETSSALGFGFRCGFLGLLHMDVIQERIEREFN 367

Query: 370 LNLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEYLGSILK 429
           + LI T+PSV+Y +   +G   ++ NP   PEV K+  + EP+++  II PN+Y+G+I++
Sbjct: 368 IPLITTAPSVIYRITQTNGEQIQIDNPSHYPEVGKVDYVEEPYVKAAIIVPNDYVGAIME 427

Query: 430 LCQERRGIQIDMSHLD-NRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDYRDSD 488
           LCQ +RG  ++M +LD  R  I YE+PL+E+++DF+D+LKS +KGYASFDY +  YR S+
Sbjct: 428 LCQNKRGEFVNMEYLDTTRVTITYEIPLSEIVYDFFDQLKSSTKGYASFDYELSGYRRSN 487

Query: 489 LVKLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGGRIIAR 548
           LVK+ IL+N E +DALS +VH+  +  RGR ICEKL+ LIP+QMF++ IQA++G +++AR
Sbjct: 488 LVKMDILLNAEQVDALSFIVHKDRAYHRGRAICEKLRELIPRQMFEVPIQASVGTKVVAR 547

Query: 549 ETVKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISILKTDNE 606
           ETVKA RK+V AKCYGGDI+RKRKLLEKQKEGKKRM++ G V++PQ AF+++LK D++
Sbjct: 548 ETVKAMRKNVLAKCYGGDISRKRKLLEKQKEGKKRMKQVGSVEVPQEAFMAVLKIDDK 605


>gi|308388953|gb|ADO31273.1| putative GTP-binding protein [Neisseria meningitidis alpha710]
          Length = 597

 Score =  750 bits (1936), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 344/599 (57%), Positives = 469/599 (78%), Gaps = 2/599 (0%)

Query: 8   LSRIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVR 67
           +  IRNFSI+AHIDHGKSTLADRFIQ+C GL  REMS+QVLD+MDIE+ERGITIKAQT  
Sbjct: 1   MKNIRNFSIIAHIDHGKSTLADRFIQYCGGLDLREMSTQVLDSMDIEKERGITIKAQTAA 60

Query: 68  LNYTSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQAI 127
           LNY + D + YQLNLIDTPGHVDF+YEVSRSLSACEG+LLVVDA+QGVEAQT+AN Y AI
Sbjct: 61  LNYKARDGQVYQLNLIDTPGHVDFSYEVSRSLSACEGALLVVDASQGVEAQTVANCYTAI 120

Query: 128 DNNHEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERIVQQL 187
           D   E++ VLNK DLP+ADP+RV+++IE+ IGI   DA+  SAK+G G+  +LE IV ++
Sbjct: 121 DLGVEVVPVLNKIDLPAADPERVEQEIEDIIGIDAVDAVQCSAKSGIGVEDVLEEIVAKI 180

Query: 188 PSPTSPEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVERIG 247
           P+PT  E  NAPL+A+++DSW+++Y+GV++L+R+ NG +     +R M T A+ QVE++G
Sbjct: 181 PAPTGDE--NAPLQAVIVDSWFDNYVGVVMLIRVKNGIIKLKDKVRFMSTKAETQVEQLG 238

Query: 248 ILTPKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVVFCG 307
           + TPK +  + L  GE+G +I  +KE+   +VGDT+T  ++P +  LPGF+ +Q  VF G
Sbjct: 239 VFTPKSVQKQELKAGEVGFLITGVKELGQAKVGDTVTLVANPASEPLPGFQEVQSQVFAG 298

Query: 308 LFPVDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERLERE 367
           L+PV++  +E LR A+ KL+LNDAS  FE E S ALGFGFRCGFLGLLHLEI+QERLERE
Sbjct: 299 LYPVESHDYEALRDALEKLQLNDASLKFEPEVSQALGFGFRCGFLGLLHLEIVQERLERE 358

Query: 368 FSLNLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEYLGSI 427
           F ++LI T+P+VVYE+ + +G   ++ NP  +P++  I  + EP I  TI+ P EY+G++
Sbjct: 359 FDMDLITTAPTVVYEVVLKNGEKIEVENPSKLPDIGSIETILEPIITATILVPQEYVGNV 418

Query: 428 LKLCQERRGIQIDMSHLDNRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDYRDS 487
           + LC ++RG+Q++M ++  + M+ Y+LP+NEV+ DF+D+LKS S+GYAS DY+  +++ S
Sbjct: 419 MTLCNQKRGVQVNMQYMGRQVMLTYDLPMNEVVMDFFDKLKSTSRGYASLDYHFKEFQPS 478

Query: 488 DLVKLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGGRIIA 547
           DL+KL I+VN E +DALS++VHR  +  RGR +  K++ LIP+QMF IA+QAAIG +IIA
Sbjct: 479 DLIKLDIMVNGEKVDALSLIVHRKSAVHRGRELASKMRELIPRQMFDIAVQAAIGSQIIA 538

Query: 548 RETVKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISILKTDNE 606
           RE VKA RK+V AKCYGGDITRK+KLLEKQK GK+RM++ G V+IPQSAF++IL+  ++
Sbjct: 539 RENVKALRKNVLAKCYGGDITRKKKLLEKQKAGKRRMKQVGNVEIPQSAFLAILQVSDK 597


>gi|251796213|ref|YP_003010944.1| GTP-binding protein LepA [Paenibacillus sp. JDR-2]
 gi|247543839|gb|ACT00858.1| GTP-binding protein LepA [Paenibacillus sp. JDR-2]
          Length = 605

 Score =  750 bits (1936), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 341/598 (57%), Positives = 471/598 (78%), Gaps = 3/598 (0%)

Query: 10  RIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVRLN 69
           +IRNFSI+AHIDHGKSTLADR ++    L+ REM  QVLD MD+ERERGITIK Q VRL 
Sbjct: 10  KIRNFSIIAHIDHGKSTLADRILEFTGALSSREMQEQVLDQMDLERERGITIKLQAVRLT 69

Query: 70  YTSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQAIDN 129
           Y + D ++Y LNLIDTPGHVDFTYEVSRS++ACEG+LLVVDA QG+EAQTLANVY A+DN
Sbjct: 70  YKADDGEEYLLNLIDTPGHVDFTYEVSRSMAACEGALLVVDAAQGIEAQTLANVYLALDN 129

Query: 130 NHEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERIVQQLPS 189
           N EI+ V+NK DLPSA+P+RVK++IE+ IG+   DA+L SAK G GI  +LE++VQ++P+
Sbjct: 130 NLEILPVINKIDLPSAEPERVKQEIEDVIGLDASDAVLASAKAGIGIKEILEQVVQKVPA 189

Query: 190 PTSPEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVERIGIL 249
           PT     + PLKAL+ DS Y+ Y GV+V VR+I+G +  G+ IR M T A+++V  +G  
Sbjct: 190 PTG--NPDEPLKALIFDSHYDPYKGVIVYVRVIDGSIQAGKKIRFMATGAEFEVIEVGAF 247

Query: 250 TPKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVVFCGLF 309
            P+M  ++ L  G++G ++A IK V  TRVGDT+T+   P   ALPG++ I P+V+CGL+
Sbjct: 248 KPRMGIVDELAVGDVGFVVAGIKNVKDTRVGDTVTEAKRPAPEALPGYRKINPMVYCGLY 307

Query: 310 PVDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERLEREFS 369
           P++   + +LR A+ KL LNDAS  +E E STALGFGFRCGFLGLLH+EIIQER+EREF+
Sbjct: 308 PIETQDYNDLREALEKLELNDASLRYEPETSTALGFGFRCGFLGLLHMEIIQERIEREFN 367

Query: 370 LNLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEYLGSILK 429
           + LI T+PSV+Y + + +G++ ++ NP + PE  K+  + EP+++ ++I PN+Y+G+I++
Sbjct: 368 IPLITTAPSVIYRVTLTNGTVMEIDNPSNYPEAGKLEFVEEPYVKASVIVPNDYVGAIME 427

Query: 430 LCQERRGIQIDMSHLD-NRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDYRDSD 488
           LCQ +RG  ++M +LD NR  + YE+PL+E+++DF+D+LKS +KGYASFDY +  YR S+
Sbjct: 428 LCQGKRGEFVNMEYLDTNRVTLTYEIPLSEIVYDFFDQLKSSTKGYASFDYELSGYRRSN 487

Query: 489 LVKLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGGRIIAR 548
           LVK+ I++NNE +DALS++VHR  + +RGR IC+K+K LIP+QMF++ +QA+IG ++IAR
Sbjct: 488 LVKMDIMLNNEQVDALSVIVHRDRAYQRGRVICQKMKELIPRQMFEVPVQASIGTKVIAR 547

Query: 549 ETVKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISILKTDNE 606
           ETVKA RK+V AKCYGGDI+RKRKLL+KQKEGKKRM++ G V++PQ AF+++LK D +
Sbjct: 548 ETVKAMRKNVLAKCYGGDISRKRKLLDKQKEGKKRMKQVGSVEVPQEAFMAVLKIDED 605


>gi|315645950|ref|ZP_07899071.1| GTP-binding protein LepA [Paenibacillus vortex V453]
 gi|315278711|gb|EFU42025.1| GTP-binding protein LepA [Paenibacillus vortex V453]
          Length = 604

 Score =  750 bits (1936), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 344/598 (57%), Positives = 466/598 (77%), Gaps = 5/598 (0%)

Query: 10  RIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVRLN 69
           +IRNF I+AHIDHGKSTLADR +++   LT REM  QVLD MD+ERERGITIK Q VRLN
Sbjct: 10  KIRNFCIIAHIDHGKSTLADRILEYTGALTSREMQEQVLDQMDLERERGITIKLQAVRLN 69

Query: 70  YTSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQAIDN 129
           Y + + ++Y LNLIDTPGHVDFTYEVSRSL+ACEG+LLVVDA QG+EAQTLANVY A+DN
Sbjct: 70  YKADNGEEYILNLIDTPGHVDFTYEVSRSLAACEGALLVVDAAQGIEAQTLANVYLALDN 129

Query: 130 NHEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERIVQQLPS 189
           N EI+ V+NK DLPSADP+RVK+++E+ IG+   DA+L SAK G GI  +LE++VQ++P+
Sbjct: 130 NLEILPVINKIDLPSADPERVKQEVEDVIGLDASDAVLASAKAGIGIKEILEQVVQKVPA 189

Query: 190 PTS-PEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVERIGI 248
           PT  PE    PLKAL+ DS Y+ Y GV+V VR+I+G +  G  I++M T   ++V  +G 
Sbjct: 190 PTGHPE---EPLKALIFDSHYDPYKGVIVYVRVIDGSIKAGSKIKMMATGKSFEVIEVGA 246

Query: 249 LTPKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVVFCGL 308
             P+M  ++ L  G++G ++A IK V  T+VGDT+TD   PT   LPG++ I P+VFCGL
Sbjct: 247 FKPRMSIVDELNVGDVGFIVAGIKSVGDTQVGDTVTDAKRPTAEPLPGYRKINPMVFCGL 306

Query: 309 FPVDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERLEREF 368
           +P++ + + +LR A+ KL+LNDAS SFE E S+ALGFGFRCGFLGLLH+++IQER+EREF
Sbjct: 307 YPIETSDYNDLREALEKLQLNDASLSFEPETSSALGFGFRCGFLGLLHMDVIQERIEREF 366

Query: 369 SLNLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEYLGSIL 428
           ++ LI T+PSV+Y + + +G   ++ NP   PEV K+  + EP+++  II PN+Y+GSI+
Sbjct: 367 NIPLITTAPSVIYRITLTNGEQIQIDNPSHYPEVGKVDYVEEPYVKAAIIVPNDYVGSIM 426

Query: 429 KLCQERRGIQIDMSHLD-NRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDYRDS 487
           +LCQ +RG  ++M +LD  R  I YE+PL+E+++DF+D+LKS +KGYASFDY V  YR S
Sbjct: 427 ELCQNKRGEFVNMEYLDTTRVTITYEIPLSEIVYDFFDQLKSSTKGYASFDYEVSGYRKS 486

Query: 488 DLVKLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGGRIIA 547
           +L K+ I++N E +DALS +VH+  +  RGR ICEKL+ LIP+QMF++ IQA++G +++A
Sbjct: 487 NLAKMDIVLNGEQVDALSFIVHKDRAYHRGRAICEKLRELIPRQMFEVPIQASVGTKVVA 546

Query: 548 RETVKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISILKTDN 605
           RETVKA RK+V AKCYGGDI+RKRKLLEKQKEGKKRM++ G V++PQ AF+++LK D+
Sbjct: 547 RETVKAMRKNVLAKCYGGDISRKRKLLEKQKEGKKRMKQVGSVEVPQEAFMAVLKIDD 604


>gi|325136010|gb|EGC58620.1| GTP-binding protein LepA [Neisseria meningitidis M0579]
          Length = 624

 Score =  750 bits (1936), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 346/603 (57%), Positives = 470/603 (77%), Gaps = 2/603 (0%)

Query: 4   KPTPLSRIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKA 63
           K T +  IRNFSI+AHIDHGKSTLADRFIQ+C GL  REMS+QVLD+MDIE+ERGITIKA
Sbjct: 24  KTTLMKNIRNFSIIAHIDHGKSTLADRFIQYCGGLDLREMSTQVLDSMDIEKERGITIKA 83

Query: 64  QTVRLNYTSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANV 123
           QT  LNY + D + YQLNLIDTPGHVDF+YEVSRSLSACEG+LLVVDA+QGVEAQT+AN 
Sbjct: 84  QTAALNYKARDGQVYQLNLIDTPGHVDFSYEVSRSLSACEGALLVVDASQGVEAQTVANC 143

Query: 124 YQAIDNNHEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERI 183
           Y AID   E++ VLNK DLP+ADP+RV+++IE+ IGI    A+  SAK+G G+  +LE I
Sbjct: 144 YTAIDLGVEVVPVLNKIDLPAADPERVEQEIEDIIGIDAVGAVQCSAKSGIGVEDVLEEI 203

Query: 184 VQQLPSPTSPEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQV 243
           V ++P+PT  E  NAPL+A+++DSW+++Y+GV++L+R+ NG +     +R M T A+ QV
Sbjct: 204 VAKIPAPTGDE--NAPLQAVIVDSWFDNYVGVVMLIRVKNGTIKLKDKVRFMSTKAETQV 261

Query: 244 ERIGILTPKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPV 303
           E++G+ TPK +  + L  GE+G +I  +KE+   +VGDT+T  ++P T  LPGF+ +Q  
Sbjct: 262 EQLGVFTPKSVQKQELKAGEVGFLITGVKELGQAKVGDTVTLVANPATEPLPGFQEVQSQ 321

Query: 304 VFCGLFPVDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQER 363
           VF GL+PV++  +E LR A+ KL+LNDAS  FE E S ALGFGFRCGFLGLLHLEI+QER
Sbjct: 322 VFAGLYPVESHDYEALRDALEKLQLNDASLKFEPEVSQALGFGFRCGFLGLLHLEIVQER 381

Query: 364 LEREFSLNLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEY 423
           LEREF ++LI T+P+VVYE+ + +G   ++ NP  +P++  I  + EP I  TI+ P EY
Sbjct: 382 LEREFDMDLITTAPTVVYEVVLKNGEKIEVENPSKLPDIGSIETILEPIITATILVPQEY 441

Query: 424 LGSILKLCQERRGIQIDMSHLDNRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVID 483
           +G+++ LC ++RG+Q++M ++  + M+ Y+LP+NEV+ DF+D+LKS S+GYAS DY+  +
Sbjct: 442 VGNVMTLCNQKRGVQVNMQYMGRQVMLTYDLPMNEVVMDFFDKLKSTSRGYASLDYHFKE 501

Query: 484 YRDSDLVKLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGG 543
           ++ SDL+KL I+VN E +DALS++VHR  +  RGR +  K++ LIP+QMF IA+QAAIG 
Sbjct: 502 FQPSDLIKLDIMVNGEKVDALSLIVHRQSAVHRGRELASKMRELIPRQMFDIAVQAAIGS 561

Query: 544 RIIARETVKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISILKT 603
           +IIARE VKA RK+V AKCYGGDITRK+KLLEKQK GK+RM++ G V+IPQSAF++IL+ 
Sbjct: 562 QIIARENVKALRKNVLAKCYGGDITRKKKLLEKQKAGKRRMKQVGNVEIPQSAFLAILQV 621

Query: 604 DNE 606
            ++
Sbjct: 622 SDK 624


>gi|289209111|ref|YP_003461177.1| GTP-binding protein LepA [Thioalkalivibrio sp. K90mix]
 gi|288944742|gb|ADC72441.1| GTP-binding protein LepA [Thioalkalivibrio sp. K90mix]
          Length = 601

 Score =  749 bits (1935), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 351/596 (58%), Positives = 460/596 (77%), Gaps = 4/596 (0%)

Query: 12  RNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVRLNYT 71
           RNFSI+AHIDHGKSTLADR IQ C GLTEREMS QVLD+MD+ERERGITIKAQ+V L Y 
Sbjct: 8   RNFSIIAHIDHGKSTLADRLIQGCHGLTEREMSEQVLDSMDLERERGITIKAQSVSLFYD 67

Query: 72  STDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQAIDNNH 131
           + D + YQLN IDTPGHVDF+YEVSRSL ACEG+LLVVDA+QGVEAQ++AN Y AID   
Sbjct: 68  AQDGQRYQLNFIDTPGHVDFSYEVSRSLYACEGALLVVDASQGVEAQSVANCYTAIDQGL 127

Query: 132 EIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERIVQQLPSPT 191
           E++ VLNK DLP+A+PDRV  +IE+ IGI   DA+ VSAKTGEGI  LLE IV+++P P 
Sbjct: 128 EVVPVLNKIDLPAAEPDRVAAEIEDVIGIEATDAVRVSAKTGEGIAELLEEIVRRIPPP- 186

Query: 192 SPEG-ANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVERIGILT 250
             EG A A  KAL+IDSWY++YLGV+ LVR+  G+   GQ I+ M     ++V R+G+ T
Sbjct: 187 --EGDAEASPKALVIDSWYDNYLGVVALVRVKAGRFYAGQKIKAMSVGRAHEVSRVGVFT 244

Query: 251 PKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVVFCGLFP 310
           PK +D E L  GE+G +IA+IK++S  +VGDT TD ++P +  +PGF+ +QP VF GLFP
Sbjct: 245 PKPVDRETLEVGEVGYLIATIKDISGAKVGDTFTDFNNPASEPVPGFQEVQPRVFAGLFP 304

Query: 311 VDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERLEREFSL 370
           V A  F +LR A++KLRLNDA+ SFE E S ALGFGFRCGFLG+LH+EI+QERLERE+ L
Sbjct: 305 VSADDFNDLRDALDKLRLNDAALSFEPETSQALGFGFRCGFLGMLHMEIVQERLEREYDL 364

Query: 371 NLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEYLGSILKL 430
           +LI T+P+VVYE+   DG +  + NP  +P   +IAE+REP I+  I+ P +Y+G+++ L
Sbjct: 365 DLITTAPTVVYEVEKSDGEVVMVHNPSGLPPSNEIAEIREPIIEANILVPQDYVGAVITL 424

Query: 431 CQERRGIQIDMSHLDNRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDYRDSDLV 490
           C E+RG+Q  M +L  +  + YELP++EV+ DF+DRLKS ++GYASFDY    ++ + LV
Sbjct: 425 CIEKRGVQTKMQYLGRQVQLSYELPMSEVMLDFFDRLKSATRGYASFDYQPRRFQAAPLV 484

Query: 491 KLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGGRIIARET 550
           ++ IL+N E +DALS +VHR  +E RGR + E++  +IP+QM+++AIQAAIG +IIAR T
Sbjct: 485 RVDILINGERVDALSGIVHRDHAESRGRELTERMAKIIPRQMYEVAIQAAIGSKIIARST 544

Query: 551 VKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISILKTDNE 606
           VKA RK+V AKCYGGD++RKRKLLEKQK GKKRM+  G+VD+PQ AF+++L   ++
Sbjct: 545 VKAMRKNVLAKCYGGDVSRKRKLLEKQKAGKKRMKSIGKVDVPQEAFLAVLSVGDD 600


>gi|258544606|ref|ZP_05704840.1| GTP-binding protein LepA [Cardiobacterium hominis ATCC 15826]
 gi|258520148|gb|EEV89007.1| GTP-binding protein LepA [Cardiobacterium hominis ATCC 15826]
          Length = 601

 Score =  749 bits (1935), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 348/599 (58%), Positives = 467/599 (77%), Gaps = 3/599 (0%)

Query: 8   LSRIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVR 67
           L RIRNFSI+AHIDHGKSTL+DRFIQ C GL+EREM +QVLD+MD+ERERGITIKAQ+V 
Sbjct: 2   LERIRNFSIIAHIDHGKSTLSDRFIQMCGGLSEREMEAQVLDSMDLERERGITIKAQSVS 61

Query: 68  LNYTST-DAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQA 126
           LNYTS  D + YQ N IDTPGHVDF+YEVSRSL ACEG+LLVVDA QGVEAQ++AN Y A
Sbjct: 62  LNYTSKRDGQTYQFNFIDTPGHVDFSYEVSRSLYACEGALLVVDAAQGVEAQSVANCYTA 121

Query: 127 IDNNHEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERIVQQ 186
           I+ N E++ VLNK DLPSA+P+RV ++IEE IG+ T + L VSAKTGEGI  LLE+I+++
Sbjct: 122 IEQNLEVLPVLNKIDLPSAEPERVMEEIEEIIGLDTSETLKVSAKTGEGIADLLEQIIEK 181

Query: 187 LPSPTSPEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVERI 246
           +P+PT     +AP+KAL+IDSW++SY+GV+ LVR+ +G L   Q +R+M +  ++ + ++
Sbjct: 182 IPAPTG--DPDAPVKALIIDSWFDSYVGVVSLVRVFDGTLKVKQKMRVMSSGDEHLITKL 239

Query: 247 GILTPKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVVFC 306
           GI TPK  D   L  GE+G +IA IK+++   VGDT+TD + PT   LPGF+ +QP VF 
Sbjct: 240 GIFTPKAQDRSELRAGEVGFVIAGIKDINGAPVGDTLTDAARPTAERLPGFQKVQPRVFA 299

Query: 307 GLFPVDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERLER 366
           GLFPV++  +E+LR A+ KLRLNDAS  +E E S ALGFGFRCGFLG+LH+EI+QERLER
Sbjct: 300 GLFPVESDDYEDLREALAKLRLNDASLFYEPETSQALGFGFRCGFLGMLHMEIVQERLER 359

Query: 367 EFSLNLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEYLGS 426
           E+ L+LI T+P+VVYE+    G    + NP  +P    IAE+REP I   I+ P +YLG+
Sbjct: 360 EYDLDLITTAPTVVYEVETTAGETLHIDNPSKLPATNHIAEIREPIILANILVPKDYLGA 419

Query: 427 ILKLCQERRGIQIDMSHLDNRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDYRD 486
           ++ LC E+RG+Q DM    ++  + +E+P++EV+ DF+DRLKSVS+G+ASFDY    +  
Sbjct: 420 VIGLCIEKRGVQKDMQFAGHQVQLRFEMPMSEVVLDFFDRLKSVSRGFASFDYEFRRFEP 479

Query: 487 SDLVKLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGGRII 546
           + LV+L +L+N + +D+LSI++HR  ++ RGR + E++++LIP+QMF++AIQAAIG ++I
Sbjct: 480 ASLVRLDVLINGDKVDSLSIIIHREHAQSRGRDLVERMRDLIPRQMFEVAIQAAIGNQVI 539

Query: 547 ARETVKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISILKTDN 605
           AR TVKA RK+V AKCYGGD++RKRKLLEKQK GKKRM++ G V+IPQ AF+++LK DN
Sbjct: 540 ARSTVKALRKNVLAKCYGGDVSRKRKLLEKQKAGKKRMKQVGSVEIPQEAFLAVLKVDN 598


>gi|329924042|ref|ZP_08279305.1| GTP-binding protein LepA [Paenibacillus sp. HGF5]
 gi|328940881|gb|EGG37189.1| GTP-binding protein LepA [Paenibacillus sp. HGF5]
          Length = 605

 Score =  749 bits (1935), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 343/598 (57%), Positives = 465/598 (77%), Gaps = 3/598 (0%)

Query: 10  RIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVRLN 69
           +IRNF I+AHIDHGKSTLADR ++    LT REM  QVLD MD+ERERGITIK Q VRLN
Sbjct: 10  KIRNFCIIAHIDHGKSTLADRILEFTGALTSREMQEQVLDQMDLERERGITIKLQAVRLN 69

Query: 70  YTSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQAIDN 129
           Y + D ++Y LNLIDTPGHVDFTYEVSRSL+ACEG+LLVVDA QG+EAQTLANVY A+DN
Sbjct: 70  YKADDGEEYILNLIDTPGHVDFTYEVSRSLAACEGALLVVDAAQGIEAQTLANVYLALDN 129

Query: 130 NHEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERIVQQLPS 189
           N EI+ V+NK DLPSADP+RVK+++E+ IG+   DA+L SAK G GI  +LE++VQ++P+
Sbjct: 130 NLEILPVINKIDLPSADPERVKQEVEDVIGLDASDAVLASAKAGIGIKEILEQVVQKVPA 189

Query: 190 PTSPEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVERIGIL 249
           PT    +  PLKAL+ DS Y+ Y GV+V VR+I+G +  G  I++M T   ++V  +G  
Sbjct: 190 PTG--NSEDPLKALIFDSHYDPYKGVIVYVRVIDGSIKAGSKIKMMATGKTFEVIEVGAF 247

Query: 250 TPKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVVFCGLF 309
            P+M  ++ L  G++G ++A IK V  T+VGDT+TD   PT   LPG++ I P+VFCGL+
Sbjct: 248 KPRMSIVDELNVGDVGFIVAGIKSVGDTQVGDTVTDAKRPTAEPLPGYRKINPMVFCGLY 307

Query: 310 PVDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERLEREFS 369
           P++ + + +LR A+ KL+LNDAS SFE E S+ALGFGFRCGFLGLLH+++IQER+EREF+
Sbjct: 308 PIETSDYNDLREALEKLQLNDASLSFEPETSSALGFGFRCGFLGLLHMDVIQERIEREFN 367

Query: 370 LNLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEYLGSILK 429
           + LI T+PSV+Y +   +G   ++ NP   PEV K+  + EP+++  II PN+Y+G+I++
Sbjct: 368 IPLITTAPSVIYRITQTNGEQIQIDNPSHYPEVGKVDYVEEPYVKAAIIVPNDYVGAIME 427

Query: 430 LCQERRGIQIDMSHLD-NRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDYRDSD 488
           LCQ +RG  ++M +LD  R  I YE+PL+E+++DF+D+LKS +KGYASFDY +  YR S+
Sbjct: 428 LCQNKRGEFVNMEYLDTTRVTITYEIPLSEIVYDFFDQLKSSTKGYASFDYELSGYRRSN 487

Query: 489 LVKLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGGRIIAR 548
           LVK+ IL+N E +DALS +VH+  +  RGR ICEKL+ LIP+QMF++ IQA++G +++AR
Sbjct: 488 LVKMDILLNAEQVDALSFIVHKDRAYHRGRAICEKLRELIPRQMFEVPIQASVGTKVVAR 547

Query: 549 ETVKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISILKTDNE 606
           ETVKA RK+V AKCYGGDI+RKRKLLEKQKEGKKRM++ G V++PQ AF+++LK D++
Sbjct: 548 ETVKAMRKNVLAKCYGGDISRKRKLLEKQKEGKKRMKQVGSVEVPQEAFMAVLKIDDK 605


>gi|284106757|ref|ZP_06386278.1| GTP-binding protein lepA [Candidatus Poribacteria sp. WGA-A3]
 gi|283830055|gb|EFC34330.1| GTP-binding protein lepA [Candidatus Poribacteria sp. WGA-A3]
          Length = 601

 Score =  749 bits (1935), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 352/600 (58%), Positives = 460/600 (76%), Gaps = 3/600 (0%)

Query: 8   LSRIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVR 67
           LS IRNFSI+AHIDHGKSTLADR ++    +T RE   Q+LD+MD+ERERGITIKA  V 
Sbjct: 4   LSSIRNFSIIAHIDHGKSTLADRLLELTGAITPREFREQILDDMDLERERGITIKAHAVT 63

Query: 68  LNYTSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQAI 127
            +Y + D   YQLNLIDTPGHVDFTYEVSRSL+ACEG+LL+VDATQGVEAQT+ANVY A+
Sbjct: 64  TSYKAHDGHTYQLNLIDTPGHVDFTYEVSRSLAACEGALLLVDATQGVEAQTIANVYLAM 123

Query: 128 DNNHEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERIVQQL 187
            N+  I+ V+NK DLPSAD D VK QIEE +G+  +DALLVSAK G G+  +L+ +V+Q+
Sbjct: 124 ANDLVILPVINKIDLPSADIDGVKHQIEEVLGLPMDDALLVSAKQGIGVDDVLDAMVRQV 183

Query: 188 PSPTSPEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVERIG 247
           P PT     +A LKAL+ DSW++SY G +VLVRI +G++  G  IRLM T   ++V  +G
Sbjct: 184 PPPTG--AVSASLKALIFDSWFDSYQGAIVLVRIFDGEVKPGMKIRLMSTGRIFEVSEVG 241

Query: 248 ILTPKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVVFCG 307
           I +PK      L  G +G ++A +K+VS T++GDT+TD + PT + LPG++ ++P+VFCG
Sbjct: 242 IFSPKRTKTRELKAGAVGYVVAGMKDVSDTKIGDTLTDAAQPTATPLPGYREVKPLVFCG 301

Query: 308 LFPVDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERLERE 367
           L+ +D   +ENLR +++KLRLND+SF +E E S ALGFGFRCGFLGLLH+EII+ERL RE
Sbjct: 302 LYTMDNADYENLRDSLDKLRLNDSSFVYEPETSLALGFGFRCGFLGLLHMEIIRERLHRE 361

Query: 368 FSLNLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEYLGSI 427
           + L+LI T+P+V+Y +   DG +  + NP  +PE   I  + EP+IQ TII P  Y G+I
Sbjct: 362 YGLSLISTAPTVIYRVRTLDGEVLNIENPSKLPEPEAIETMEEPFIQATIIAPERYAGNI 421

Query: 428 LKLCQERRGIQIDMSHLD-NRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDYRD 486
           L LCQERRG+Q  M +LD  R M++Y LPLNE++ DFYD+LKS ++GYAS DY + DYR+
Sbjct: 422 LALCQERRGVQKSMQYLDTTRMMLIYALPLNEMVLDFYDKLKSRTQGYASLDYELTDYRE 481

Query: 487 SDLVKLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGGRII 546
           +DLVKL +L+N ETIDALS + H+  +  RGR + EK+K LIP+QMF++AIQAAIG R+I
Sbjct: 482 ADLVKLDVLLNGETIDALSFITHKDKAYHRGRQLVEKMKELIPKQMFEVAIQAAIGKRVI 541

Query: 547 ARETVKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISILKTDNE 606
           ARETV A +K+VTAKCYGGDITRKRKL EKQKEGKKRM++ GRV++PQ AF+++LK  +E
Sbjct: 542 ARETVSAIKKNVTAKCYGGDITRKRKLWEKQKEGKKRMKQLGRVEVPQEAFLALLKVKDE 601


>gi|161869710|ref|YP_001598877.1| GTP-binding protein LepA [Neisseria meningitidis 053442]
 gi|189046447|sp|A9M3J8|LEPA_NEIM0 RecName: Full=Elongation factor 4; Short=EF-4; AltName:
           Full=Ribosomal back-translocase LepA
 gi|161595263|gb|ABX72923.1| GTP-binding protein [Neisseria meningitidis 053442]
 gi|254669906|emb|CBA04438.1| GTP-binding protein LepA [Neisseria meningitidis alpha153]
 gi|325129920|gb|EGC52721.1| GTP-binding protein LepA [Neisseria meningitidis OX99.30304]
          Length = 597

 Score =  749 bits (1935), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 344/599 (57%), Positives = 468/599 (78%), Gaps = 2/599 (0%)

Query: 8   LSRIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVR 67
           +  IRNFSI+AHIDHGKSTLADRFIQ+C GL  REMS+QVLD+MDIE+ERGITIKAQT  
Sbjct: 1   MKNIRNFSIIAHIDHGKSTLADRFIQYCGGLDLREMSTQVLDSMDIEKERGITIKAQTAA 60

Query: 68  LNYTSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQAI 127
           LNY + D + YQLNLIDTPGHVDF+YEVSRSLSACEG+LLVVDA+QGVEAQT+AN Y AI
Sbjct: 61  LNYKARDGQVYQLNLIDTPGHVDFSYEVSRSLSACEGALLVVDASQGVEAQTVANCYTAI 120

Query: 128 DNNHEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERIVQQL 187
           D   E++ VLNK DLP+ADP+RV+++IE+ IGI    A+  SAK+G G+  +LE IV ++
Sbjct: 121 DLGVEVVPVLNKIDLPAADPERVEQEIEDIIGIDAVGAVQCSAKSGIGVEDVLEEIVAKI 180

Query: 188 PSPTSPEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVERIG 247
           P+PT  E  NAPL+A+++DSW+++Y+GV++L+R+ NG +     +R M T A+ QVE++G
Sbjct: 181 PAPTGDE--NAPLQAVIVDSWFDNYVGVVMLIRVKNGTIKLKDKVRFMSTKAETQVEQLG 238

Query: 248 ILTPKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVVFCG 307
           + TPK +  + L  GE+G +I  +KE+   +VGDT+T  ++P T  LPGF+ +Q  VF G
Sbjct: 239 VFTPKSVQKQELKAGEVGFLITGVKELGQAKVGDTVTLVANPATEPLPGFQEVQSQVFAG 298

Query: 308 LFPVDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERLERE 367
           L+PV++  +E LR A+ KL+LNDAS  FE E S ALGFGFRCGFLGLLHLEI+QERLERE
Sbjct: 299 LYPVESHDYEALRDALEKLQLNDASLKFEPEVSQALGFGFRCGFLGLLHLEIVQERLERE 358

Query: 368 FSLNLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEYLGSI 427
           F ++LI T+P+VVYE+ + +G   ++ NP  +P++  I  + EP I  TI+ P EY+G++
Sbjct: 359 FDMDLITTAPTVVYEVVLKNGEKIEVENPSKLPDIGSIETILEPIITATILVPQEYVGNV 418

Query: 428 LKLCQERRGIQIDMSHLDNRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDYRDS 487
           + LC ++RG+Q++M ++  + M+ Y+LP+NEV+ DF+D+LKS S+GYAS DY+  +++ S
Sbjct: 419 MTLCNQKRGVQVNMQYMGRQVMLTYDLPMNEVVMDFFDKLKSTSRGYASLDYHFKEFQPS 478

Query: 488 DLVKLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGGRIIA 547
           DL+KL I+VN E +DALS++VHR  +  RGR +  K++ LIP+QMF IA+QAAIG +IIA
Sbjct: 479 DLIKLDIMVNGEKVDALSLIVHRQSAVHRGRELASKMRELIPRQMFDIAVQAAIGSQIIA 538

Query: 548 RETVKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISILKTDNE 606
           RE VKA RK+V AKCYGGDITRK+KLLEKQK GK+RM++ G V+IPQSAF++IL+  ++
Sbjct: 539 RENVKALRKNVLAKCYGGDITRKKKLLEKQKAGKRRMKQVGNVEIPQSAFLAILQVSDK 597


>gi|255659191|ref|ZP_05404600.1| GTP-binding protein LepA [Mitsuokella multacida DSM 20544]
 gi|260848643|gb|EEX68650.1| GTP-binding protein LepA [Mitsuokella multacida DSM 20544]
          Length = 598

 Score =  749 bits (1935), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 343/595 (57%), Positives = 470/595 (78%), Gaps = 3/595 (0%)

Query: 11  IRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVRLNY 70
           IRNFSI+AHIDHGKST+ADR I++   L++REM +QVLDNMDIERERGITIK+QTVRLNY
Sbjct: 6   IRNFSIIAHIDHGKSTIADRLIEYTGTLSKREMEAQVLDNMDIERERGITIKSQTVRLNY 65

Query: 71  TSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQAIDNN 130
              D ++Y+LNLIDTPGHVDFTYEVSRSL+ACEG+LLVVDA QGVEAQTLANVY A++++
Sbjct: 66  KGKDGEEYELNLIDTPGHVDFTYEVSRSLAACEGALLVVDAAQGVEAQTLANVYMALEHD 125

Query: 131 HEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERIVQQLPSP 190
            EII V+NK DLPSADP+RVKK+IE+ IG+ T +A+L SAK G GI  +L+ IV  +P+P
Sbjct: 126 LEIIPVINKIDLPSADPERVKKEIEDVIGLDTSNAVLASAKAGIGIEEILDSIVDYIPAP 185

Query: 191 TSPEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVERIGILT 250
              E  NAPL+AL+ DS+++SY GV+  +R++ G + KG  ++LM +   ++V  +G   
Sbjct: 186 EGNE--NAPLQALIFDSFFDSYKGVIAHIRVMQGHIKKGMKLKLMNSGKVFEVTDVGCFK 243

Query: 251 PKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVVFCGLFP 310
           P+ +D+  L  GE+G +  S+K+V   RVGDTIT   +P +  LPG++ + P+V+CGL+P
Sbjct: 244 PQPVDLGYLDVGEVGFVAGSLKDVRDVRVGDTITYADNPASEPLPGYRGVNPMVYCGLYP 303

Query: 311 VDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERLEREFSL 370
           V+++ ++NL+ A+ K+++NDA+  FE E S ALGFGFRCGFLGLLH+++IQERLERE++L
Sbjct: 304 VESSDYDNLKDALEKMQINDAALVFEPETSVALGFGFRCGFLGLLHMDVIQERLEREYNL 363

Query: 371 NLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEYLGSILKL 430
            LI T+PSV+Y +Y  DG+M K+SNP ++P  T+I  + EP+++ T+I PN+++G+++++
Sbjct: 364 KLITTAPSVIYHVYKTDGTMIKVSNPAELPPQTEIEHIEEPYVKATVIVPNDFVGAVMEI 423

Query: 431 CQERRGIQIDMSHLD-NRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDYRDSDL 489
            Q++RG    M +LD NR MI Y +PLNE+IFD++DRLKS ++GYAS DY + DY++S L
Sbjct: 424 SQDKRGEFKGMDYLDTNRVMITYHIPLNEIIFDYFDRLKSATRGYASLDYELADYKESKL 483

Query: 490 VKLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGGRIIARE 549
           VK+ IL+N + +DALS +VH+  +  RGR +  KLK +IPQQMF+I IQAAIG ++IARE
Sbjct: 484 VKVDILLNGDPVDALSTIVHKDRAASRGRQLAAKLKEIIPQQMFEIPIQAAIGSKVIARE 543

Query: 550 TVKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISILKTD 604
            V+ARRKDV AKCYGGDI+RKRKLLEKQKEGKKRM+  G V++PQ AF++ILK D
Sbjct: 544 NVRARRKDVLAKCYGGDISRKRKLLEKQKEGKKRMKAVGSVEVPQEAFMAILKID 598


>gi|325266142|ref|ZP_08132826.1| GTP-binding protein LepA [Kingella denitrificans ATCC 33394]
 gi|324982372|gb|EGC18000.1| GTP-binding protein LepA [Kingella denitrificans ATCC 33394]
          Length = 624

 Score =  749 bits (1935), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 347/599 (57%), Positives = 464/599 (77%), Gaps = 2/599 (0%)

Query: 8   LSRIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVR 67
           +  IRNFSI+AHIDHGKSTLADRFIQHC GL  REMSSQVLD+MDIE+ERGITIKAQT  
Sbjct: 28  MKNIRNFSIIAHIDHGKSTLADRFIQHCGGLENREMSSQVLDSMDIEKERGITIKAQTAA 87

Query: 68  LNYTSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQAI 127
           LNY + + + Y LNLIDTPGHVDF+YEVSRSLSACEG+LLVVDA+QGVEAQT+AN Y AI
Sbjct: 88  LNYKAKNGETYLLNLIDTPGHVDFSYEVSRSLSACEGALLVVDASQGVEAQTVANCYTAI 147

Query: 128 DNNHEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERIVQQL 187
           D   E++ VLNK DLP+ADPDRV ++IE+ IGI    A+  SAK+G G+  +LE IV ++
Sbjct: 148 DLGVEVVPVLNKIDLPAADPDRVAQEIEDIIGIDAVGAVTCSAKSGLGVEDVLEEIVAKI 207

Query: 188 PSPTSPEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVERIG 247
           P+P   E  +APL+A++IDSW+++Y+GV++L+R+ NG+L     +R M T A+ QVE++G
Sbjct: 208 PAPEGDE--DAPLQAVIIDSWFDNYVGVVMLIRVKNGRLKLKDKVRFMSTKAESQVEQLG 265

Query: 248 ILTPKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVVFCG 307
           + TPK ++ + L  GE+G +I  +KE+   +VGDT+T   +P +  LPGFK +Q  VF G
Sbjct: 266 VFTPKSVNKQELKAGEVGFLITGVKELGQAKVGDTVTLVQNPASEPLPGFKEVQSQVFAG 325

Query: 308 LFPVDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERLERE 367
           L+PV++  +E LR A+ KL+LNDAS  FE E S ALGFGFRCGFLGLLHLEI+QERLERE
Sbjct: 326 LYPVESHDYEALRDALEKLQLNDASLKFEPEVSQALGFGFRCGFLGLLHLEIVQERLERE 385

Query: 368 FSLNLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEYLGSI 427
           F ++LI T+P+VVYE+ + +G    + NP  +P++  I  + EP I  TI+ P +Y+G++
Sbjct: 386 FDMDLITTAPTVVYEVILKNGEKIDVENPSKLPDIATIDTIMEPIITATILVPQDYVGNV 445

Query: 428 LKLCQERRGIQIDMSHLDNRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDYRDS 487
           + LC ++RG+Q +M ++  + M+ Y+LP+NEV+ DF+D+LKS S+GYAS DY   ++  S
Sbjct: 446 MTLCNQKRGVQRNMQYMGRQVMLTYDLPMNEVVMDFFDKLKSTSRGYASLDYEFKEFMPS 505

Query: 488 DLVKLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGGRIIA 547
           DLVKL I+VN + +DALS++VHR  S +RGR +  K++ LIP+QMF IA+QAAIGG+IIA
Sbjct: 506 DLVKLDIMVNGDKVDALSLIVHRQTSVQRGRELAAKMRELIPRQMFDIAVQAAIGGQIIA 565

Query: 548 RETVKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISILKTDNE 606
           RE VKA RK+V AKCYGGDITRK+KLLEKQK GKKRM++ G V+IPQSAF++IL+  ++
Sbjct: 566 RENVKALRKNVLAKCYGGDITRKKKLLEKQKAGKKRMKQVGNVEIPQSAFLAILQVGDK 624


>gi|325131999|gb|EGC54698.1| GTP-binding protein LepA [Neisseria meningitidis M6190]
          Length = 624

 Score =  749 bits (1934), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 346/603 (57%), Positives = 469/603 (77%), Gaps = 2/603 (0%)

Query: 4   KPTPLSRIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKA 63
           K T +  IRNFSI+AHIDHGKSTLADRFIQ+C GL  REMS+QVLD+MDIE+ERGITIKA
Sbjct: 24  KTTLMKNIRNFSIIAHIDHGKSTLADRFIQYCGGLDLREMSTQVLDSMDIEKERGITIKA 83

Query: 64  QTVRLNYTSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANV 123
           QT  LNY + D + YQLNLIDTPGHVDF+YEVSRSLSACEG+LLVVDA+QGVEAQT+AN 
Sbjct: 84  QTAALNYKARDGQVYQLNLIDTPGHVDFSYEVSRSLSACEGALLVVDASQGVEAQTVANC 143

Query: 124 YQAIDNNHEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERI 183
           Y AID   E++ VLNK DLP+ADP+RV+++IE+ IGI    A+  SAK+G G+  +LE I
Sbjct: 144 YTAIDLGVEVVPVLNKIDLPAADPERVEQEIEDIIGIDAVGAVQCSAKSGIGVEDVLEEI 203

Query: 184 VQQLPSPTSPEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQV 243
           V ++P+PT  E  NAPL+A+++DSW+++Y+GV++L+R+ NG +     +R M T A+ QV
Sbjct: 204 VAKIPAPTGDE--NAPLQAVIVDSWFDNYVGVVMLIRVKNGTIKLKDKVRFMSTKAETQV 261

Query: 244 ERIGILTPKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPV 303
           E++G+ TPK +  + L  GE+G +I  +KE+   +VGDT+T  ++P T  LPGF+ +Q  
Sbjct: 262 EQLGVFTPKSVQKQELKAGEVGFLITGVKELGQAKVGDTVTLVANPATEPLPGFQEVQSQ 321

Query: 304 VFCGLFPVDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQER 363
           VF GL+PV++  +E LR A+ KL+LNDAS  FE E S ALGFGFRCGFLGLLHLEI+QER
Sbjct: 322 VFAGLYPVESHDYEALRDALEKLQLNDASLKFEPEVSQALGFGFRCGFLGLLHLEIVQER 381

Query: 364 LEREFSLNLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEY 423
           LEREF ++LI T+P+VVYE+ +  G   ++ NP  +P++  I  + EP I  TI+ P EY
Sbjct: 382 LEREFDMDLITTAPTVVYEVVLKSGEKIEVENPSKLPDIGSIETILEPIITATILVPQEY 441

Query: 424 LGSILKLCQERRGIQIDMSHLDNRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVID 483
           +G+++ LC ++RG+Q++M ++  + M+ Y+LP+NEV+ DF+D+LKS S+GYAS DY+  +
Sbjct: 442 VGNVMTLCNQKRGVQVNMQYMGRQVMLTYDLPMNEVVMDFFDKLKSTSRGYASLDYHFKE 501

Query: 484 YRDSDLVKLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGG 543
           ++ SDL+KL I+VN E +DALS++VHR  +  RGR +  K++ LIP+QMF IA+QAAIG 
Sbjct: 502 FQPSDLIKLDIMVNGEKVDALSLIVHRQSAVHRGRELASKMRELIPRQMFDIAVQAAIGS 561

Query: 544 RIIARETVKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISILKT 603
           +IIARE VKA RK+V AKCYGGDITRK+KLLEKQK GK+RM++ G V+IPQSAF++IL+ 
Sbjct: 562 QIIARENVKALRKNVLAKCYGGDITRKKKLLEKQKAGKRRMKQVGNVEIPQSAFLAILQV 621

Query: 604 DNE 606
            ++
Sbjct: 622 SDK 624


>gi|225024243|ref|ZP_03713435.1| hypothetical protein EIKCOROL_01115 [Eikenella corrodens ATCC
           23834]
 gi|224943268|gb|EEG24477.1| hypothetical protein EIKCOROL_01115 [Eikenella corrodens ATCC
           23834]
          Length = 597

 Score =  749 bits (1934), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 346/599 (57%), Positives = 466/599 (77%), Gaps = 2/599 (0%)

Query: 8   LSRIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVR 67
           ++ IRNFSI+AHIDHGKSTLADRFIQHC GL  REMSSQVLD+MDIE+ERGITIKAQT  
Sbjct: 1   MNNIRNFSIIAHIDHGKSTLADRFIQHCGGLENREMSSQVLDSMDIEKERGITIKAQTAA 60

Query: 68  LNYTSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQAI 127
           LNY + + + Y LNLIDTPGHVDF+YEVSRSLSACEG+LLVVDA+QGVEAQT+AN Y AI
Sbjct: 61  LNYKARNGETYLLNLIDTPGHVDFSYEVSRSLSACEGALLVVDASQGVEAQTVANCYTAI 120

Query: 128 DNNHEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERIVQQL 187
           D   E++ VLNK DLP+ADPDRV ++IE+ +GI    A+  SAK+G G+  +LE IV ++
Sbjct: 121 DLGVEVVPVLNKIDLPAADPDRVAQEIEDIVGIDAVGAVTCSAKSGLGVEDVLEEIVAKI 180

Query: 188 PSPTSPEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVERIG 247
           P+P   E  NAPL+A++IDSW+++Y+GV++L+R+ NG+L     +R M T A+ QVE++G
Sbjct: 181 PAPEGDE--NAPLQAVIIDSWFDNYVGVVMLIRVKNGRLKLKDKVRFMSTKAESQVEQLG 238

Query: 248 ILTPKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVVFCG 307
           + TPK ++ + L  GE+G +I  +KE+   +VGDT+T   +P    LPGFK +Q  VF G
Sbjct: 239 VFTPKSVNRQELKAGEVGFLITGVKELGQAKVGDTVTLVQNPAAEPLPGFKEVQSQVFAG 298

Query: 308 LFPVDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERLERE 367
           L+PV++  +E LR A+ KL+LNDAS  FE E S ALGFGFRCGFLGLLHLEI+QERLERE
Sbjct: 299 LYPVESHDYEALRDALEKLQLNDASLKFEPEVSQALGFGFRCGFLGLLHLEIVQERLERE 358

Query: 368 FSLNLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEYLGSI 427
           F ++LI T+P+VVYE+ +  G   ++ NP  +P++  +  + EP I  TI+ P EY+G++
Sbjct: 359 FDMDLITTAPTVVYEVILKTGEHIEVENPSKLPDLATVESILEPIITATILVPQEYVGNV 418

Query: 428 LKLCQERRGIQIDMSHLDNRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDYRDS 487
           + LC ++RG+QI+M +L  + M+ Y+LP+NEV+ DF+D+LKS S+GYAS DY+  ++R +
Sbjct: 419 MTLCNQKRGVQINMQYLGRQVMLTYDLPMNEVVMDFFDKLKSTSRGYASLDYHFKEFRAA 478

Query: 488 DLVKLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGGRIIA 547
           +LVKL I+VN + +DALS++VHR  + +RGR +  K++ LIP+QMF IA+QAAIG +IIA
Sbjct: 479 NLVKLDIMVNGDKVDALSLIVHRQNAVQRGRELAAKMRELIPRQMFDIAVQAAIGSQIIA 538

Query: 548 RETVKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISILKTDNE 606
           RE VKA RK+V AKCYGGDITRK+KLLEKQK GKKRM++ G V+IPQSAF++IL+  ++
Sbjct: 539 RENVKALRKNVLAKCYGGDITRKKKLLEKQKAGKKRMKQVGNVEIPQSAFLAILQVGDK 597


>gi|212638674|ref|YP_002315194.1| GTP-binding protein LepA [Anoxybacillus flavithermus WK1]
 gi|226732749|sp|B7GKC4|LEPA_ANOFW RecName: Full=Elongation factor 4; Short=EF-4; AltName:
           Full=Ribosomal back-translocase LepA
 gi|212560154|gb|ACJ33209.1| Membrane GTPase LepA [Anoxybacillus flavithermus WK1]
          Length = 608

 Score =  749 bits (1934), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 345/598 (57%), Positives = 469/598 (78%), Gaps = 3/598 (0%)

Query: 10  RIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVRLN 69
           RIRNFSI+AHIDHGKSTLADR ++    L+EREM  Q LD+M++ERERGITIK   V+L+
Sbjct: 12  RIRNFSIIAHIDHGKSTLADRILEKTGALSEREMKEQALDSMELERERGITIKLNAVQLH 71

Query: 70  YTSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQAIDN 129
           Y + D +DY L+LIDTPGHVDFTYEVSRSL+ACEG++LVVDA QG+EAQTLANVY AIDN
Sbjct: 72  YKAKDGEDYILHLIDTPGHVDFTYEVSRSLAACEGAILVVDAAQGIEAQTLANVYLAIDN 131

Query: 130 NHEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERIVQQLPS 189
           N EI+ V+NK DLPSADP+RV+++IE+ IG+   +A+L SAK G GI  +LE+IVQ++P+
Sbjct: 132 NLEILPVINKIDLPSADPERVRQEIEDVIGLDASEAVLASAKVGIGIDEILEQIVQKIPA 191

Query: 190 PTSPEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVERIGIL 249
           P+     +APLKAL+ DS Y+ Y GV+  +R++ G +  GQ I++M T  +++V  +G+ 
Sbjct: 192 PSG--DPDAPLKALIFDSLYDPYRGVVAYIRVVEGTVKAGQKIKMMATGKEFEVVEVGVF 249

Query: 250 TPKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVVFCGLF 309
           TPK   ++ L  G++G + ASIK VS TRVGDTIT   +P    LPG++ + P+VFCGL+
Sbjct: 250 TPKAKVVDELTVGDVGYLTASIKNVSDTRVGDTITHADNPANEPLPGYRRLNPMVFCGLY 309

Query: 310 PVDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERLEREFS 369
           P+D  ++ +LR A+ KL+LNDA+  FE E S ALGFGFRCGFLGLLH+EIIQERLEREF+
Sbjct: 310 PIDTARYNDLREALEKLQLNDAALQFEPETSQALGFGFRCGFLGLLHMEIIQERLEREFN 369

Query: 370 LNLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEYLGSILK 429
           +++I T+PSVVY++Y+ DG+   + NP +MP+  KI  + EP+++ TI+ PN+Y+G +++
Sbjct: 370 IDIIATAPSVVYKVYLTDGTELAVDNPSNMPDPQKIERVEEPYVRATIMVPNDYVGPVME 429

Query: 430 LCQERRGIQIDMSHLDNRAM-IVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDYRDSD 488
           LCQ++RGI  DM +LD R + + YELPL E+++DF+D LKS +KGYASFDY +I Y+ S 
Sbjct: 430 LCQKKRGIFGDMQYLDERRVTLTYELPLAEIVYDFFDILKSSTKGYASFDYELIGYKPSK 489

Query: 489 LVKLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGGRIIAR 548
           LVK+ IL+N E +DALS +VHR  +  RG+ I EKLK+LIP+Q F++ +QAAIG +IIAR
Sbjct: 490 LVKMDILLNGEKVDALSFIVHRDSAYDRGKVIVEKLKDLIPRQQFEVPVQAAIGNKIIAR 549

Query: 549 ETVKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISILKTDNE 606
            T+KA RK+V AKCYGGDI+RKRKLLEKQKEGKKRM++ G V++PQ AF+++LK D++
Sbjct: 550 STIKALRKNVLAKCYGGDISRKRKLLEKQKEGKKRMKQVGSVEVPQEAFMAVLKMDDQ 607


>gi|59800788|ref|YP_207500.1| GTP-binding protein LepA [Neisseria gonorrhoeae FA 1090]
 gi|194098078|ref|YP_002001126.1| GTP-binding protein LepA [Neisseria gonorrhoeae NCCP11945]
 gi|239998535|ref|ZP_04718459.1| GTP-binding protein LepA [Neisseria gonorrhoeae 35/02]
 gi|240013660|ref|ZP_04720573.1| GTP-binding protein LepA [Neisseria gonorrhoeae DGI18]
 gi|240016099|ref|ZP_04722639.1| GTP-binding protein LepA [Neisseria gonorrhoeae FA6140]
 gi|240115193|ref|ZP_04729255.1| GTP-binding protein LepA [Neisseria gonorrhoeae PID18]
 gi|240117479|ref|ZP_04731541.1| GTP-binding protein LepA [Neisseria gonorrhoeae PID1]
 gi|240120730|ref|ZP_04733692.1| GTP-binding protein LepA [Neisseria gonorrhoeae PID24-1]
 gi|240125286|ref|ZP_04738172.1| GTP-binding protein LepA [Neisseria gonorrhoeae SK-92-679]
 gi|240127740|ref|ZP_04740401.1| GTP-binding protein LepA [Neisseria gonorrhoeae SK-93-1035]
 gi|254493257|ref|ZP_05106428.1| GTP-binding protein lepA [Neisseria gonorrhoeae 1291]
 gi|260440989|ref|ZP_05794805.1| GTP-binding protein LepA [Neisseria gonorrhoeae DGI2]
 gi|268594394|ref|ZP_06128561.1| GTP-binding protein lepA [Neisseria gonorrhoeae 35/02]
 gi|268600874|ref|ZP_06135041.1| GTP-binding protein lepA [Neisseria gonorrhoeae PID18]
 gi|268603180|ref|ZP_06137347.1| GTP-binding protein lepA [Neisseria gonorrhoeae PID1]
 gi|268683888|ref|ZP_06150750.1| GTP-binding protein lepA [Neisseria gonorrhoeae SK-92-679]
 gi|268686131|ref|ZP_06152993.1| GTP-binding protein lepA [Neisseria gonorrhoeae SK-93-1035]
 gi|291044316|ref|ZP_06570025.1| GTP-binding protein lepA [Neisseria gonorrhoeae DGI2]
 gi|75432553|sp|Q5F9P9|LEPA_NEIG1 RecName: Full=Elongation factor 4; Short=EF-4; AltName:
           Full=Ribosomal back-translocase LepA
 gi|238690183|sp|B4RK41|LEPA_NEIG2 RecName: Full=Elongation factor 4; Short=EF-4; AltName:
           Full=Ribosomal back-translocase LepA
 gi|59717683|gb|AAW89088.1| putative GTP-binding protein [Neisseria gonorrhoeae FA 1090]
 gi|193933368|gb|ACF29192.1| GTP-binding protein LepA [Neisseria gonorrhoeae NCCP11945]
 gi|226512297|gb|EEH61642.1| GTP-binding protein lepA [Neisseria gonorrhoeae 1291]
 gi|268547783|gb|EEZ43201.1| GTP-binding protein lepA [Neisseria gonorrhoeae 35/02]
 gi|268585005|gb|EEZ49681.1| GTP-binding protein lepA [Neisseria gonorrhoeae PID18]
 gi|268587311|gb|EEZ51987.1| GTP-binding protein lepA [Neisseria gonorrhoeae PID1]
 gi|268624172|gb|EEZ56572.1| GTP-binding protein lepA [Neisseria gonorrhoeae SK-92-679]
 gi|268626415|gb|EEZ58815.1| GTP-binding protein lepA [Neisseria gonorrhoeae SK-93-1035]
 gi|291011210|gb|EFE03206.1| GTP-binding protein lepA [Neisseria gonorrhoeae DGI2]
 gi|317163811|gb|ADV07352.1| GTP-binding protein LepA [Neisseria gonorrhoeae TCDC-NG08107]
          Length = 597

 Score =  749 bits (1934), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 344/599 (57%), Positives = 467/599 (77%), Gaps = 2/599 (0%)

Query: 8   LSRIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVR 67
           +  IRNFSI+AHIDHGKSTLADRFIQ+C GL  REMS+QVLD+MDIE+ERGITIKAQT  
Sbjct: 1   MKNIRNFSIIAHIDHGKSTLADRFIQYCGGLDLREMSTQVLDSMDIEKERGITIKAQTAA 60

Query: 68  LNYTSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQAI 127
           LNY + D + YQLNLIDTPGHVDF+YEVSRSLSACEG+LLVVDA+QGVEAQT+AN Y AI
Sbjct: 61  LNYKARDGQVYQLNLIDTPGHVDFSYEVSRSLSACEGALLVVDASQGVEAQTVANCYTAI 120

Query: 128 DNNHEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERIVQQL 187
           D   E++ VLNK DLP+ADP+RV+++IE+ IGI    A+  SAK+G G+  +LE IV ++
Sbjct: 121 DLGVEVVPVLNKIDLPAADPERVEQEIEDIIGIDAVGAVQCSAKSGIGVEDVLEEIVAKI 180

Query: 188 PSPTSPEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVERIG 247
           P+PT  E  NAPL+A+++DSW+++Y+GV++L+R+ NG +     +R M T A+ QVE++G
Sbjct: 181 PAPTGDE--NAPLQAVIVDSWFDNYVGVVMLIRVKNGTIKLKDKVRFMSTKAETQVEQLG 238

Query: 248 ILTPKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVVFCG 307
           + TPK +  + L  GE+G +I  +KE+   +VGDT+T  ++P T  LPGF+ +Q  VF G
Sbjct: 239 VFTPKSVQKQELKAGEVGFLITGVKELGQAKVGDTVTLVANPATEPLPGFQEVQSQVFAG 298

Query: 308 LFPVDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERLERE 367
           L+PV++  +E LR A+ KL+LNDAS  FE E S ALGFGFRCGFLGLLHLEI+QERLERE
Sbjct: 299 LYPVESHDYEALRDALEKLQLNDASLKFEPEVSQALGFGFRCGFLGLLHLEIVQERLERE 358

Query: 368 FSLNLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEYLGSI 427
           F ++LI T+P+VVYE+ +  G   ++ NP  +P++  I  + EP I  TI+ P EY+G++
Sbjct: 359 FDMDLITTAPTVVYEVVLKSGEKIEVENPSKLPDIGSIETILEPIITATILVPQEYVGNV 418

Query: 428 LKLCQERRGIQIDMSHLDNRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDYRDS 487
           + LC ++RG+Q++M ++  + M+ Y+LP+NEV+ DF+D+LKS S+GYAS DY+  +++ S
Sbjct: 419 MTLCNQKRGVQVNMQYMGRQVMLTYDLPMNEVVMDFFDKLKSTSRGYASLDYHFKEFQPS 478

Query: 488 DLVKLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGGRIIA 547
           DL+KL I+VN E +DALS++VHR  +  +GR +  K++ LIP+QMF IA+QAAIG RIIA
Sbjct: 479 DLIKLDIMVNGEKVDALSLIVHRQSAVHKGRELASKMRELIPRQMFDIAVQAAIGSRIIA 538

Query: 548 RETVKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISILKTDNE 606
           RE VKA RK+V AKCYGGDITRK+KLLEKQK GK+RM++ G V+IPQSAF++IL+  ++
Sbjct: 539 RENVKALRKNVLAKCYGGDITRKKKLLEKQKAGKRRMKQVGNVEIPQSAFLAILQVSDK 597


>gi|288575877|ref|ZP_05977790.2| GTP-binding protein LepA [Neisseria mucosa ATCC 25996]
 gi|288566684|gb|EFC88244.1| GTP-binding protein LepA [Neisseria mucosa ATCC 25996]
          Length = 630

 Score =  749 bits (1933), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 344/599 (57%), Positives = 467/599 (77%), Gaps = 2/599 (0%)

Query: 8   LSRIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVR 67
           +  IRNFSI+AHIDHGKSTLADRFIQ+C GL  REMS+QVLD+MDIE+ERGITIKAQT  
Sbjct: 34  MKNIRNFSIIAHIDHGKSTLADRFIQYCGGLDLREMSTQVLDSMDIEKERGITIKAQTAA 93

Query: 68  LNYTSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQAI 127
           LNY + D + YQLNLIDTPGHVDF+YEVSRSLSACEG+LLVVDA+QGVEAQT+AN Y AI
Sbjct: 94  LNYKARDGQVYQLNLIDTPGHVDFSYEVSRSLSACEGALLVVDASQGVEAQTVANCYTAI 153

Query: 128 DNNHEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERIVQQL 187
           D   E++ VLNK DLP+ADPDRV+++IE+ IGI    A+  SAK+G G+  +LE IV ++
Sbjct: 154 DLGVEVVPVLNKIDLPAADPDRVEQEIEDIIGIDAVGAVQCSAKSGIGVEDVLEEIVAKI 213

Query: 188 PSPTSPEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVERIG 247
           P+PT  E  NAPL+A+++DSW+++Y+GV++L+R+ NG +     +R M T A+ QVE++G
Sbjct: 214 PAPTGDE--NAPLQAVIVDSWFDNYVGVVMLIRVKNGTIKLKDKVRFMSTKAETQVEQLG 271

Query: 248 ILTPKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVVFCG 307
           + TPK +  + L  GE+G +I  +KE+   +VGDT+T  ++P +  LPGF+ +Q  VF G
Sbjct: 272 VFTPKSVQKQELKAGEVGFLITGVKELGQAKVGDTVTLVANPASEPLPGFQEVQSQVFAG 331

Query: 308 LFPVDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERLERE 367
           L+PV++  +E LR A+ KL+LNDAS  FE E S ALGFGFRCGFLGLLHLEI+QERLERE
Sbjct: 332 LYPVESHDYEALRDALEKLQLNDASLKFEPEVSQALGFGFRCGFLGLLHLEIVQERLERE 391

Query: 368 FSLNLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEYLGSI 427
           F ++LI T+P+VVYE+ +  G   ++ NP  +P++  I  + EP I  TI+ P EY+G++
Sbjct: 392 FDMDLITTAPTVVYEVVLKSGEKIEVENPSKLPDIGSIETILEPIITATILVPQEYVGNV 451

Query: 428 LKLCQERRGIQIDMSHLDNRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDYRDS 487
           + LC ++RG+Q++M ++  + M+ Y+LP+NEV+ DF+D+LKS S+GYAS DY+  +++ S
Sbjct: 452 MTLCNQKRGVQVNMQYMGRQVMLTYDLPMNEVVMDFFDKLKSTSRGYASLDYHFKEFQPS 511

Query: 488 DLVKLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGGRIIA 547
           DL+KL I+VN E +DALS++VHR  +  RGR +  K++ LIP+QMF IA+QAAIG +IIA
Sbjct: 512 DLIKLDIMVNGEKVDALSLIVHRQSAVHRGRELAAKMRELIPRQMFDIAVQAAIGSQIIA 571

Query: 548 RETVKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISILKTDNE 606
           RE VKA RK+V AKCYGGDITRK+KLLEKQK GK+RM++ G V+IPQSAF++IL+  ++
Sbjct: 572 RENVKALRKNVLAKCYGGDITRKKKLLEKQKAGKRRMKQVGNVEIPQSAFLAILQVSDK 630


>gi|316983751|gb|EFV62732.1| GTP-binding protein LepA [Neisseria meningitidis H44/76]
          Length = 624

 Score =  749 bits (1933), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 345/603 (57%), Positives = 469/603 (77%), Gaps = 2/603 (0%)

Query: 4   KPTPLSRIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKA 63
           K T +  IRNFSI+AHIDHGKSTLADRFIQ+C GL  REMS+QVLD+MDIE+ERGITIKA
Sbjct: 24  KTTLMKNIRNFSIIAHIDHGKSTLADRFIQYCGGLDLREMSTQVLDSMDIEKERGITIKA 83

Query: 64  QTVRLNYTSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANV 123
           QT  LNY + D + YQLNLIDTPGHVDF+YEVSRSLSACEG+LLVVDA+QGVEAQT+AN 
Sbjct: 84  QTAALNYKARDGQVYQLNLIDTPGHVDFSYEVSRSLSACEGALLVVDASQGVEAQTVANC 143

Query: 124 YQAIDNNHEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERI 183
           Y AID   E++ VLNK DLP+ADP+RV+++IE+ IGI    A+  SAK+G G+  +LE I
Sbjct: 144 YTAIDLGVEVVPVLNKIDLPAADPERVEQEIEDIIGIDAVGAVQCSAKSGIGVEDVLEEI 203

Query: 184 VQQLPSPTSPEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQV 243
           V ++P+PT  E  NAPL+A+++DSW+++Y+GV++L+R+ NG +     +R M T A+ QV
Sbjct: 204 VAKIPAPTGDE--NAPLQAVIVDSWFDNYVGVVMLIRVKNGTIKLKDKVRFMSTKAETQV 261

Query: 244 ERIGILTPKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPV 303
           E++G+ TPK +  + L  GE+G +I  +KE+   +VGDT+T  ++P T  LPGF+ +Q  
Sbjct: 262 EQLGVFTPKSVQKQELKAGEVGFLITGVKELGQAKVGDTVTLVANPATEPLPGFQEVQSQ 321

Query: 304 VFCGLFPVDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQER 363
           VF GL+PV++  +E LR A+ KL+LNDAS  FE E S ALGFGFRCGFLGLLHLEI+QER
Sbjct: 322 VFAGLYPVESHDYEALRDALEKLQLNDASLKFEPEVSQALGFGFRCGFLGLLHLEIVQER 381

Query: 364 LEREFSLNLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEY 423
           LEREF ++LI T+P+V+YE+ +  G   ++ NP  +P++  I  + EP I  TI+ P EY
Sbjct: 382 LEREFDMDLITTAPTVIYEVVLKSGEKIEVENPSKLPDIGSIETILEPIITATILVPQEY 441

Query: 424 LGSILKLCQERRGIQIDMSHLDNRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVID 483
           +G+++ LC ++RG+Q++M ++  + M+ Y+LP+NEV+ DF+D+LKS S+GYAS DY+  +
Sbjct: 442 VGNVMTLCNQKRGVQVNMQYMGRQVMLTYDLPMNEVVMDFFDKLKSTSRGYASLDYHFKE 501

Query: 484 YRDSDLVKLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGG 543
           ++ SDL+KL I+VN E +DALS++VHR  +  RGR +  K++ LIP+QMF IA+QAAIG 
Sbjct: 502 FQPSDLIKLDIMVNGEKVDALSLIVHRQSAVHRGRELASKMRELIPRQMFDIAVQAAIGS 561

Query: 544 RIIARETVKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISILKT 603
           +IIARE VKA RK+V AKCYGGDITRK+KLLEKQK GK+RM++ G V+IPQSAF++IL+ 
Sbjct: 562 QIIARENVKALRKNVLAKCYGGDITRKKKLLEKQKAGKRRMKQVGNVEIPQSAFLAILQV 621

Query: 604 DNE 606
            ++
Sbjct: 622 SDK 624


>gi|78357858|ref|YP_389307.1| GTP-binding protein LepA [Desulfovibrio desulfuricans subsp.
           desulfuricans str. G20]
 gi|90185154|sp|Q30XI4|LEPA_DESDG RecName: Full=Elongation factor 4; Short=EF-4; AltName:
           Full=Ribosomal back-translocase LepA
 gi|78220263|gb|ABB39612.1| GTP-binding protein LepA [Desulfovibrio desulfuricans subsp.
           desulfuricans str. G20]
          Length = 601

 Score =  749 bits (1933), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 347/600 (57%), Positives = 471/600 (78%), Gaps = 5/600 (0%)

Query: 9   SRIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVRL 68
           S IRNFSI+AHIDHGKSTLADR +     +TER+   Q LD M++ERERGITIKAQ VR+
Sbjct: 5   SNIRNFSIIAHIDHGKSTLADRILDVTGLVTERDKRDQYLDRMELERERGITIKAQAVRI 64

Query: 69  NYTSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQAID 128
            Y + D ++Y LNLIDTPGHVDF+YEVSRSL+ACEG+LLVVDATQGVEAQTLANV+ A+D
Sbjct: 65  PYKAADGREYVLNLIDTPGHVDFSYEVSRSLAACEGALLVVDATQGVEAQTLANVFLALD 124

Query: 129 NNHEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERIVQQLP 188
           ++HEII VLNK DLPS+D  RVK +IE+ IG+   +A+ VSAKTG  +  +LE IV++LP
Sbjct: 125 HDHEIIPVLNKIDLPSSDIARVKAEIEDGIGLDAAEAVEVSAKTGLNVDKVLEAIVERLP 184

Query: 189 SPTSPEG-ANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVERIG 247
           +P   EG ++APL+AL+ DSWY+SY GV+V+ R+++G + KG SI++M T  KY+V R+G
Sbjct: 185 AP---EGDSDAPLQALIFDSWYDSYQGVVVMFRVMHGTIRKGDSIQMMATGKKYEVTRLG 241

Query: 248 ILTPKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVVFCG 307
           + +P+  D++    G++G + A+IKE+   +VGDT+T  S P  + LPGFK ++P+VFCG
Sbjct: 242 VFSPEAKDVDCFTAGDVGFLCAAIKELGDAKVGDTVTHSSRPAATPLPGFKEVKPMVFCG 301

Query: 308 LFPVDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERLERE 367
           L+P D++++E L+ A+ KL+LNDA+FSFE E S ALGFG+RCGFLGLLH+EI+QERLERE
Sbjct: 302 LYPTDSSEYEQLKYALEKLQLNDAAFSFEAETSQALGFGYRCGFLGLLHMEIVQERLERE 361

Query: 368 FSLNLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEYLGSI 427
           F++ LI T+PSVVY++   DG  + + NP  +P+ TKI  L EP++++ I  PNE++G++
Sbjct: 362 FNIGLIATAPSVVYKVLTVDGEEKYIENPAALPDPTKIEGLYEPYVRMEIHVPNEFVGNV 421

Query: 428 LKLCQERRGIQIDMSHLD-NRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDYRD 486
            KLC+E+RGIQ DM +L  NR +I YELP  E+++DF+D+LKS+++GYAS DY +IDYR 
Sbjct: 422 FKLCEEKRGIQKDMRYLAVNRVIITYELPFAEIVYDFFDKLKSLTRGYASMDYEIIDYRQ 481

Query: 487 SDLVKLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGGRII 546
           S+LVKL +L+N + +DAL+ +VHR  +  +GR I  +LK  IP+QMF++ +QAAIG +II
Sbjct: 482 SNLVKLDMLINGDPVDALACIVHRDKAYYQGRAIALRLKRTIPRQMFEVVVQAAIGNKII 541

Query: 547 ARETVKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISILKTDNE 606
           ARE     RK+VTAKCYGGDITRKRKLLEKQKEGKKRM+R G V++PQ AF++ L+ D+E
Sbjct: 542 ARERNAPLRKNVTAKCYGGDITRKRKLLEKQKEGKKRMKRMGNVELPQEAFLAALQVDDE 601


>gi|241759862|ref|ZP_04757962.1| GTP-binding protein LepA [Neisseria flavescens SK114]
 gi|241319870|gb|EER56266.1| GTP-binding protein LepA [Neisseria flavescens SK114]
          Length = 597

 Score =  749 bits (1933), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 346/599 (57%), Positives = 466/599 (77%), Gaps = 2/599 (0%)

Query: 8   LSRIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVR 67
           +  IRNFSI+AHIDHGKSTLADRFIQ+C GL  REMS+QVLD+MDIE+ERGITIKAQT  
Sbjct: 1   MKNIRNFSIIAHIDHGKSTLADRFIQYCGGLDLREMSTQVLDSMDIEKERGITIKAQTAA 60

Query: 68  LNYTSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQAI 127
           LNY + D + YQLNLIDTPGHVDF+YEVSRSLSACEG+LLVVDA+QGVEAQT+AN Y AI
Sbjct: 61  LNYKARDGQVYQLNLIDTPGHVDFSYEVSRSLSACEGALLVVDASQGVEAQTVANCYTAI 120

Query: 128 DNNHEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERIVQQL 187
           D   E++ VLNK DLP+ADP+RV+++IE+ IGI    A+  SAK+G G+  +LE IV ++
Sbjct: 121 DLGVEVVPVLNKIDLPAADPERVEQEIEDIIGIDAVGAVQCSAKSGIGVEDVLEEIVAKI 180

Query: 188 PSPTSPEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVERIG 247
           P+PT  E  NAPL+A+++DSW+++Y+GV++L+R+ NG +     +R M T A+ QVE++G
Sbjct: 181 PAPTGDE--NAPLQAVIVDSWFDNYVGVVMLIRVKNGTIKLKDKVRFMSTKAETQVEQLG 238

Query: 248 ILTPKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVVFCG 307
           + TPK +  + L  GE+G +I  +KE+   +VGDT+T  ++P +  LPGFK +Q  VF G
Sbjct: 239 VFTPKSVQKQELKAGEVGFLITGVKELGQAKVGDTVTLVANPASEPLPGFKEVQSQVFAG 298

Query: 308 LFPVDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERLERE 367
           L+PV++  +E LR A+ KL+LNDAS  FE E S ALGFGFRCGFLGLLHLEI+QERLERE
Sbjct: 299 LYPVESHDYEALRDALEKLQLNDASLKFEPEVSQALGFGFRCGFLGLLHLEIVQERLERE 358

Query: 368 FSLNLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEYLGSI 427
           F ++LI T+P+VVYE+ + +G    + NP  +P++  I  + EP I  TI+ P +Y+G++
Sbjct: 359 FDMDLITTAPTVVYEVILKNGEKIDVENPSKLPDIATIDTIMEPIITATILVPQDYVGNV 418

Query: 428 LKLCQERRGIQIDMSHLDNRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDYRDS 487
           + LC ++RG+Q +M ++  + M+ Y+LP+NEV+ DF+D+LKS S+GYAS DY   ++  S
Sbjct: 419 MTLCNQKRGVQRNMQYMGRQVMLTYDLPMNEVVMDFFDKLKSTSRGYASLDYEFKEFMPS 478

Query: 488 DLVKLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGGRIIA 547
           DLVKL I+VN + +DALS++VHR  S +RGR +  K++ LIP+QMF IA+QAAIGG+IIA
Sbjct: 479 DLVKLDIMVNGDKVDALSLIVHRQTSVQRGRELAAKMRELIPRQMFDIAVQAAIGGQIIA 538

Query: 548 RETVKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISILKTDNE 606
           RE VKA RK+V AKCYGGDITRK+KLLEKQK GKKRM++ G V+IPQSAF++IL+  ++
Sbjct: 539 RENVKALRKNVLAKCYGGDITRKKKLLEKQKAGKKRMKQVGNVEIPQSAFLAILQVSDK 597


>gi|121634562|ref|YP_974807.1| GTP-binding protein LepA [Neisseria meningitidis FAM18]
 gi|304387925|ref|ZP_07370098.1| GTP-binding protein LepA [Neisseria meningitidis ATCC 13091]
 gi|166224501|sp|A1KT27|LEPA_NEIMF RecName: Full=Elongation factor 4; Short=EF-4; AltName:
           Full=Ribosomal back-translocase LepA
 gi|120866268|emb|CAM10009.1| putative GTP-binding protein [Neisseria meningitidis FAM18]
 gi|304338022|gb|EFM04159.1| GTP-binding protein LepA [Neisseria meningitidis ATCC 13091]
 gi|325137830|gb|EGC60405.1| GTP-binding protein LepA [Neisseria meningitidis ES14902]
 gi|325202437|gb|ADY97891.1| GTP-binding protein LepA [Neisseria meningitidis M01-240149]
 gi|325207811|gb|ADZ03263.1| GTP-binding protein LepA [Neisseria meningitidis NZ-05/33]
          Length = 597

 Score =  749 bits (1933), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 344/599 (57%), Positives = 467/599 (77%), Gaps = 2/599 (0%)

Query: 8   LSRIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVR 67
           +  IRNFSI+AHIDHGKSTLADRFIQ+C GL  REMS+QVLD+MDIE+ERGITIKAQT  
Sbjct: 1   MKNIRNFSIIAHIDHGKSTLADRFIQYCGGLDLREMSTQVLDSMDIEKERGITIKAQTAA 60

Query: 68  LNYTSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQAI 127
           LNY + D + YQLNLIDTPGHVDF+YEVSRSLSACEG+LLVVDA+QGVEAQT+AN Y AI
Sbjct: 61  LNYKARDGQVYQLNLIDTPGHVDFSYEVSRSLSACEGALLVVDASQGVEAQTVANCYTAI 120

Query: 128 DNNHEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERIVQQL 187
           D   E++ VLNK DLP+ADP+RV+++IE+ IGI    A+  SAK+G G+  +LE IV ++
Sbjct: 121 DLGVEVVPVLNKIDLPAADPERVEQEIEDIIGIDAVGAVQCSAKSGIGVEDVLEEIVAKI 180

Query: 188 PSPTSPEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVERIG 247
           P+PT  E  NAPL+A+++DSW+++Y+GV++L+R+ NG +     +R M T A+ QVE++G
Sbjct: 181 PAPTGDE--NAPLQAVIVDSWFDNYVGVVMLIRVKNGTIKLKDKVRFMSTKAETQVEQLG 238

Query: 248 ILTPKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVVFCG 307
           + TPK +  + L  GE+G +I  +KE+   +VGDT+T  ++P T  LPGF+ +Q  VF G
Sbjct: 239 VFTPKSVQKQELKAGEVGFLITGVKELGQAKVGDTVTLVANPATEPLPGFQEVQSQVFAG 298

Query: 308 LFPVDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERLERE 367
           L+PV++  +E LR A+ KL+LNDAS  FE E S ALGFGFRCGFLGLLHLEI+QERLERE
Sbjct: 299 LYPVESHDYEALRDALEKLQLNDASLKFEPEVSQALGFGFRCGFLGLLHLEIVQERLERE 358

Query: 368 FSLNLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEYLGSI 427
           F ++LI T+P+VVYE+ +  G   ++ NP  +P++  I  + EP I  TI+ P EY+G++
Sbjct: 359 FDMDLITTAPTVVYEVVLKSGEKIEVENPSKLPDIGSIETILEPIITATILVPQEYVGNV 418

Query: 428 LKLCQERRGIQIDMSHLDNRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDYRDS 487
           + LC ++RG+Q++M ++  + M+ Y+LP+NEV+ DF+D+LKS S+GYAS DY+  +++ S
Sbjct: 419 MTLCNQKRGVQVNMQYMGRQVMLTYDLPMNEVVMDFFDKLKSTSRGYASLDYHFKEFQPS 478

Query: 488 DLVKLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGGRIIA 547
           DL+KL I+VN E +DALS++VHR  +  RGR +  K++ LIP+QMF IA+QAAIG +IIA
Sbjct: 479 DLIKLDIMVNGEKVDALSLIVHRQSAVHRGRELASKMRELIPRQMFDIAVQAAIGSQIIA 538

Query: 548 RETVKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISILKTDNE 606
           RE VKA RK+V AKCYGGDITRK+KLLEKQK GK+RM++ G V+IPQSAF++IL+  ++
Sbjct: 539 RENVKALRKNVLAKCYGGDITRKKKLLEKQKAGKRRMKQVGNVEIPQSAFLAILQVSDK 597


>gi|255019678|ref|ZP_05291757.1| Translation elongation factor LepA [Acidithiobacillus caldus ATCC
           51756]
 gi|254970901|gb|EET28384.1| Translation elongation factor LepA [Acidithiobacillus caldus ATCC
           51756]
          Length = 600

 Score =  749 bits (1933), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 356/597 (59%), Positives = 464/597 (77%), Gaps = 2/597 (0%)

Query: 9   SRIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVRL 68
           S IRNFSI+AH+DHGKSTLAD+FI+ C  L++REMS QVLD+MDIERERGITIKAQ+VRL
Sbjct: 5   SLIRNFSIIAHVDHGKSTLADQFIRLCGALSDREMSQQVLDSMDIERERGITIKAQSVRL 64

Query: 69  NYTSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQAID 128
           NY + D K Y  NLIDTPGHVDF+YEVSRSL+ACEG+LLVVDA+QGVEAQ++AN Y A++
Sbjct: 65  NYRADDGKLYAFNLIDTPGHVDFSYEVSRSLAACEGALLVVDASQGVEAQSVANCYTAME 124

Query: 129 NNHEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERIVQQLP 188
           ++ EII VLNK DLP+ADP+RV+++IEE +G+   DA+L SAK G GI  +LE++V+Q+P
Sbjct: 125 HDLEIIPVLNKIDLPAADPERVRREIEEIVGLPAADAILASAKEGIGIREILEQVVRQIP 184

Query: 189 SPTSPEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVERIGI 248
            P      +APL+AL+IDSW+++Y+G +VLVR++NG L  GQ IR M     Y VE++G+
Sbjct: 185 PPRGER--DAPLQALIIDSWFDNYVGTVVLVRVVNGSLRAGQKIRTMAGQKDYVVEKVGV 242

Query: 249 LTPKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVVFCGL 308
            TPK + +  L  G +G +IA ++ +   RVGDT+TD S P    LPGF+ +QP VF GL
Sbjct: 243 FTPKALIVPELETGAVGFVIAGVRSIDGARVGDTLTDASRPAAQPLPGFRQVQPQVFTGL 302

Query: 309 FPVDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERLEREF 368
           +PVD++ +E+ R A+ KLRLND++  FE E S ALGFGFRCGFLGLLH+EI+QERLERE+
Sbjct: 303 YPVDSSDYESFREALQKLRLNDSALQFEPETSQALGFGFRCGFLGLLHMEIVQERLEREY 362

Query: 369 SLNLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEYLGSIL 428
            L LI T+P+VVYE+   DGS+  +SNP D+P   +I ++REP I   I+TP  YLG ++
Sbjct: 363 GLELISTAPTVVYEVETTDGSVLHISNPADLPVPNRIHDIREPVILANILTPEAYLGPVI 422

Query: 429 KLCQERRGIQIDMSHLDNRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDYRDSD 488
            LC+ERRG Q ++     + M+ YELPLNEV+ DF+DRLKSVS+GYAS DY    +    
Sbjct: 423 TLCEERRGRQKNLQFTGGQVMVSYELPLNEVVLDFFDRLKSVSRGYASMDYEFARFESGP 482

Query: 489 LVKLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGGRIIAR 548
           LVK+ +L+N E +DALS +VHR  +E+RGR +  +LK LIP+QMF++AIQAAIG +IIAR
Sbjct: 483 LVKMDVLINGEKLDALSWIVHRDFAERRGRELVGRLKELIPRQMFEVAIQAAIGAKIIAR 542

Query: 549 ETVKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISILKTDN 605
           ETVKA RK+V AKCYGGDITRKRKLLEKQKEGKKRM++ G V+IPQ AF++IL++D 
Sbjct: 543 ETVKALRKNVLAKCYGGDITRKRKLLEKQKEGKKRMKQVGHVEIPQEAFLAILQSDK 599


>gi|296313840|ref|ZP_06863781.1| GTP-binding protein LepA [Neisseria polysaccharea ATCC 43768]
 gi|296839571|gb|EFH23509.1| GTP-binding protein LepA [Neisseria polysaccharea ATCC 43768]
          Length = 597

 Score =  749 bits (1933), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 344/599 (57%), Positives = 467/599 (77%), Gaps = 2/599 (0%)

Query: 8   LSRIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVR 67
           +  IRNFSI+AHIDHGKSTLADRFIQ+C GL  REMS+QVLD+MDIE+ERGITIKAQT  
Sbjct: 1   MKNIRNFSIIAHIDHGKSTLADRFIQYCGGLDLREMSTQVLDSMDIEKERGITIKAQTAA 60

Query: 68  LNYTSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQAI 127
           LNY + D + YQLNLIDTPGHVDF+YEVSRSLSACEG+LLVVDA+QGVEAQT+AN Y AI
Sbjct: 61  LNYKARDGQVYQLNLIDTPGHVDFSYEVSRSLSACEGALLVVDASQGVEAQTVANCYTAI 120

Query: 128 DNNHEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERIVQQL 187
           D   E++ VLNK DLP+ADP+RV+++IE+ IGI    A+  SAK+G G+  +LE IV ++
Sbjct: 121 DLGVEVVPVLNKIDLPAADPERVEQEIEDIIGIDAVGAVQCSAKSGIGVEDVLEEIVAKI 180

Query: 188 PSPTSPEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVERIG 247
           P+PT  E  NAPL+A+++DSW+++Y+GV++L+R+ NG +     +R M T A+ QVE++G
Sbjct: 181 PAPTGDE--NAPLQAVIVDSWFDNYVGVVMLIRVKNGTIKLKDKVRFMSTKAETQVEQLG 238

Query: 248 ILTPKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVVFCG 307
           + TPK +  + L  GE+G +I  +KE+   +VGDT+T  ++P +  LPGF+ +Q  VF G
Sbjct: 239 VFTPKSVQKQELKAGEVGFLITGVKELGQAKVGDTVTLVANPASEPLPGFQEVQSQVFAG 298

Query: 308 LFPVDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERLERE 367
           L+PV++  +E LR A+ KL+LNDAS  FE E S ALGFGFRCGFLGLLHLEI+QERLERE
Sbjct: 299 LYPVESHDYEALRDALEKLQLNDASLKFEPEVSQALGFGFRCGFLGLLHLEIVQERLERE 358

Query: 368 FSLNLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEYLGSI 427
           F ++LI T+P+VVYE+ +  G   ++ NP  +P++  I  + EP I  TI+ P EY+G++
Sbjct: 359 FDMDLITTAPTVVYEVVLKSGEKIEVENPSKLPDIGSIETILEPIITATILVPQEYVGNV 418

Query: 428 LKLCQERRGIQIDMSHLDNRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDYRDS 487
           + LC ++RG+Q++M ++  + M+ Y+LP+NEV+ DF+D+LKS S+GYAS DY+  +++ S
Sbjct: 419 MTLCNQKRGVQVNMQYMGRQVMLTYDLPMNEVVMDFFDKLKSTSRGYASLDYHFKEFQPS 478

Query: 488 DLVKLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGGRIIA 547
           DL+KL I+VN E +DALS++VHR  S  RGR +  K++ LIP+QMF IA+QAAIG +IIA
Sbjct: 479 DLIKLDIMVNGEKVDALSLIVHRQSSVHRGRELASKMRELIPRQMFDIAVQAAIGSQIIA 538

Query: 548 RETVKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISILKTDNE 606
           RE VKA RK+V AKCYGGDITRK+KLLEKQK GK+RM++ G V+IPQSAF++IL+  ++
Sbjct: 539 RENVKALRKNVLAKCYGGDITRKKKLLEKQKAGKRRMKQVGNVEIPQSAFLAILQVSDK 597


>gi|303247972|ref|ZP_07334239.1| GTP-binding protein LepA [Desulfovibrio fructosovorans JJ]
 gi|302490696|gb|EFL50599.1| GTP-binding protein LepA [Desulfovibrio fructosovorans JJ]
          Length = 600

 Score =  749 bits (1933), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 355/600 (59%), Positives = 459/600 (76%), Gaps = 3/600 (0%)

Query: 8   LSRIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVR 67
           +SRIRNFSI+AHIDHGKSTLADR ++    +T REM  Q LD MD+ERERGITIKAQTVR
Sbjct: 3   ISRIRNFSIIAHIDHGKSTLADRILELTGVITAREMREQYLDRMDLERERGITIKAQTVR 62

Query: 68  LNYTSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQAI 127
           + Y + D  +Y LNLIDTPGHVDF+YEVSRSL+ACEG+LLVVDATQGVEAQTLANV+ A+
Sbjct: 63  IPYKAADGTEYILNLIDTPGHVDFSYEVSRSLAACEGALLVVDATQGVEAQTLANVFLAL 122

Query: 128 DNNHEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERIVQQL 187
           DN+ EII VLNK DLPSADP+ VK +IEE IG+   DA+ VSAKTG  +  +LE+I+ ++
Sbjct: 123 DNDLEIIPVLNKIDLPSADPEAVKAEIEEAIGLPCADAVAVSAKTGVNVGAVLEQIITKI 182

Query: 188 PSPTSPEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVERIG 247
           P P     A  PLKAL++DSWY+SY GV+VL R+I+G +  GQ I++M T A ++V R+G
Sbjct: 183 PPPKGDPAA--PLKALVVDSWYDSYQGVVVLFRVIDGTVKLGQRIKMMSTGATFEVIRLG 240

Query: 248 ILTPKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVVFCG 307
             +P  IDI +  PGE G + A+IK ++  RVGDT+T         LPGFK ++P+VFCG
Sbjct: 241 AFSPGPIDIPSFGPGEAGFLCANIKTLTDARVGDTVTTAEEGAVVPLPGFKEVKPMVFCG 300

Query: 308 LFPVDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERLERE 367
           L+PVDA ++E L+TA+ KLRLNDA+F++E E S ALGFGFRCGFLGLLH+EIIQERLERE
Sbjct: 301 LYPVDAAEYEVLKTALEKLRLNDAAFTYEPETSQALGFGFRCGFLGLLHMEIIQERLERE 360

Query: 368 FSLNLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEYLGSI 427
           F  NLI T+PSV+Y++    G    + NP  +P+  +IA L EP+ ++ I TPNEY+G +
Sbjct: 361 FGANLIATAPSVIYKVEKLSGETISIENPSKLPKTQEIAALYEPYARLEIHTPNEYVGGV 420

Query: 428 LKLCQERRGIQIDMSHLD-NRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDYRD 486
            KLC+E+RGIQ D+ +L   R +I YELP  E+++DF+DRLKS ++GYAS DY +IDYR 
Sbjct: 421 FKLCEEKRGIQKDVRYLTATRVIITYELPFAEIVYDFFDRLKSATRGYASLDYEIIDYRA 480

Query: 487 SDLVKLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGGRII 546
           SDLVKL I++N + +DAL+++VHR  +   GR +  KLK +IP+Q+F++ IQAAIG +II
Sbjct: 481 SDLVKLDIMINGDPVDALAVIVHRDNAYHYGRALALKLKRVIPRQLFEVVIQAAIGTKII 540

Query: 547 ARETVKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISILKTDNE 606
           ARE      K+VTAKCYGGDITRKRKLLEKQKEGKKRM+R G V++PQ AF++ LK  ++
Sbjct: 541 ARERNAPMGKNVTAKCYGGDITRKRKLLEKQKEGKKRMKRMGNVELPQEAFLAALKAGDD 600


>gi|15676664|ref|NP_273808.1| GTP-binding protein LepA [Neisseria meningitidis MC58]
 gi|254804646|ref|YP_003082867.1| GTP-binding protein [Neisseria meningitidis alpha14]
 gi|24211956|sp|Q9K055|LEPA_NEIMB RecName: Full=Elongation factor 4; Short=EF-4; AltName:
           Full=Ribosomal back-translocase LepA
 gi|7225996|gb|AAF41179.1| GTP-binding protein LepA [Neisseria meningitidis MC58]
 gi|254668188|emb|CBA04904.1| GTP-binding protein [Neisseria meningitidis alpha14]
 gi|325140080|gb|EGC62609.1| GTP-binding protein LepA [Neisseria meningitidis CU385]
 gi|325200548|gb|ADY96003.1| GTP-binding protein LepA [Neisseria meningitidis H44/76]
 gi|325203853|gb|ADY99306.1| GTP-binding protein LepA [Neisseria meningitidis M01-240355]
          Length = 597

 Score =  748 bits (1932), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 343/599 (57%), Positives = 467/599 (77%), Gaps = 2/599 (0%)

Query: 8   LSRIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVR 67
           +  IRNFSI+AHIDHGKSTLADRFIQ+C GL  REMS+QVLD+MDIE+ERGITIKAQT  
Sbjct: 1   MKNIRNFSIIAHIDHGKSTLADRFIQYCGGLDLREMSTQVLDSMDIEKERGITIKAQTAA 60

Query: 68  LNYTSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQAI 127
           LNY + D + YQLNLIDTPGHVDF+YEVSRSLSACEG+LLVVDA+QGVEAQT+AN Y AI
Sbjct: 61  LNYKARDGQVYQLNLIDTPGHVDFSYEVSRSLSACEGALLVVDASQGVEAQTVANCYTAI 120

Query: 128 DNNHEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERIVQQL 187
           D   E++ VLNK DLP+ADP+RV+++IE+ IGI    A+  SAK+G G+  +LE IV ++
Sbjct: 121 DLGVEVVPVLNKIDLPAADPERVEQEIEDIIGIDAVGAVQCSAKSGIGVEDVLEEIVAKI 180

Query: 188 PSPTSPEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVERIG 247
           P+PT  E  NAPL+A+++DSW+++Y+GV++L+R+ NG +     +R M T A+ QVE++G
Sbjct: 181 PAPTGDE--NAPLQAVIVDSWFDNYVGVVMLIRVKNGTIKLKDKVRFMSTKAETQVEQLG 238

Query: 248 ILTPKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVVFCG 307
           + TPK +  + L  GE+G +I  +KE+   +VGDT+T  ++P T  LPGF+ +Q  VF G
Sbjct: 239 VFTPKSVQKQELKAGEVGFLITGVKELGQAKVGDTVTLVANPATEPLPGFQEVQSQVFAG 298

Query: 308 LFPVDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERLERE 367
           L+PV++  +E LR A+ KL+LNDAS  FE E S ALGFGFRCGFLGLLHLEI+QERLERE
Sbjct: 299 LYPVESHDYEALRDALEKLQLNDASLKFEPEVSQALGFGFRCGFLGLLHLEIVQERLERE 358

Query: 368 FSLNLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEYLGSI 427
           F ++LI T+P+V+YE+ +  G   ++ NP  +P++  I  + EP I  TI+ P EY+G++
Sbjct: 359 FDMDLITTAPTVIYEVVLKSGEKIEVENPSKLPDIGSIETILEPIITATILVPQEYVGNV 418

Query: 428 LKLCQERRGIQIDMSHLDNRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDYRDS 487
           + LC ++RG+Q++M ++  + M+ Y+LP+NEV+ DF+D+LKS S+GYAS DY+  +++ S
Sbjct: 419 MTLCNQKRGVQVNMQYMGRQVMLTYDLPMNEVVMDFFDKLKSTSRGYASLDYHFKEFQPS 478

Query: 488 DLVKLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGGRIIA 547
           DL+KL I+VN E +DALS++VHR  +  RGR +  K++ LIP+QMF IA+QAAIG +IIA
Sbjct: 479 DLIKLDIMVNGEKVDALSLIVHRQSAVHRGRELASKMRELIPRQMFDIAVQAAIGSQIIA 538

Query: 548 RETVKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISILKTDNE 606
           RE VKA RK+V AKCYGGDITRK+KLLEKQK GK+RM++ G V+IPQSAF++IL+  ++
Sbjct: 539 RENVKALRKNVLAKCYGGDITRKKKLLEKQKAGKRRMKQVGNVEIPQSAFLAILQVSDK 597


>gi|325144196|gb|EGC66503.1| GTP-binding protein LepA [Neisseria meningitidis M01-240013]
          Length = 624

 Score =  748 bits (1931), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 345/603 (57%), Positives = 469/603 (77%), Gaps = 2/603 (0%)

Query: 4   KPTPLSRIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKA 63
           K T +  IRNFSI+AHIDHGKSTLADRFIQ+C GL  REMS+QVLD+MDIE+ERGITIKA
Sbjct: 24  KTTLMKNIRNFSIIAHIDHGKSTLADRFIQYCGGLDLREMSTQVLDSMDIEKERGITIKA 83

Query: 64  QTVRLNYTSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANV 123
           QT  LNY + D + YQLNLIDTPGHVDF+YEVSRSLSACEG+LLVVDA+QGVEAQT+AN 
Sbjct: 84  QTAALNYKARDGQVYQLNLIDTPGHVDFSYEVSRSLSACEGALLVVDASQGVEAQTVANC 143

Query: 124 YQAIDNNHEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERI 183
           Y AID   E++ VLNK DLP+ADP+RV+++IE+ IGI    A+  SAK+G G+  +LE I
Sbjct: 144 YTAIDLGVEVVPVLNKIDLPAADPERVEQEIEDIIGIDAVGAVQCSAKSGIGVEDVLEEI 203

Query: 184 VQQLPSPTSPEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQV 243
           V ++P+PT  E  NAPL+A+++DSW+++Y+GV++L+R+ NG +     +R M T A+ QV
Sbjct: 204 VAKVPAPTGDE--NAPLQAVIVDSWFDNYVGVVMLIRVKNGTIKLKDKVRFMSTKAETQV 261

Query: 244 ERIGILTPKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPV 303
           E++G+ TPK +  + L  GE+G +I  +KE+   +VGDT+T  ++P +  LPGF+ +Q  
Sbjct: 262 EQLGVFTPKSVQKQELKAGEVGFLITGVKELGQAKVGDTVTLVANPASEPLPGFQEVQSQ 321

Query: 304 VFCGLFPVDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQER 363
           VF GL+PV++  +E LR A+ KL+LNDAS  FE E S ALGFGFRCGFLGLLHLEI+QER
Sbjct: 322 VFAGLYPVESHDYEALRDALEKLQLNDASLKFEPEVSQALGFGFRCGFLGLLHLEIVQER 381

Query: 364 LEREFSLNLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEY 423
           LEREF ++LI T+P+VVYE+ +  G   ++ NP  +P++  I  + EP I  TI+ P EY
Sbjct: 382 LEREFDMDLITTAPTVVYEVVLKSGEKIEVENPSKLPDIGSIETILEPIITATILVPQEY 441

Query: 424 LGSILKLCQERRGIQIDMSHLDNRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVID 483
           +G+++ LC ++RG+Q++M ++  + M+ Y+LP+NEV+ DF+D+LKS S+GYAS DY+  +
Sbjct: 442 VGNVMTLCNQKRGVQVNMQYMGRQVMLTYDLPMNEVVMDFFDKLKSTSRGYASLDYHFKE 501

Query: 484 YRDSDLVKLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGG 543
           ++ SDL+KL I+VN E +DALS++VHR  +  RGR +  K++ LIP+QMF IA+QAAIG 
Sbjct: 502 FQPSDLIKLDIMVNGEKVDALSLIVHRQSAVHRGRELASKMRELIPRQMFDIAVQAAIGS 561

Query: 544 RIIARETVKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISILKT 603
           +IIARE VKA RK+V AKCYGGDITRK+KLLEKQK GK+RM++ G V+IPQSAF++IL+ 
Sbjct: 562 QIIARENVKALRKNVLAKCYGGDITRKKKLLEKQKAGKRRMKQVGNVEIPQSAFLAILQV 621

Query: 604 DNE 606
            ++
Sbjct: 622 SDK 624


>gi|329119321|ref|ZP_08248008.1| GTP-binding protein LepA [Neisseria bacilliformis ATCC BAA-1200]
 gi|327464668|gb|EGF10966.1| GTP-binding protein LepA [Neisseria bacilliformis ATCC BAA-1200]
          Length = 597

 Score =  748 bits (1931), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 346/595 (58%), Positives = 462/595 (77%), Gaps = 2/595 (0%)

Query: 8   LSRIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVR 67
           +  IRNFSI+AHIDHGKSTLADRFIQ+C GL +REMS+QVLD+MDIE+ERGITIKAQT  
Sbjct: 1   MKNIRNFSIIAHIDHGKSTLADRFIQYCGGLEQREMSTQVLDSMDIEKERGITIKAQTAA 60

Query: 68  LNYTSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQAI 127
           LNY + D + Y LNLIDTPGHVDF+YEVSRSLSACEG+LLVVDA+QGVEAQT+AN Y AI
Sbjct: 61  LNYKAKDGETYLLNLIDTPGHVDFSYEVSRSLSACEGALLVVDASQGVEAQTVANCYTAI 120

Query: 128 DNNHEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERIVQQL 187
           D   E++ VLNK DLP+ADPDRV ++IE+ IGI    A+  SAK+G G+  +LE IV ++
Sbjct: 121 DLGVEVVPVLNKIDLPAADPDRVAQEIEDIIGIDAVGAVTCSAKSGLGVEDVLEEIVAKI 180

Query: 188 PSPTSPEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVERIG 247
           P+P     A APL+A++IDSW+++Y+GV++L+RI NG L     +R M T A+ QVE++G
Sbjct: 181 PAPQGD--AAAPLQAVIIDSWFDNYVGVVMLIRIKNGSLKLKDKVRFMSTKAESQVEQLG 238

Query: 248 ILTPKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVVFCG 307
           + TPK +  + L  GE+G +I  +KE+   +VGDT+T  ++P    LPGFK +Q  VF G
Sbjct: 239 VFTPKSVQKQELKAGEVGFLITGVKELGQAKVGDTVTLAANPAAEPLPGFKEVQSQVFAG 298

Query: 308 LFPVDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERLERE 367
           L+PV++  +E LR A+ KL+LNDAS  FE E S ALGFGFRCGFLGLLHLEI+QERLERE
Sbjct: 299 LYPVESHDYEALRDALEKLQLNDASLKFEPEVSQALGFGFRCGFLGLLHLEIVQERLERE 358

Query: 368 FSLNLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEYLGSI 427
           F ++LI T+P+VVYE+ + +G    + NP  +P++  I  + EP I  TI+ P +Y+G++
Sbjct: 359 FDMDLITTAPTVVYEVILKNGEKIDVENPSKLPDIGTIETIMEPIITATILVPQDYVGNV 418

Query: 428 LKLCQERRGIQIDMSHLDNRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDYRDS 487
           + LC ++RG+Q +M ++  + M+ Y+LP+NEV+ DF+D+LKS S+GYAS DY+  +++ S
Sbjct: 419 MTLCNQKRGVQRNMQYMGRQVMLTYDLPMNEVVMDFFDKLKSTSRGYASLDYDFKEFQPS 478

Query: 488 DLVKLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGGRIIA 547
           DLVKL I+VN + +DALS++VHR  + +RGR +  K++ LIP+QMF IA+QAAIGG+IIA
Sbjct: 479 DLVKLDIMVNGDKVDALSLIVHRQTAVQRGRELASKMRELIPRQMFDIAVQAAIGGQIIA 538

Query: 548 RETVKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISILK 602
           RE VKA RK+V AKCYGGDITRK+KLLEKQK GKKRM++ G V+IPQSAF++IL+
Sbjct: 539 RENVKALRKNVLAKCYGGDITRKKKLLEKQKAGKKRMKQVGNVEIPQSAFLAILE 593


>gi|30250254|ref|NP_842324.1| GTP-binding protein LepA [Nitrosomonas europaea ATCC 19718]
 gi|33112354|sp|Q820H8|LEPA_NITEU RecName: Full=Elongation factor 4; Short=EF-4; AltName:
           Full=Ribosomal back-translocase LepA
 gi|30181049|emb|CAD86239.1| GTP-binding elongation factor:Elongation factor Tu domain 2
           [Nitrosomonas europaea ATCC 19718]
          Length = 598

 Score =  748 bits (1930), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 356/600 (59%), Positives = 470/600 (78%), Gaps = 4/600 (0%)

Query: 8   LSRIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVR 67
           +  IRNFSI+AHIDHGKSTLADR IQ C GL++REM  QVLD+MD+ERERGITIKAQT  
Sbjct: 2   IQHIRNFSIIAHIDHGKSTLADRIIQFCGGLSDREMEDQVLDSMDLERERGITIKAQTAA 61

Query: 68  LNYTSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQAI 127
           L+Y + D K+Y LNLIDTPGHVDF+YEVSRSLSACEG+LLVVDA+QGVEAQT+AN Y AI
Sbjct: 62  LHYQAKDGKNYLLNLIDTPGHVDFSYEVSRSLSACEGALLVVDASQGVEAQTVANCYTAI 121

Query: 128 DNNHEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERIVQQL 187
           +   E+I VLNK DLP+ADPDRV  ++E+ IGI  + AL +SAKTGEG+  +LE IV Q+
Sbjct: 122 EQGVEVIPVLNKIDLPAADPDRVIAEVEDIIGIEAKGALRISAKTGEGVDQVLEMIVAQI 181

Query: 188 PSPTSPEG-ANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVERI 246
           P P   EG  +APLKAL+IDSW++SY+GV++LVR+++G L  G  I LM + A Y  E +
Sbjct: 182 PPP---EGDVDAPLKALIIDSWFDSYVGVVMLVRVVDGVLRPGNKILLMSSKANYLCEEV 238

Query: 247 GILTPKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVVFC 306
           G+  PK +  ++L  GE+G +I+ IK++   +VGDT+T    P    L GFK I+P VF 
Sbjct: 239 GVFQPKAVSHKSLSAGEVGFIISGIKDLKSAKVGDTVTLADRPAGEPLAGFKEIKPQVFA 298

Query: 307 GLFPVDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERLER 366
           GL+PV++ Q++ LR A+ KL+LNDAS  FE E S ALGFGFRCGFLGLLHL+I+QERLER
Sbjct: 299 GLYPVESNQYDALRAALEKLQLNDASLHFEPETSQALGFGFRCGFLGLLHLDIVQERLER 358

Query: 367 EFSLNLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEYLGS 426
           E+ ++LI T+P+VVY++ + DG + ++ NP  +P+++ I E+REP I  TI+ P EY+G+
Sbjct: 359 EYDMDLITTAPTVVYQVVLRDGKITEIENPSRLPDLSSIEEIREPIITATILVPEEYVGT 418

Query: 427 ILKLCQERRGIQIDMSHLDNRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDYRD 486
           ++ LC  +RGIQ +M ++  + M+VYE+PLNEV+ DF+DRLKSVS+GYAS DY   ++R 
Sbjct: 419 VMTLCTGKRGIQKNMQYMGRQVMLVYEMPLNEVVMDFFDRLKSVSRGYASLDYEFKEFRA 478

Query: 487 SDLVKLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGGRII 546
           +DLVKL IL+N++ +DALS++VHR+ S+ RGR + +K++ LIP+QMF IA+QAAIG  I+
Sbjct: 479 ADLVKLDILINSDRVDALSLIVHRASSQHRGRELAQKMRELIPRQMFDIAVQAAIGAHIV 538

Query: 547 ARETVKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISILKTDNE 606
           ARE VKA RK+V AKCYGGDITRKRKLLEKQK GKKRM+R G V+IPQ+AF++IL+ D +
Sbjct: 539 ARENVKALRKNVLAKCYGGDITRKRKLLEKQKAGKKRMKRVGNVEIPQAAFLAILQVDGK 598


>gi|325133720|gb|EGC56376.1| GTP-binding protein LepA [Neisseria meningitidis M13399]
 gi|325206392|gb|ADZ01845.1| GTP-binding protein LepA [Neisseria meningitidis M04-240196]
          Length = 597

 Score =  748 bits (1930), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 343/599 (57%), Positives = 467/599 (77%), Gaps = 2/599 (0%)

Query: 8   LSRIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVR 67
           +  IRNFSI+AHIDHGKSTLADRFIQ+C GL  REMS+QVLD+MDIE+ERGITIKAQT  
Sbjct: 1   MKNIRNFSIIAHIDHGKSTLADRFIQYCGGLDLREMSTQVLDSMDIEKERGITIKAQTAA 60

Query: 68  LNYTSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQAI 127
           LNY + D + YQLNLIDTPGHVDF+YEVSRSLSACEG+LLVVDA+QGVEAQT+AN Y AI
Sbjct: 61  LNYKARDGQVYQLNLIDTPGHVDFSYEVSRSLSACEGALLVVDASQGVEAQTVANCYTAI 120

Query: 128 DNNHEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERIVQQL 187
           D   E++ VLNK DLP+ADP+RV+++IE+ IGI    A+  SAK+G G+  +LE IV ++
Sbjct: 121 DLGVEVVPVLNKIDLPAADPERVEQEIEDIIGIDAVGAVQCSAKSGIGVEDVLEEIVAKV 180

Query: 188 PSPTSPEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVERIG 247
           P+PT  E  NAPL+A+++DSW+++Y+GV++L+R+ NG +     +R M T A+ QVE++G
Sbjct: 181 PAPTGDE--NAPLQAVIVDSWFDNYVGVVMLIRVKNGTIKLKDKVRFMSTKAETQVEQLG 238

Query: 248 ILTPKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVVFCG 307
           + TPK +  + L  GE+G +I  +KE+   +VGDT+T  ++P +  LPGF+ +Q  VF G
Sbjct: 239 VFTPKSVQKQELKAGEVGFLITGVKELGQAKVGDTVTLVANPASEPLPGFQEVQSQVFAG 298

Query: 308 LFPVDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERLERE 367
           L+PV++  +E LR A+ KL+LNDAS  FE E S ALGFGFRCGFLGLLHLEI+QERLERE
Sbjct: 299 LYPVESHDYEALRDALEKLQLNDASLKFEPEVSQALGFGFRCGFLGLLHLEIVQERLERE 358

Query: 368 FSLNLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEYLGSI 427
           F ++LI T+P+VVYE+ +  G   ++ NP  +P++  I  + EP I  TI+ P EY+G++
Sbjct: 359 FDMDLITTAPTVVYEVVLKSGEKIEVENPSKLPDIGSIETILEPIITATILVPQEYVGNV 418

Query: 428 LKLCQERRGIQIDMSHLDNRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDYRDS 487
           + LC ++RG+Q++M ++  + M+ Y+LP+NEV+ DF+D+LKS S+GYAS DY+  +++ S
Sbjct: 419 MTLCNQKRGVQVNMQYMGRQVMLTYDLPMNEVVMDFFDKLKSTSRGYASLDYHFKEFQPS 478

Query: 488 DLVKLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGGRIIA 547
           DL+KL I+VN E +DALS++VHR  +  RGR +  K++ LIP+QMF IA+QAAIG +IIA
Sbjct: 479 DLIKLDIMVNGEKVDALSLIVHRQSAVHRGRELASKMRELIPRQMFDIAVQAAIGSQIIA 538

Query: 548 RETVKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISILKTDNE 606
           RE VKA RK+V AKCYGGDITRK+KLLEKQK GK+RM++ G V+IPQSAF++IL+  ++
Sbjct: 539 RENVKALRKNVLAKCYGGDITRKKKLLEKQKAGKRRMKQVGNVEIPQSAFLAILQVSDK 597


>gi|325127883|gb|EGC50788.1| GTP-binding protein LepA [Neisseria meningitidis N1568]
          Length = 597

 Score =  748 bits (1930), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 343/599 (57%), Positives = 467/599 (77%), Gaps = 2/599 (0%)

Query: 8   LSRIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVR 67
           +  IRNFSI+AHIDHGKSTLADRFIQ+C GL  REMS+QVLD+MDIE+ERGITIKAQT  
Sbjct: 1   MKNIRNFSIIAHIDHGKSTLADRFIQYCGGLDLREMSTQVLDSMDIEKERGITIKAQTAA 60

Query: 68  LNYTSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQAI 127
           LNY + D + YQLNLIDTPGHVDF+YEVSRSLSACEG+LLVVDA+QGVEAQT+AN Y AI
Sbjct: 61  LNYKARDGQVYQLNLIDTPGHVDFSYEVSRSLSACEGALLVVDASQGVEAQTVANCYTAI 120

Query: 128 DNNHEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERIVQQL 187
           D   E++ VLNK DLP+A+PDRV+++IE+ IGI    A+  SAK+G G+  +LE IV ++
Sbjct: 121 DLGVEVVPVLNKIDLPAAEPDRVEQEIEDIIGIDAVGAVQCSAKSGIGVEDVLEEIVAKI 180

Query: 188 PSPTSPEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVERIG 247
           P+PT  E  NAPL+A+++DSW+++Y+GV++L+R+ NG +     +R M T A+ QVE++G
Sbjct: 181 PAPTGDE--NAPLQAVIVDSWFDNYVGVVMLIRVKNGTIKLKDKVRFMSTKAETQVEQLG 238

Query: 248 ILTPKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVVFCG 307
           + TPK +  + L  GE+G +I  +KE+   +VGDT+T  ++P +  LPGF+ +Q  VF G
Sbjct: 239 VFTPKSVQKQELKAGEVGFLITGVKELGQAKVGDTVTLVANPASEPLPGFQEVQSQVFAG 298

Query: 308 LFPVDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERLERE 367
           L+PV++  +E LR A+ KL+LNDAS  FE E S ALGFGFRCGFLGLLHLEI+QERLERE
Sbjct: 299 LYPVESHDYEALRDALEKLQLNDASLKFEPEVSQALGFGFRCGFLGLLHLEIVQERLERE 358

Query: 368 FSLNLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEYLGSI 427
           F ++LI T+P+VVYE+ +  G   ++ NP  +P++  I  + EP I  TI+ P EY+G++
Sbjct: 359 FDMDLITTAPTVVYEVVLKSGEKIEVENPSKLPDIGSIETILEPIITATILVPQEYVGNV 418

Query: 428 LKLCQERRGIQIDMSHLDNRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDYRDS 487
           + LC ++RG+Q++M ++  + M+ Y+LP+NEV+ DF+D+LKS S+GYAS DY+  +++ S
Sbjct: 419 MTLCNQKRGVQVNMQYMGRQVMLTYDLPMNEVVMDFFDKLKSTSRGYASLDYHFKEFQPS 478

Query: 488 DLVKLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGGRIIA 547
           DL+KL I+VN E +DALS++VHR  +  RGR +  K++ LIP+QMF IA+QAAIG +IIA
Sbjct: 479 DLIKLDIMVNGEKVDALSLIVHRQSAVHRGRELASKMRELIPRQMFDIAVQAAIGSQIIA 538

Query: 548 RETVKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISILKTDNE 606
           RE VKA RK+V AKCYGGDITRK+KLLEKQK GK+RM++ G V+IPQSAF++IL+  ++
Sbjct: 539 RENVKALRKNVLAKCYGGDITRKKKLLEKQKAGKRRMKQVGNVEIPQSAFLAILQVSDK 597


>gi|319638526|ref|ZP_07993288.1| GTP-binding protein lepA [Neisseria mucosa C102]
 gi|317400275|gb|EFV80934.1| GTP-binding protein lepA [Neisseria mucosa C102]
 gi|325142028|gb|EGC64460.1| GTP-binding protein LepA [Neisseria meningitidis 961-5945]
 gi|325197986|gb|ADY93442.1| GTP-binding protein LepA [Neisseria meningitidis G2136]
          Length = 597

 Score =  748 bits (1930), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 343/599 (57%), Positives = 467/599 (77%), Gaps = 2/599 (0%)

Query: 8   LSRIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVR 67
           +  IRNFSI+AHIDHGKSTLADRFIQ+C GL  REMS+QVLD+MDIE+ERGITIKAQT  
Sbjct: 1   MKNIRNFSIIAHIDHGKSTLADRFIQYCGGLDLREMSTQVLDSMDIEKERGITIKAQTAA 60

Query: 68  LNYTSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQAI 127
           LNY + D + YQLNLIDTPGHVDF+YEVSRSLSACEG+LLVVDA+QGVEAQT+AN Y AI
Sbjct: 61  LNYKARDGQVYQLNLIDTPGHVDFSYEVSRSLSACEGALLVVDASQGVEAQTVANCYTAI 120

Query: 128 DNNHEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERIVQQL 187
           D   E++ VLNK DLP+ADP+RV+++IE+ IGI    A+  SAK+G G+  +LE IV ++
Sbjct: 121 DLGVEVVPVLNKIDLPAADPERVEQEIEDIIGIDAVGAVQCSAKSGIGVEDVLEEIVAKI 180

Query: 188 PSPTSPEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVERIG 247
           P+PT  E  NAPL+A+++DSW+++Y+GV++L+R+ NG +     +R M T A+ QVE++G
Sbjct: 181 PAPTGDE--NAPLQAVIVDSWFDNYVGVVMLIRVKNGTIKLKDKVRFMSTKAETQVEQLG 238

Query: 248 ILTPKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVVFCG 307
           + TPK +  + L  GE+G +I  +KE+   +VGDT+T  ++P +  LPGF+ +Q  VF G
Sbjct: 239 VFTPKSVQKQELKAGEVGFLITGVKELGQAKVGDTVTLVANPASEPLPGFQEVQSQVFAG 298

Query: 308 LFPVDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERLERE 367
           L+PV++  +E LR A+ KL+LNDAS  FE E S ALGFGFRCGFLGLLHLEI+QERLERE
Sbjct: 299 LYPVESHDYEALRDALEKLQLNDASLKFEPEVSQALGFGFRCGFLGLLHLEIVQERLERE 358

Query: 368 FSLNLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEYLGSI 427
           F ++LI T+P+VVYE+ +  G   ++ NP  +P++  I  + EP I  TI+ P EY+G++
Sbjct: 359 FDMDLITTAPTVVYEVVLKSGEKIEVENPSKLPDIGSIETILEPIITATILVPQEYVGNV 418

Query: 428 LKLCQERRGIQIDMSHLDNRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDYRDS 487
           + LC ++RG+Q++M ++  + M+ Y+LP+NEV+ DF+D+LKS S+GYAS DY+  +++ S
Sbjct: 419 MTLCNQKRGVQVNMQYMGRQVMLTYDLPMNEVVMDFFDKLKSTSRGYASLDYHFKEFQPS 478

Query: 488 DLVKLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGGRIIA 547
           DL+KL I+VN E +DALS++VHR  +  RGR +  K++ LIP+QMF IA+QAAIG +IIA
Sbjct: 479 DLIKLDIMVNGEKVDALSLIVHRQSAVHRGRELASKMRELIPRQMFDIAVQAAIGSQIIA 538

Query: 548 RETVKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISILKTDNE 606
           RE VKA RK+V AKCYGGDITRK+KLLEKQK GK+RM++ G V+IPQSAF++IL+  ++
Sbjct: 539 RENVKALRKNVLAKCYGGDITRKKKLLEKQKAGKRRMKQVGNVEIPQSAFLAILQVSDK 597


>gi|240123033|ref|ZP_04735989.1| GTP-binding protein LepA [Neisseria gonorrhoeae PID332]
 gi|268681661|ref|ZP_06148523.1| GTP-binding protein lepA [Neisseria gonorrhoeae PID332]
 gi|268621945|gb|EEZ54345.1| GTP-binding protein lepA [Neisseria gonorrhoeae PID332]
          Length = 597

 Score =  748 bits (1930), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 343/599 (57%), Positives = 467/599 (77%), Gaps = 2/599 (0%)

Query: 8   LSRIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVR 67
           +  IRNFSI+AHIDHGKSTLADRFIQ+C GL  REMS+QVLD+MDIE+ERGITIKAQT  
Sbjct: 1   MKNIRNFSIIAHIDHGKSTLADRFIQYCGGLNLREMSTQVLDSMDIEKERGITIKAQTAA 60

Query: 68  LNYTSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQAI 127
           LNY + D + YQLNLIDTPGHVDF+YEVSRSLSACEG+LLVVDA+QGVEAQT+AN Y AI
Sbjct: 61  LNYKARDGQVYQLNLIDTPGHVDFSYEVSRSLSACEGALLVVDASQGVEAQTVANCYTAI 120

Query: 128 DNNHEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERIVQQL 187
           D   E++ VLNK DLP+ADP+RV+++IE+ IGI    A+  SAK+G G+  +LE IV ++
Sbjct: 121 DLGVEVVPVLNKIDLPAADPERVEQEIEDIIGIDAVGAVQCSAKSGIGVEDVLEEIVAKI 180

Query: 188 PSPTSPEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVERIG 247
           P+PT  E  NAPL+A+++DSW+++Y+GV++L+R+ NG +     +R M T A+ QVE++G
Sbjct: 181 PAPTGDE--NAPLQAVIVDSWFDNYVGVVMLIRVKNGTIKLKDKVRFMSTKAETQVEQLG 238

Query: 248 ILTPKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVVFCG 307
           + TPK +  + L  GE+G +I  +KE+   +VGDT+T  ++P T  LPGF+ +Q  VF G
Sbjct: 239 VFTPKSVQKQELKAGEVGFLITGVKELGQAKVGDTVTLVANPATEPLPGFQEVQSQVFAG 298

Query: 308 LFPVDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERLERE 367
           L+PV++  +E LR A+ KL+LNDAS  FE E S ALGFGFRCGFLGLLHLEI+QERLERE
Sbjct: 299 LYPVESHDYEALRDALEKLQLNDASLKFEPEVSQALGFGFRCGFLGLLHLEIVQERLERE 358

Query: 368 FSLNLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEYLGSI 427
           F ++LI T+P+VVYE+ +  G   ++ NP  +P++  I  + EP I  TI+ P EY+G++
Sbjct: 359 FDMDLITTAPTVVYEVVLKSGEKIEVENPSKLPDIGSIETILEPIITATILVPQEYVGNV 418

Query: 428 LKLCQERRGIQIDMSHLDNRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDYRDS 487
           + LC ++RG+Q++M ++  + M+ Y+LP+NEV+ DF+D+LKS S+GYAS DY+  +++ S
Sbjct: 419 MTLCNQKRGMQVNMQYMGRQVMLTYDLPMNEVVMDFFDKLKSTSRGYASLDYHFKEFQPS 478

Query: 488 DLVKLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGGRIIA 547
           DL+KL I+VN E +DALS++VHR  +  +GR +  K++ LIP+QMF IA+QAAIG +IIA
Sbjct: 479 DLIKLDIMVNGEKVDALSLIVHRQSAVHKGRELASKMRELIPRQMFDIAVQAAIGSQIIA 538

Query: 548 RETVKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISILKTDNE 606
           RE VKA RK+V AKCYGGDITRK+KLLEKQK GK+RM++ G V+IPQSAF++IL+  ++
Sbjct: 539 RENVKALRKNVLAKCYGGDITRKKKLLEKQKAGKRRMKQVGNVEIPQSAFLAILQVSDK 597


>gi|253999492|ref|YP_003051555.1| GTP-binding protein LepA [Methylovorus sp. SIP3-4]
 gi|253986171|gb|ACT51028.1| GTP-binding protein LepA [Methylovorus sp. SIP3-4]
          Length = 597

 Score =  748 bits (1930), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 359/600 (59%), Positives = 472/600 (78%), Gaps = 4/600 (0%)

Query: 8   LSRIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVR 67
           +  IRNFSI+AHIDHGKSTLADR IQ C GL++REM +QVLD+MD+ERERGITIKAQT  
Sbjct: 1   MKNIRNFSIIAHIDHGKSTLADRIIQLCGGLSDREMEAQVLDSMDLERERGITIKAQTAA 60

Query: 68  LNYTSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQAI 127
           L Y + D + YQLNLIDTPGHVDF+YEVSRSLSACEG+LLVVDA+QGVEAQ++AN Y AI
Sbjct: 61  LQYKALDGQIYQLNLIDTPGHVDFSYEVSRSLSACEGALLVVDASQGVEAQSVANCYTAI 120

Query: 128 DNNHEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERIVQQL 187
           D   E+  VLNK DLPSADP+RV ++IE+ IG+   DA+  SAKTGEG+  +LE +V ++
Sbjct: 121 DLGVEVTAVLNKIDLPSADPERVIQEIEDVIGVEATDAVRCSAKTGEGVRDVLEAVVARI 180

Query: 188 PSPTSPEG-ANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVERI 246
           P P   EG    PLKAL+IDSW+++Y+GV++LVR+I+G L     IR+M T A +  E++
Sbjct: 181 PPP---EGDPTKPLKALIIDSWFDNYVGVVMLVRVIDGTLKPKDKIRMMATRAVHLCEQV 237

Query: 247 GILTPKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVVFC 306
           G+ TPK    E+L  GE+G +IA IKE++  +VGDT+T    P   ALPGFK ++P VF 
Sbjct: 238 GVFTPKSRQKESLSAGEVGFIIAGIKELTSAKVGDTVTLADKPAAEALPGFKEVKPQVFA 297

Query: 307 GLFPVDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERLER 366
           GL+PV++ QFE LR A+ KLRLNDAS  FE ENSTALGFGFRCGFLGLLH+EI+QERLER
Sbjct: 298 GLYPVESNQFEALRDALEKLRLNDASLQFEPENSTALGFGFRCGFLGLLHMEIVQERLER 357

Query: 367 EFSLNLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEYLGS 426
           E+ ++LI T+P+VVYEL + +G + ++ NP  +PE ++I E+REP I V ++ P +Y+G 
Sbjct: 358 EYDMDLITTAPTVVYELLLKNGEVVQIENPSRLPEPSRIDEIREPVINVNLLMPQDYVGP 417

Query: 427 ILKLCQERRGIQIDMSHLDNRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDYRD 486
           ++ LC  +RG+Q +M ++  + M+ YE+PLNEV+ DF+D+LKSVS+GYAS DY  +++R 
Sbjct: 418 VMTLCNGKRGVQRNMQYMGRQVMLSYEMPLNEVVLDFFDKLKSVSRGYASMDYEFLEFRA 477

Query: 487 SDLVKLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGGRII 546
           +DLVKL I+VN + +DALS++VHR+ S  RGR +C K++ LIP+QMF +A+QAAIG  II
Sbjct: 478 ADLVKLDIMVNGDRVDALSLIVHRANSIYRGRQLCAKMRELIPRQMFDVAVQAAIGANII 537

Query: 547 ARETVKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISILKTDNE 606
           ARETVKA RK+V AKCYGGDITRK+KLLEKQKEGKKRM++ G V+IPQ AF++ILK +++
Sbjct: 538 ARETVKAMRKNVLAKCYGGDITRKKKLLEKQKEGKKRMKQVGNVEIPQEAFLAILKVEDK 597


>gi|294787784|ref|ZP_06753028.1| GTP-binding protein LepA [Simonsiella muelleri ATCC 29453]
 gi|294484077|gb|EFG31760.1| GTP-binding protein LepA [Simonsiella muelleri ATCC 29453]
          Length = 597

 Score =  748 bits (1930), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 351/596 (58%), Positives = 463/596 (77%), Gaps = 4/596 (0%)

Query: 8   LSRIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVR 67
           +  IRNFSI+AHIDHGKSTLADRFIQHC GL  REMS+QVLD+MDIE+ERGITIKAQT  
Sbjct: 1   MKNIRNFSIIAHIDHGKSTLADRFIQHCGGLDLREMSTQVLDSMDIEKERGITIKAQTAA 60

Query: 68  LNYTSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQAI 127
           LNY + + + YQLNLIDTPGHVDF+YEVSRSLSACEG+LLVVDA+QGVEAQT+AN Y AI
Sbjct: 61  LNYKARNGEIYQLNLIDTPGHVDFSYEVSRSLSACEGALLVVDASQGVEAQTVANCYTAI 120

Query: 128 DNNHEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERIVQQL 187
           D   E++ VLNK DLP+ADPDRV ++IE+ IGI    A+  SAK+G G+  +LE IV ++
Sbjct: 121 DLGVEVVPVLNKIDLPAADPDRVAQEIEDIIGIDAVGAVTCSAKSGLGVEDVLEEIVAKI 180

Query: 188 PSPTSPEG-ANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVERI 246
           P+P   EG   APL+A++IDSW+++Y+GV++L+R+ NG +     +R M T A+ QVE++
Sbjct: 181 PAP---EGDPTAPLQAVIIDSWFDNYVGVVMLIRVKNGTIKLKDKVRFMSTKAETQVEQL 237

Query: 247 GILTPKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVVFC 306
           GI TPK I  + L  GE+G +I  +KE+   +VGDT+T  ++P    L GFK +Q  VF 
Sbjct: 238 GIFTPKSIQKQQLSAGEVGFLITGVKELGSAKVGDTVTLAANPAAEPLAGFKEVQSQVFA 297

Query: 307 GLFPVDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERLER 366
           GL+PV++  +ENLR A+ KL+LNDAS  FE E S ALGFGFRCGFLGLLHLEI+QERLER
Sbjct: 298 GLYPVESHDYENLRDALEKLQLNDASLKFEPEVSQALGFGFRCGFLGLLHLEIVQERLER 357

Query: 367 EFSLNLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEYLGS 426
           EF ++LI T+P+VVYE+ M +G   ++ NP  +P++  I  + EP I  TI+ P +Y+G+
Sbjct: 358 EFDMDLITTAPTVVYEVIMKNGDKIEVENPSKLPDIATIDTILEPIITATILVPQDYVGN 417

Query: 427 ILKLCQERRGIQIDMSHLDNRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDYRD 486
           ++ LC ++RG+Q +M +L  + M+ Y+LP+NEV+ DF+D+LKS S+GYAS DY   +++ 
Sbjct: 418 VMTLCNQKRGVQRNMQYLGRQVMLTYDLPMNEVVMDFFDKLKSTSRGYASLDYEFKEFQP 477

Query: 487 SDLVKLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGGRII 546
           SDLVKL I+VN + +DALS++VHR  S +RGR +  K++ LIP+QMF IA+QAAIGG+II
Sbjct: 478 SDLVKLDIMVNGDKVDALSLIVHRQTSVQRGRELASKMRELIPRQMFDIAVQAAIGGQII 537

Query: 547 ARETVKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISILK 602
           ARE VKA RK+V AKCYGGDITRK+KLLEKQK GKKRM++ G V+IPQSAF++IL+
Sbjct: 538 ARENVKALRKNVLAKCYGGDITRKKKLLEKQKAGKKRMKQVGNVEIPQSAFLAILE 593


>gi|254797114|ref|YP_003081952.1| GTP-binding protein LepA [Neorickettsia risticii str. Illinois]
 gi|254590347|gb|ACT69709.1| GTP-binding protein LepA [Neorickettsia risticii str. Illinois]
          Length = 596

 Score =  747 bits (1929), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 355/596 (59%), Positives = 467/596 (78%), Gaps = 2/596 (0%)

Query: 8   LSRIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVR 67
           +  IRNF+I+AHIDHGKSTLADR ++ C+ +  R+M  Q+LD+M IERERGITIK+QTV 
Sbjct: 1   MKNIRNFAIIAHIDHGKSTLADRLMEECKAVDPRKMKEQLLDSMKIERERGITIKSQTVM 60

Query: 68  LNYTSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQAI 127
           L YT+ DA+DY LNLIDTPGHVDF+YEVSRSL+ACEGSLL+VDATQG+EAQTLANVY+AI
Sbjct: 61  LKYTAKDAEDYVLNLIDTPGHVDFSYEVSRSLAACEGSLLIVDATQGLEAQTLANVYKAI 120

Query: 128 DNNHEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERIVQQL 187
           DN+H II V+NK DL SA+P+RV+ QI + IGISTE+A+ VSAK+G GI  LLE IV+ +
Sbjct: 121 DNDHAIIPVINKIDLDSAEPERVRAQIRDVIGISTENAVEVSAKSGIGIADLLESIVKYI 180

Query: 188 PSPTSPEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVERIG 247
           P P      +  L+ALLIDSWY+ YLGV++LVR+ NG +  G +I +M    KY VE++G
Sbjct: 181 PPPEG--NVSERLQALLIDSWYDIYLGVVILVRVKNGSIKSGMTIEMMSNGNKYSVEKVG 238

Query: 248 ILTPKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVVFCG 307
           I TP+  ++  L  GEIG + ASIK      +GDTITD  +P T  LPGFK ++PVVFC 
Sbjct: 239 IFTPEKRNVAELSAGEIGFLTASIKNARDCNIGDTITDAKNPCTEHLPGFKQLRPVVFCS 298

Query: 308 LFPVDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERLERE 367
           LFPV + +F  LR ++ KL LND+SF+FE E+S+ALG GFRCGFLG+LHLE+I +RL+ E
Sbjct: 299 LFPVSSDEFAKLRQSLEKLHLNDSSFTFESESSSALGHGFRCGFLGMLHLEVITQRLDEE 358

Query: 368 FSLNLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEYLGSI 427
           F L L+ T+PSVVY ++M D S+ +L NP +MP+ +KI  + EPWI+ +++ P +Y+G +
Sbjct: 359 FDLALVLTAPSVVYRIHMKDSSVLELYNPTEMPDPSKIDHIEEPWIKASVMLPGDYIGEV 418

Query: 428 LKLCQERRGIQIDMSHLDNRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDYRDS 487
           + LC E+RG QID++++DN+A++ Y LPL+E++FDFYDRLKSVSKGYAS D+ +  YR S
Sbjct: 419 INLCNEKRGEQIDLAYVDNKAILTYSLPLSEIVFDFYDRLKSVSKGYASLDWEIHGYRSS 478

Query: 488 DLVKLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGGRIIA 547
           +LVKL+I +N E +DALS++++R  +E+RGR ICE+LK LIP+Q ++IAIQAAIGG++IA
Sbjct: 479 ELVKLSIFINGEEVDALSVMIYRPNAERRGREICERLKELIPRQQYKIAIQAAIGGKVIA 538

Query: 548 RETVKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISILKT 603
           RETV   RKDVTAK YGGD TR+ KLLEKQK+GKKRM   G+ +IPQ+AFI  LK 
Sbjct: 539 RETVNPYRKDVTAKLYGGDRTRRMKLLEKQKKGKKRMHSIGKANIPQNAFIEALKV 594


>gi|240112453|ref|ZP_04726943.1| GTP-binding protein LepA [Neisseria gonorrhoeae MS11]
 gi|268598522|ref|ZP_06132689.1| GTP-binding protein lepA [Neisseria gonorrhoeae MS11]
 gi|293399507|ref|ZP_06643660.1| GTP-binding protein LepA [Neisseria gonorrhoeae F62]
 gi|268582653|gb|EEZ47329.1| GTP-binding protein lepA [Neisseria gonorrhoeae MS11]
 gi|291610076|gb|EFF39198.1| GTP-binding protein LepA [Neisseria gonorrhoeae F62]
          Length = 597

 Score =  747 bits (1929), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 343/599 (57%), Positives = 467/599 (77%), Gaps = 2/599 (0%)

Query: 8   LSRIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVR 67
           +  IRNFSI+AHIDHGKSTLADRFIQ+C GL  REMS+QVLD+MDIE+ERGITIKAQT  
Sbjct: 1   MKNIRNFSIIAHIDHGKSTLADRFIQYCGGLDLREMSTQVLDSMDIEKERGITIKAQTAA 60

Query: 68  LNYTSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQAI 127
           LNY + D + YQLNLIDTPGHVDF+YEVSRSLSACEG+LLVVDA+QGVEAQT+AN Y AI
Sbjct: 61  LNYKARDGQVYQLNLIDTPGHVDFSYEVSRSLSACEGALLVVDASQGVEAQTVANCYTAI 120

Query: 128 DNNHEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERIVQQL 187
           D   E++ VLNK DLP+ADP+RV+++IE+ IGI    A+  SAK+G G+  +LE IV ++
Sbjct: 121 DLGVEVVPVLNKIDLPAADPERVEQEIEDIIGIDAVGAVQCSAKSGIGVEDVLEEIVAKI 180

Query: 188 PSPTSPEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVERIG 247
           P+PT  E  NAPL+A+++DSW+++Y+GV++L+R+ NG +     +R M T A+ QVE++G
Sbjct: 181 PAPTGDE--NAPLQAVIVDSWFDNYVGVVMLIRVKNGTIKLKDKVRFMSTKAETQVEQLG 238

Query: 248 ILTPKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVVFCG 307
           + TPK +  + L  GE+G +I  +KE+   +VGDT+T  ++P T  LPGF+ +Q  VF G
Sbjct: 239 VFTPKSVQKQELKAGEVGFLITGVKELGQAKVGDTVTLVANPATEPLPGFQEVQSQVFAG 298

Query: 308 LFPVDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERLERE 367
           L+PV++  +E LR A+ KL+LNDAS  FE E S ALGFGFRCGFLGLLHLEI+QERLERE
Sbjct: 299 LYPVESHDYEALRDALEKLQLNDASLKFEPEVSQALGFGFRCGFLGLLHLEIVQERLERE 358

Query: 368 FSLNLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEYLGSI 427
           F ++LI T+P+VVYE+ +  G   ++ NP  +P++  I  + EP I  TI+ P EY+G++
Sbjct: 359 FDMDLITTAPTVVYEVVLKSGEKIEVENPSKLPDIGSIETILEPIITATILVPQEYVGNV 418

Query: 428 LKLCQERRGIQIDMSHLDNRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDYRDS 487
           + LC ++RG+Q++M ++  + M+ Y+LP+NEV+ DF+D+LKS S+GYAS DY+  +++ S
Sbjct: 419 MTLCNQKRGVQVNMQYMGRQVMLTYDLPMNEVVMDFFDKLKSTSRGYASLDYHFKEFQPS 478

Query: 488 DLVKLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGGRIIA 547
           DL+KL I+VN E +DALS++VHR  +  +GR +  K++ LIP+QMF IA+QAAIG +IIA
Sbjct: 479 DLIKLDIMVNGEKVDALSLIVHRQSAVHKGRELASKMRELIPRQMFDIAVQAAIGSQIIA 538

Query: 548 RETVKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISILKTDNE 606
           RE VKA RK+V AKCYGGDITRK+KLLEKQK GK+RM++ G V+IPQSAF++IL+  ++
Sbjct: 539 RENVKALRKNVLAKCYGGDITRKKKLLEKQKAGKRRMKQVGNVEIPQSAFLAILQVSDK 597


>gi|313668754|ref|YP_004049038.1| GTP-binding protein [Neisseria lactamica ST-640]
 gi|313006216|emb|CBN87678.1| putative GTP-binding protein [Neisseria lactamica 020-06]
          Length = 597

 Score =  747 bits (1929), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 344/599 (57%), Positives = 467/599 (77%), Gaps = 2/599 (0%)

Query: 8   LSRIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVR 67
           +  IRNFSI+AHIDHGKSTLADRFIQ+C GL  REMS+QVLD+MDIE+ERGITIKAQT  
Sbjct: 1   MKNIRNFSIIAHIDHGKSTLADRFIQYCGGLDLREMSTQVLDSMDIEKERGITIKAQTAA 60

Query: 68  LNYTSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQAI 127
           LNY + D + YQLNLIDTPGHVDF+YEVSRSLSACEG+LLVVDA+QGVEAQT+AN Y AI
Sbjct: 61  LNYKARDGQVYQLNLIDTPGHVDFSYEVSRSLSACEGALLVVDASQGVEAQTVANCYTAI 120

Query: 128 DNNHEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERIVQQL 187
           D   E++ VLNK DLP+ADP+RV+++IE+ IGI    A+  SAK+G G+  +LE IV ++
Sbjct: 121 DLGVEVVPVLNKIDLPAADPERVEQEIEDIIGIDAVGAVQCSAKSGIGVEDVLEEIVAKI 180

Query: 188 PSPTSPEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVERIG 247
           P+PT  E  NAPL+A+++DSW+++Y+GV++L+R+ NG +     +R M T A+ QVE++G
Sbjct: 181 PAPTGDE--NAPLQAVIVDSWFDNYVGVVMLIRVKNGIIKLKDKVRFMSTKAETQVEQLG 238

Query: 248 ILTPKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVVFCG 307
           + TPK +  + L  GE+G +I  +KE+   +VGDT+T  ++P T  LPGF+ +Q  VF G
Sbjct: 239 VFTPKSVQKQELKAGEVGFLITGVKELGQAKVGDTVTLVANPATEPLPGFQEVQSQVFAG 298

Query: 308 LFPVDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERLERE 367
           L+PV++  +E LR A+ KL+LNDAS  FE E S ALGFGFRCGFLGLLHLEI+QERLERE
Sbjct: 299 LYPVESHDYEALRDALEKLQLNDASLKFEPEVSQALGFGFRCGFLGLLHLEIVQERLERE 358

Query: 368 FSLNLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEYLGSI 427
           F ++LI T+P+VVYE+ + +G   ++ NP  +P++  I  + EP I  TI+ P EY+G++
Sbjct: 359 FDMDLITTAPTVVYEVVLKNGEKIEVENPSKLPDIGSIETILEPIITATILVPQEYVGNV 418

Query: 428 LKLCQERRGIQIDMSHLDNRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDYRDS 487
           + LC ++RG+Q +M ++  + M+ Y+LP+NEV+ DF+D+LKS S+GYAS DY+  +++ S
Sbjct: 419 MTLCNQKRGVQANMQYMGRQVMLTYDLPMNEVVMDFFDKLKSTSRGYASLDYHFKEFQPS 478

Query: 488 DLVKLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGGRIIA 547
           DL+KL I+VN E +DALS++VHR  +  RGR +  K++ LIP+QMF IA+QAAIG +IIA
Sbjct: 479 DLIKLDIMVNGEKVDALSLIVHRQSAVHRGRELASKMRELIPRQMFDIAVQAAIGSQIIA 538

Query: 548 RETVKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISILKTDNE 606
           RE VKA RK+V AKCYGGDITRK+KLLEKQK GK+RM++ G V+IPQSAF++IL+  ++
Sbjct: 539 RENVKALRKNVLAKCYGGDITRKKKLLEKQKAGKRRMKQVGNVEIPQSAFLAILQVSDK 597


>gi|152981046|ref|YP_001353057.1| GTP-binding protein LepA [Janthinobacterium sp. Marseille]
 gi|166223203|sp|A6SXR0|LEPA_JANMA RecName: Full=Elongation factor 4; Short=EF-4; AltName:
           Full=Ribosomal back-translocase LepA
 gi|151281123|gb|ABR89533.1| GTP-binding protein LepA [Janthinobacterium sp. Marseille]
          Length = 597

 Score =  747 bits (1929), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 345/599 (57%), Positives = 463/599 (77%), Gaps = 2/599 (0%)

Query: 8   LSRIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVR 67
           ++ IRNFSI+AHIDHGKSTLADR IQ C GL++REM +QVLD+MDIERERGITIKAQT  
Sbjct: 1   MNNIRNFSIIAHIDHGKSTLADRIIQLCGGLSDREMEAQVLDSMDIERERGITIKAQTAA 60

Query: 68  LNYTSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQAI 127
           L Y + D + Y LNLIDTPGHVDF+YEVSRSLSACEG+LLVVDA+QGVEAQT+AN Y A+
Sbjct: 61  LMYKARDGQVYNLNLIDTPGHVDFSYEVSRSLSACEGALLVVDASQGVEAQTVANCYTAL 120

Query: 128 DNNHEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERIVQQL 187
           D   E++ VLNK DLPSADP     +IEE IGI   +A+  SAKTG G+  +LE ++ ++
Sbjct: 121 DLGVEVVPVLNKIDLPSADPANAIAEIEEVIGIDASEAVHCSAKTGLGVQDVLESLITKV 180

Query: 188 PSPTSPEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVERIG 247
           P P     A APL+AL++DSW+++Y+GV++LVR++NG L     I LM + +++ VE +G
Sbjct: 181 PPPKG--DATAPLQALIVDSWFDNYVGVVMLVRVMNGTLRPKDKILLMASESQHLVESVG 238

Query: 248 ILTPKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVVFCG 307
           + TPK I  + L  G++G +IA IKE+   +VGDT+T  S P    LPGFK +QP VF G
Sbjct: 239 VFTPKSISRDTLTAGQVGFIIAGIKELKAAKVGDTVTLASRPAAEPLPGFKEVQPQVFAG 298

Query: 308 LFPVDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERLERE 367
           LFPV+A Q++ LR ++ KL+LNDA+  +E E S ALGFGFRCGFLGLLH+EI+QERLERE
Sbjct: 299 LFPVEANQYDALRDSLEKLKLNDAALMYEPEVSQALGFGFRCGFLGLLHMEIVQERLERE 358

Query: 368 FSLNLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEYLGSI 427
           F ++LI T+P+V+YE+ + DGS+  + NP  MP+ +KI E+REP + V +  P EY+GS+
Sbjct: 359 FDMDLITTAPTVIYEVVLRDGSILMVDNPSKMPDPSKIEEIREPIVTVNLYMPQEYVGSV 418

Query: 428 LKLCQERRGIQIDMSHLDNRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDYRDS 487
           + LC ++RGIQ+DMS+   +  ++YE+P+ E++ DF+D+LKS S+GYAS DY   +YR S
Sbjct: 419 ITLCTQKRGIQMDMSYHGKQVKLIYEMPMAEIVLDFFDKLKSTSRGYASMDYEFKEYRSS 478

Query: 488 DLVKLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGGRIIA 547
           D+VK+ +L+N+E +DAL+I+VHR+ S+ RGR +  K++ LIP+QMF +AIQAAIG  II+
Sbjct: 479 DVVKVDMLINSEKVDALAIIVHRANSQYRGRAVAAKMRELIPRQMFDVAIQAAIGANIIS 538

Query: 548 RETVKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISILKTDNE 606
           RE VKA RK+V AKCYGGDI+RKRKLLEKQK GKKRM++ G V+IPQ AF++IL+ D++
Sbjct: 539 RENVKALRKNVLAKCYGGDISRKRKLLEKQKAGKKRMKQVGSVEIPQEAFLAILQVDDK 597


>gi|255067056|ref|ZP_05318911.1| GTP-binding protein LepA [Neisseria sicca ATCC 29256]
 gi|255048652|gb|EET44116.1| GTP-binding protein LepA [Neisseria sicca ATCC 29256]
          Length = 630

 Score =  747 bits (1929), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 343/599 (57%), Positives = 467/599 (77%), Gaps = 2/599 (0%)

Query: 8   LSRIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVR 67
           +  IRNFSI+AHIDHGKSTLADRFIQ+C GL  REMS+QVLD+MDIE+ERGITIKAQT  
Sbjct: 34  MKNIRNFSIIAHIDHGKSTLADRFIQYCGGLDLREMSTQVLDSMDIEKERGITIKAQTAA 93

Query: 68  LNYTSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQAI 127
           LNY + D + YQLNLIDTPGHVDF+YEVSRSLSACEG+LLVVDA+QGVEAQT+AN Y AI
Sbjct: 94  LNYKARDGQVYQLNLIDTPGHVDFSYEVSRSLSACEGALLVVDASQGVEAQTVANCYTAI 153

Query: 128 DNNHEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERIVQQL 187
           D   E++ VLNK DLP+ADP+RV+++IE+ IGI    A+  SAK+G G+  +LE IV ++
Sbjct: 154 DLGVEVVPVLNKIDLPAADPERVEQEIEDIIGIDAVGAVQCSAKSGIGVEDVLEEIVAKI 213

Query: 188 PSPTSPEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVERIG 247
           P+PT  E  NAPL+A+++DSW+++Y+GV++L+R+ NG +     +R M T A+ QVE++G
Sbjct: 214 PAPTGDE--NAPLQAVIVDSWFDNYVGVVMLIRVKNGTIKLKDKVRFMSTKAETQVEQLG 271

Query: 248 ILTPKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVVFCG 307
           + TPK +  + L  GE+G +I  +KE+   +VGDT+T  ++P +  LPGF+ +Q  VF G
Sbjct: 272 VFTPKSVQKQELKAGEVGFLITGVKELGQAKVGDTVTLVANPASEPLPGFQEVQSQVFAG 331

Query: 308 LFPVDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERLERE 367
           L+PV++  +E LR A+ KL+LNDAS  FE E S ALGFGFRCGFLGLLHLEI+QERLERE
Sbjct: 332 LYPVESHDYEALRDALEKLQLNDASLKFEPEVSQALGFGFRCGFLGLLHLEIVQERLERE 391

Query: 368 FSLNLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEYLGSI 427
           F ++LI T+P+VVYE+ +  G   ++ NP  +P++  I  + EP I  TI+ P EY+G++
Sbjct: 392 FDMDLITTAPTVVYEVVLKSGEKIEVENPSKLPDIGSIETILEPIITATILVPQEYVGNV 451

Query: 428 LKLCQERRGIQIDMSHLDNRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDYRDS 487
           + LC ++RG+Q++M ++  + M+ Y+LP+NEV+ DF+D+LKS S+GYAS DY+  +++ S
Sbjct: 452 MTLCNQKRGVQVNMQYMGRQVMLTYDLPMNEVVMDFFDKLKSTSRGYASLDYHFKEFQPS 511

Query: 488 DLVKLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGGRIIA 547
           DL+KL I+VN E +DALS++VHR  +  RGR +  K++ LIP+QMF IA+QAAIG +IIA
Sbjct: 512 DLIKLDIMVNGEKVDALSLIVHRQSAVHRGRELAAKMRELIPRQMFDIAVQAAIGSQIIA 571

Query: 548 RETVKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISILKTDNE 606
           RE VKA RK+V AKCYGGDITRK+KLLEKQK GK+RM++ G V+IPQSAF++IL+  ++
Sbjct: 572 RENVKALRKNVLAKCYGGDITRKKKLLEKQKAGKRRMKQVGNVEIPQSAFLAILQVSDK 630


>gi|240080240|ref|ZP_04724783.1| GTP-binding protein LepA [Neisseria gonorrhoeae FA19]
 gi|268596391|ref|ZP_06130558.1| GTP-binding protein lepA [Neisseria gonorrhoeae FA19]
 gi|268550179|gb|EEZ45198.1| GTP-binding protein lepA [Neisseria gonorrhoeae FA19]
          Length = 597

 Score =  747 bits (1929), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 343/599 (57%), Positives = 467/599 (77%), Gaps = 2/599 (0%)

Query: 8   LSRIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVR 67
           +  IRNFSI+AHIDHGKSTLADRFIQ+C GL  REMS+QVLD+MDIE+ERGITIKAQT  
Sbjct: 1   MKNIRNFSIIAHIDHGKSTLADRFIQYCGGLDLREMSTQVLDSMDIEKERGITIKAQTAA 60

Query: 68  LNYTSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQAI 127
           LNY + D + YQLNLIDTPGHVDF+YEVSRSLSACEG+LLVVDA+QGVEAQT+AN Y AI
Sbjct: 61  LNYKARDGQVYQLNLIDTPGHVDFSYEVSRSLSACEGALLVVDASQGVEAQTVANCYTAI 120

Query: 128 DNNHEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERIVQQL 187
           D   E++ VLNK DLP+ADP+RV+++IE+ IGI    A+  SAK+G G+  +LE IV ++
Sbjct: 121 DLGVEVVPVLNKIDLPAADPERVEQEIEDIIGIDAVGAVQCSAKSGIGVEDVLEEIVAKI 180

Query: 188 PSPTSPEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVERIG 247
           P+PT  E  NAPL+A+++DSW+++Y+GV++L+R+ NG +     +R M T A+ QVE++G
Sbjct: 181 PAPTGDE--NAPLQAVIVDSWFDNYVGVVMLIRVKNGTIKLKDKVRFMSTKAETQVEQLG 238

Query: 248 ILTPKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVVFCG 307
           + TPK +  + L  GE+G +I  +KE+   +VGDT+T  ++P T  LPGF+ +Q  VF G
Sbjct: 239 VFTPKSVQKQELKAGEVGFLITGVKELGQAKVGDTVTLVANPATEPLPGFQEVQSQVFAG 298

Query: 308 LFPVDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERLERE 367
           L+PV++  +E LR A+ KL+LNDAS  FE E S ALGFGFRCGFLGLLHLEI+QERLERE
Sbjct: 299 LYPVESHDYEALRDALEKLQLNDASLKFEPEVSQALGFGFRCGFLGLLHLEIVQERLERE 358

Query: 368 FSLNLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEYLGSI 427
           F ++LI T+P+VVYE+ +  G   ++ NP  +P++  I  + EP I  TI+ P EY+G++
Sbjct: 359 FDMDLITTAPTVVYEVVLKSGEKIEVENPSKLPDIGSIETILEPIITATILVPQEYVGNV 418

Query: 428 LKLCQERRGIQIDMSHLDNRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDYRDS 487
           + LC ++RG+Q++M ++  + M+ Y+LP+NEV+ DF+D+LKS S+GYAS DY+  +++ S
Sbjct: 419 MTLCNQKRGMQVNMQYMGRQVMLTYDLPMNEVVMDFFDKLKSTSRGYASLDYHFKEFQPS 478

Query: 488 DLVKLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGGRIIA 547
           DL+KL I+VN E +DALS++VHR  +  +GR +  K++ LIP+QMF IA+QAAIG +IIA
Sbjct: 479 DLIKLDIMVNGEKVDALSLIVHRQSAVHKGRELASKMRELIPRQMFDIAVQAAIGSQIIA 538

Query: 548 RETVKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISILKTDNE 606
           RE VKA RK+V AKCYGGDITRK+KLLEKQK GK+RM++ G V+IPQSAF++IL+  ++
Sbjct: 539 RENVKALRKNVLAKCYGGDITRKKKLLEKQKAGKRRMKQVGNVEIPQSAFLAILQVSDK 597


>gi|261378791|ref|ZP_05983364.1| GTP-binding protein LepA [Neisseria cinerea ATCC 14685]
 gi|269144769|gb|EEZ71187.1| GTP-binding protein LepA [Neisseria cinerea ATCC 14685]
          Length = 597

 Score =  747 bits (1929), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 343/599 (57%), Positives = 467/599 (77%), Gaps = 2/599 (0%)

Query: 8   LSRIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVR 67
           +  IRNFSI+AHIDHGKSTLADRFIQ+C GL  REMS+QVLD+MDIE+ERGITIKAQT  
Sbjct: 1   MKNIRNFSIIAHIDHGKSTLADRFIQYCGGLDLREMSTQVLDSMDIEKERGITIKAQTAA 60

Query: 68  LNYTSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQAI 127
           LNY + D + YQLNLIDTPGHVDF+YEVSRSLSACEG+LLVVDA+QGVEAQT+AN Y AI
Sbjct: 61  LNYKARDGQVYQLNLIDTPGHVDFSYEVSRSLSACEGALLVVDASQGVEAQTVANCYTAI 120

Query: 128 DNNHEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERIVQQL 187
           D   E++ VLNK DLP+A+P+RV+++IE+ IGI    A+  SAK+G G+  +LE IV ++
Sbjct: 121 DLGVEVVPVLNKIDLPAAEPERVEQEIEDIIGIDAVGAVQCSAKSGIGVEDVLEEIVAKI 180

Query: 188 PSPTSPEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVERIG 247
           P+PT  E  NAPL+A+++DSW+++Y+GV++L+R+ NG +     +R M T A+ QVE++G
Sbjct: 181 PAPTGDE--NAPLQAVIVDSWFDNYVGVVMLIRVKNGTIKLKDKVRFMSTKAETQVEQLG 238

Query: 248 ILTPKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVVFCG 307
           + TPK +  + L  GE+G +I  +KE+   +VGDT+T  ++P +  LPGF+ +Q  VF G
Sbjct: 239 VFTPKSVQKQELKAGEVGFLITGVKELGQAKVGDTVTLVANPASEPLPGFQEVQSQVFAG 298

Query: 308 LFPVDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERLERE 367
           L+PV++  +E LR A+ KL+LNDAS  FE E S ALGFGFRCGFLGLLHLEI+QERLERE
Sbjct: 299 LYPVESHDYEALRDALEKLQLNDASLKFEPEVSQALGFGFRCGFLGLLHLEIVQERLERE 358

Query: 368 FSLNLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEYLGSI 427
           F ++LI T+P+VVYE+ +  G   ++ NP  +P++  I  + EP I  TI+ P EY+G++
Sbjct: 359 FDMDLITTAPTVVYEVVLKSGEKIEVENPSKLPDIGSIETILEPIITATILVPQEYVGNV 418

Query: 428 LKLCQERRGIQIDMSHLDNRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDYRDS 487
           + LC ++RG+Q++M ++  + M+ Y+LP+NEV+ DF+D+LKS S+GYAS DY+  +++ S
Sbjct: 419 MTLCNQKRGVQVNMQYMGRQVMLTYDLPMNEVVMDFFDKLKSTSRGYASLDYHFKEFQPS 478

Query: 488 DLVKLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGGRIIA 547
           DL+KL I+VN E +DALS++VHR  S  RGR +  K++ LIP+QMF IA+QAAIG +IIA
Sbjct: 479 DLIKLDIMVNGEKVDALSLIVHRQSSVHRGRELASKMRELIPRQMFDIAVQAAIGSQIIA 538

Query: 548 RETVKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISILKTDNE 606
           RE VKA RK+V AKCYGGDITRK+KLLEKQK GK+RM++ G V+IPQSAF++IL+  ++
Sbjct: 539 RENVKALRKNVLAKCYGGDITRKKKLLEKQKAGKRRMKQVGNVEIPQSAFLAILQVSDK 597


>gi|313201517|ref|YP_004040175.1| GTP-binding protein lepa [Methylovorus sp. MP688]
 gi|312440833|gb|ADQ84939.1| GTP-binding protein LepA [Methylovorus sp. MP688]
          Length = 609

 Score =  747 bits (1928), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 359/600 (59%), Positives = 472/600 (78%), Gaps = 4/600 (0%)

Query: 8   LSRIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVR 67
           +  IRNFSI+AHIDHGKSTLADR IQ C GL++REM +QVLD+MD+ERERGITIKAQT  
Sbjct: 13  MKNIRNFSIIAHIDHGKSTLADRIIQLCGGLSDREMEAQVLDSMDLERERGITIKAQTAA 72

Query: 68  LNYTSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQAI 127
           L Y + D + YQLNLIDTPGHVDF+YEVSRSLSACEG+LLVVDA+QGVEAQ++AN Y AI
Sbjct: 73  LQYKALDGQIYQLNLIDTPGHVDFSYEVSRSLSACEGALLVVDASQGVEAQSVANCYTAI 132

Query: 128 DNNHEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERIVQQL 187
           D   E+  VLNK DLPSADP+RV ++IE+ IG+   DA+  SAKTGEG+  +LE +V ++
Sbjct: 133 DLGVEVTAVLNKIDLPSADPERVIQEIEDVIGVEATDAVRCSAKTGEGVRDVLEAVVARI 192

Query: 188 PSPTSPEG-ANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVERI 246
           P P   EG    PLKAL+IDSW+++Y+GV++LVR+I+G L     IR+M T A +  E++
Sbjct: 193 PPP---EGDPTKPLKALIIDSWFDNYVGVVMLVRVIDGTLKPKDKIRMMATRAVHLCEQV 249

Query: 247 GILTPKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVVFC 306
           G+ TPK    E+L  GE+G +IA IKE++  +VGDT+T    P   ALPGFK ++P VF 
Sbjct: 250 GVFTPKSRQKESLSAGEVGFIIAGIKELTSAKVGDTVTLADKPAAEALPGFKEVKPQVFA 309

Query: 307 GLFPVDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERLER 366
           GL+PV++ QFE LR A+ KLRLNDAS  FE ENSTALGFGFRCGFLGLLH+EI+QERLER
Sbjct: 310 GLYPVESNQFEALRDALEKLRLNDASLQFEPENSTALGFGFRCGFLGLLHMEIVQERLER 369

Query: 367 EFSLNLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEYLGS 426
           E+ ++LI T+P+VVYEL + +G + ++ NP  +PE ++I E+REP I V ++ P +Y+G 
Sbjct: 370 EYDMDLITTAPTVVYELLLKNGEVVQIENPSRLPEPSRIDEIREPVINVNLLMPQDYVGP 429

Query: 427 ILKLCQERRGIQIDMSHLDNRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDYRD 486
           ++ LC  +RG+Q +M ++  + M+ YE+PLNEV+ DF+D+LKSVS+GYAS DY  +++R 
Sbjct: 430 VMTLCNGKRGVQRNMQYMGRQVMLSYEMPLNEVVLDFFDKLKSVSRGYASMDYEFLEFRA 489

Query: 487 SDLVKLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGGRII 546
           +DLVKL I+VN + +DALS++VHR+ S  RGR +C K++ LIP+QMF +A+QAAIG  II
Sbjct: 490 ADLVKLDIMVNGDRVDALSLIVHRANSIYRGRQLCAKMRELIPRQMFDVAVQAAIGANII 549

Query: 547 ARETVKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISILKTDNE 606
           ARETVKA RK+V AKCYGGDITRK+KLLEKQKEGKKRM++ G V+IPQ AF++ILK +++
Sbjct: 550 ARETVKAMRKNVLAKCYGGDITRKKKLLEKQKEGKKRMKQVGNVEIPQEAFLAILKVEDK 609


>gi|88608229|ref|YP_506646.1| GTP-binding protein LepA [Neorickettsia sennetsu str. Miyayama]
 gi|119371371|sp|Q2GD00|LEPA_NEOSM RecName: Full=Elongation factor 4; Short=EF-4; AltName:
           Full=Ribosomal back-translocase LepA
 gi|88600398|gb|ABD45866.1| GTP-binding protein LepA [Neorickettsia sennetsu str. Miyayama]
          Length = 596

 Score =  747 bits (1928), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 359/597 (60%), Positives = 469/597 (78%), Gaps = 4/597 (0%)

Query: 8   LSRIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVR 67
           +  IRNF+I+AHIDHGKSTLADR ++ C+ +  R+M  Q+LD+M IERERGITIK+QTV 
Sbjct: 1   MKNIRNFAIIAHIDHGKSTLADRLMEECKAVDPRKMKEQLLDSMKIERERGITIKSQTVM 60

Query: 68  LNYTSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQAI 127
           L YT+ D +DY LNLIDTPGHVDF+YEVSRSL+ACEGSLL+VDATQG+EAQTLANVY+AI
Sbjct: 61  LKYTAKDNEDYVLNLIDTPGHVDFSYEVSRSLAACEGSLLIVDATQGLEAQTLANVYKAI 120

Query: 128 DNNHEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERIVQQL 187
           DN+H II V+NK DL SA+P+RV+ QI + IGISTE+A+ VSAK G GI  LLE IV+ +
Sbjct: 121 DNDHAIIPVINKIDLDSAEPERVRAQIRDVIGISTENAVEVSAKLGTGIADLLESIVKYI 180

Query: 188 PSPTSPEG-ANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVERI 246
           P P   EG  +  L+ALLIDSWY+ YLGV++LVR+ NG +  G +I +M    KY VE++
Sbjct: 181 PPP---EGDVSERLQALLIDSWYDIYLGVVILVRVKNGSIKSGMTIEMMSNGNKYCVEKV 237

Query: 247 GILTPKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVVFC 306
           GI TP+  ++  L  GEIG + ASIK      VGDTITD  +P T  LPGFK ++PVVFC
Sbjct: 238 GIFTPEKRNVTELRAGEIGFLTASIKNARDCNVGDTITDAKNPCTEHLPGFKQLRPVVFC 297

Query: 307 GLFPVDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERLER 366
            LFPV + +FE LR ++ KL LND+SF+FE E+S+ALG GFRCGFLG+LHLE+I +RL+ 
Sbjct: 298 SLFPVSSDEFEKLRQSLEKLHLNDSSFTFESESSSALGHGFRCGFLGMLHLEVITQRLDE 357

Query: 367 EFSLNLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEYLGS 426
           EF L L+ T+PSVVY ++M D S+ +L NP +MP+ +KI  + EPWI+ +++ P +Y+G 
Sbjct: 358 EFDLALVLTAPSVVYRIHMKDSSVLELYNPTEMPDPSKIDHIEEPWIKASVMLPGDYIGE 417

Query: 427 ILKLCQERRGIQIDMSHLDNRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDYRD 486
           ++ LC E+RG QID+ ++DN+A++ Y LPL+E++FDFYD+LKSVSKGYAS D+ +  YR 
Sbjct: 418 VINLCNEKRGEQIDLVYVDNKAILTYGLPLSEIVFDFYDKLKSVSKGYASLDWEIHGYRS 477

Query: 487 SDLVKLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGGRII 546
           S+LVKL+I++N E +DALS++++R  +EKRGR ICE+LK LIP+Q ++IAIQAAIGG++I
Sbjct: 478 SELVKLSIVINGEEVDALSVMIYRPNAEKRGREICERLKELIPRQQYKIAIQAAIGGKVI 537

Query: 547 ARETVKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISILKT 603
           ARETV   RKDVTAK YGGD TR+ KLLEKQK+GKKRM   G+V+IPQSAF+  LK 
Sbjct: 538 ARETVNPYRKDVTAKLYGGDRTRRMKLLEKQKKGKKRMHSIGKVNIPQSAFMEALKV 594


>gi|296133948|ref|YP_003641195.1| GTP-binding protein LepA [Thermincola sp. JR]
 gi|296032526|gb|ADG83294.1| GTP-binding protein LepA [Thermincola potens JR]
          Length = 602

 Score =  747 bits (1928), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 353/594 (59%), Positives = 460/594 (77%), Gaps = 3/594 (0%)

Query: 12  RNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVRLNYT 71
           RNFSI+AHIDHGKSTLADR +++   L++REM+ QVLD MD+ERERGITIKAQ VRL Y 
Sbjct: 11  RNFSIIAHIDHGKSTLADRLLEYTGTLSQREMADQVLDQMDLERERGITIKAQAVRLTYP 70

Query: 72  STDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQAIDNNH 131
           + D   Y LNLIDTPGHVDFTYEVSRSL+ACEG+LLVVDA QG+EAQTLANVY A++++ 
Sbjct: 71  AKDGNVYTLNLIDTPGHVDFTYEVSRSLAACEGALLVVDAAQGIEAQTLANVYLALEHDL 130

Query: 132 EIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERIVQQLPSPT 191
           EII V+NK DLPSA+P+RVKK+IEE IG+   DA+L SAK G G+  +LERIV+Q+P P 
Sbjct: 131 EIIPVINKIDLPSAEPERVKKEIEEVIGLDASDAILASAKEGIGVEEILERIVRQVPPPK 190

Query: 192 SPEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVERIGILTP 251
               A APLKAL+ DS Y+ Y GV+V +R+++G +  G  I++M T   ++V  +GI  P
Sbjct: 191 G--DAAAPLKALIFDSHYDPYKGVIVYIRVVDGSIRPGMKIKMMATGKTFEVNEVGIFKP 248

Query: 252 KMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVVFCGLFPV 311
            M  ++ L  G++G + ASIK V  TRVGDT+T+   P    LPG+K I P+VFCGL+P+
Sbjct: 249 YMTQVDRLSVGDVGFIAASIKNVKDTRVGDTVTEADRPADKPLPGYKKITPMVFCGLYPI 308

Query: 312 DATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERLEREFSLN 371
           D   +++LR A+ KL+LNDAS  FE ENS ALGFGFR GFLGLLH+EIIQERLERE+ LN
Sbjct: 309 DGADYDDLRDALEKLKLNDASLIFEPENSVALGFGFRLGFLGLLHMEIIQERLEREYGLN 368

Query: 372 LIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEYLGSILKLC 431
           LI T+PSV+++++  +G +  + NP ++P    IA++ EP+++ T++ PN Y+GS+++L 
Sbjct: 369 LITTAPSVIFKVHKTNGEVIDVDNPTNLPPPQNIAKMEEPYVKATVMVPNTYVGSVMELA 428

Query: 432 QERRGIQIDMSHL-DNRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDYRDSDLV 490
           QE+RG  I+M +L +NR M+ YELPL E+I+DF+D LKS +KGYASFDY    Y++SDLV
Sbjct: 429 QEKRGTFINMEYLSENRVMLHYELPLIEIIYDFFDLLKSRTKGYASFDYEFSGYKESDLV 488

Query: 491 KLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGGRIIARET 550
           KL ILV  E +DALS +VH+  + +RGR + EKLK LIP+ MF+I IQAAIG +IIARET
Sbjct: 489 KLDILVGGEVVDALSSIVHKDRAYQRGRQLAEKLKELIPRHMFEIPIQAAIGNKIIARET 548

Query: 551 VKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISILKTD 604
           VKA RK+V AKCYGGDITRKRKLLEKQKEGKKRM++ G V+IPQ AF+++LK +
Sbjct: 549 VKALRKNVLAKCYGGDITRKRKLLEKQKEGKKRMKQVGNVEIPQEAFMAVLKLE 602


>gi|297529326|ref|YP_003670601.1| GTP-binding protein LepA [Geobacillus sp. C56-T3]
 gi|297252578|gb|ADI26024.1| GTP-binding protein LepA [Geobacillus sp. C56-T3]
          Length = 609

 Score =  747 bits (1928), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 338/598 (56%), Positives = 469/598 (78%), Gaps = 3/598 (0%)

Query: 10  RIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVRLN 69
           RIRNFSI+AHIDHGKSTLADR ++    L+ERE+  Q LD M++ERERGITIK   V+L 
Sbjct: 12  RIRNFSIIAHIDHGKSTLADRILEKTGALSERELREQTLDTMELERERGITIKLNAVQLT 71

Query: 70  YTSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQAIDN 129
           Y + + ++Y  +LIDTPGHVDFTYEVSRSL+ACEG++LVVDA QG+EAQTLANVY AIDN
Sbjct: 72  YKAKNGEEYIFHLIDTPGHVDFTYEVSRSLAACEGAILVVDAAQGIEAQTLANVYLAIDN 131

Query: 130 NHEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERIVQQLPS 189
           N EI++V+NK DLPSA+P+RV+++IE+ IG+   DA+L SAK G GI  +LE+IV+++P+
Sbjct: 132 NLEILSVINKIDLPSAEPERVRQEIEDVIGLDASDAVLASAKVGIGIEEILEKIVEKIPA 191

Query: 190 PTSPEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVERIGIL 249
           P+     +APLKAL+ DS Y+ Y GV+  VR+++G +  GQ I++M T  +++V  +G+ 
Sbjct: 192 PSG--DPDAPLKALIFDSLYDPYRGVVAYVRVVDGTVKPGQRIKMMSTGKEFEVTEVGVF 249

Query: 250 TPKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVVFCGLF 309
           TPK   ++ L  G++G + ASIK V  TRVGDTITD   P    LPG++ + P+VFCG++
Sbjct: 250 TPKQKVVDELTVGDVGYLTASIKNVKDTRVGDTITDAERPAAEPLPGYRKLNPMVFCGMY 309

Query: 310 PVDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERLEREFS 369
           P+D  ++ +LR A+ KL+LNDA+  FE E S ALGFGFRCGFLGLLH+EIIQERLEREF 
Sbjct: 310 PIDTARYNDLREALEKLQLNDAALHFEPETSQALGFGFRCGFLGLLHMEIIQERLEREFH 369

Query: 370 LNLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEYLGSILK 429
           ++LI T+PSVVY++++ DG+   + NP +MP+  KI  + EP+++ TI+ PN+Y+G +++
Sbjct: 370 IDLITTAPSVVYKVHLTDGTEVDVDNPTNMPDPQKIDRIEEPYVKATIMVPNDYVGPVME 429

Query: 430 LCQERRGIQIDMSHLD-NRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDYRDSD 488
           LCQ +RG  +DM +LD  R M++Y++PL+E+++DF+D LKS +KGYASFDY +I YR S+
Sbjct: 430 LCQGKRGTFVDMQYLDEKRVMLIYDIPLSEIVYDFFDALKSNTKGYASFDYELIGYRPSN 489

Query: 489 LVKLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGGRIIAR 548
           LVK+ IL+N E IDALS +VHR  + +RG+ I EKLK+LIP+Q F++ +QAAIG ++IAR
Sbjct: 490 LVKMDILLNGEKIDALSFIVHRDSAYERGKAIVEKLKDLIPRQQFEVPVQAAIGNKVIAR 549

Query: 549 ETVKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISILKTDNE 606
            T+KA RK+V AKCYGGD++RKRKLLEKQKEGKKRM++ G V++PQ AF+++LK D++
Sbjct: 550 STIKALRKNVLAKCYGGDVSRKRKLLEKQKEGKKRMKQIGSVEVPQEAFMAVLKIDDQ 607


>gi|313896897|ref|ZP_07830444.1| GTP-binding protein LepA [Selenomonas sp. oral taxon 137 str.
           F0430]
 gi|312974344|gb|EFR39812.1| GTP-binding protein LepA [Selenomonas sp. oral taxon 137 str.
           F0430]
          Length = 599

 Score =  746 bits (1927), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 350/599 (58%), Positives = 465/599 (77%), Gaps = 5/599 (0%)

Query: 9   SRIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVRL 68
           S IRNFSI+AHIDHGKST+ADR I++   L++REM +QVLD+MD+ERERGITIKAQTVRL
Sbjct: 4   SHIRNFSIIAHIDHGKSTIADRLIEYTGTLSKREMEAQVLDSMDLERERGITIKAQTVRL 63

Query: 69  NYTSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQAID 128
           +Y   D + Y+LNLIDTPGHVDF YEVSRSL+ACEG+LLVVDA QGVEAQTLANVY A++
Sbjct: 64  DYRGADGEMYELNLIDTPGHVDFNYEVSRSLAACEGALLVVDAAQGVEAQTLANVYLALE 123

Query: 129 NNHEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERIVQQLP 188
           ++ EI+ V+NK DLPSA+P+RV  +IE+TIG+ T  A+L SAKTG GI  +L+ IV  +P
Sbjct: 124 HDLEILPVINKIDLPSAEPERVAHEIEDTIGLDTSAAVLASAKTGIGIKEILDAIVAYVP 183

Query: 189 SPTSPEG-ANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVERIG 247
           +P   EG A+APL+AL+ DS+++ Y GV+  VR+  G + KG  ++LM T   ++V  +G
Sbjct: 184 AP---EGDADAPLRALIFDSYFDPYKGVIANVRVKEGAIKKGMKLKLMATGKTFEVTDVG 240

Query: 248 ILTPKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVVFCG 307
              P+ +D  AL  GE+G +  ++K+V   RVGDT+T    P   ALPG++ + P+VFCG
Sbjct: 241 CFRPQPVDTGALGTGEVGFIAGALKDVRDVRVGDTVTSAERPAAEALPGYRGVTPMVFCG 300

Query: 308 LFPVDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERLERE 367
           L+P D+  ++NLR A+ KL+LNDA+  FE E S ALGFGFRCGFLGLLH+++IQERLERE
Sbjct: 301 LYPEDSKDYDNLREALEKLQLNDAALVFEPETSIALGFGFRCGFLGLLHMDVIQERLERE 360

Query: 368 FSLNLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEYLGSI 427
           ++L LI T+PSVVY +Y  DG+M+ +SNP D+P  T+I  + EP+++ T+I P +Y+G++
Sbjct: 361 YNLGLIMTAPSVVYHVYRTDGTMRAVSNPADLPPQTEIDHIEEPYVKATVIVPKDYVGAV 420

Query: 428 LKLCQERRGIQIDMSHLD-NRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDYRD 486
           +++ QE+RGI   M +LD  R MI+YE+PLNE+++D++DRLKS ++GYAS DY +IDYR 
Sbjct: 421 MEISQEKRGIFKTMDYLDATRVMIIYEIPLNEILYDYFDRLKSATRGYASLDYELIDYRA 480

Query: 487 SDLVKLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGGRII 546
             LVKL IL+N + +DALS +VHR  +  RGR +  KLK +IPQQMF+I IQAAIG +II
Sbjct: 481 GSLVKLDILLNGDPVDALSTIVHRDRAVARGRQLAVKLKGIIPQQMFEIPIQAAIGSKII 540

Query: 547 ARETVKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISILKTDN 605
           ARE V+ARRKDV AKCYGGDITRKRKLLEKQKEGKKRM+  G V++PQ AF+++LK D 
Sbjct: 541 ARENVRARRKDVLAKCYGGDITRKRKLLEKQKEGKKRMKAVGSVELPQEAFMAVLKIDE 599


>gi|291613746|ref|YP_003523903.1| GTP-binding protein LepA [Sideroxydans lithotrophicus ES-1]
 gi|291583858|gb|ADE11516.1| GTP-binding protein LepA [Sideroxydans lithotrophicus ES-1]
          Length = 597

 Score =  746 bits (1927), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 344/599 (57%), Positives = 464/599 (77%), Gaps = 2/599 (0%)

Query: 8   LSRIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVR 67
           +  IRNFSI+AHIDHGKSTLADR I  C GL++REM  QVLD+MDIERERGITIKAQT  
Sbjct: 1   MQHIRNFSIIAHIDHGKSTLADRIIHLCGGLSDREMEEQVLDSMDIERERGITIKAQTAA 60

Query: 68  LNYTSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQAI 127
           LNY + D + Y LNLIDTPGHVDF+YEVSRSLSACEG+LLVVDA+QGVEAQT+AN Y A+
Sbjct: 61  LNYKARDGQLYNLNLIDTPGHVDFSYEVSRSLSACEGALLVVDASQGVEAQTVANCYTAL 120

Query: 128 DNNHEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERIVQQL 187
           D   E++ VLNK DLPSA+P+    +IE+ IGI  +DA+  SAKTG G+  +LE ++ ++
Sbjct: 121 DLGVEVVPVLNKIDLPSANPENAIAEIEDVIGIGAQDAVRCSAKTGMGVEDVLEALIVKV 180

Query: 188 PSPTSPEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVERIG 247
           P P      +APL+AL+IDSW+++Y+GV++LVRI+NG L     I  M T A++  E +G
Sbjct: 181 PPPKG--DVDAPLQALIIDSWFDNYVGVVMLVRIVNGTLKPKDKILFMATGAQHLTEHVG 238

Query: 248 ILTPKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVVFCG 307
           + TPK  D ++L  G++G +IA IKE+   +VGDT+T  S P  SALPGFK IQP VF G
Sbjct: 239 VFTPKSQDRDSLSAGQVGFVIAGIKELKDAKVGDTVTLVSRPAASALPGFKEIQPQVFAG 298

Query: 308 LFPVDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERLERE 367
           LFPV++ Q+E LR ++ KL+LNDA+  +E E S ALGFGFRCGFLGLLH+EI+QERLERE
Sbjct: 299 LFPVESNQYEALRDSLEKLKLNDAALQYEPEVSQALGFGFRCGFLGLLHMEIVQERLERE 358

Query: 368 FSLNLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEYLGSI 427
           F ++LI T+P+V+YE+   DG++  + NP  +P+++K+ E+REP + V +  P EY+GS+
Sbjct: 359 FDMDLITTAPTVIYEVVQRDGTVLMVDNPSKLPDLSKVEEIREPIVNVNLYMPQEYVGSV 418

Query: 428 LKLCQERRGIQIDMSHLDNRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDYRDS 487
           + LC ++RG+QIDM++   + ++ YE+P+ E++ DF+D+LKSVS+GYAS DY   +YR +
Sbjct: 419 ITLCTQKRGVQIDMTYHGKQVLLKYEMPMGEIVLDFFDKLKSVSRGYASMDYEFKEYRPA 478

Query: 488 DLVKLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGGRIIA 547
           D+VK+ +L+N E +DALSI+VHR+ S+ RGR +  K++ LIP+QMF +AIQAAIG  II+
Sbjct: 479 DVVKVDMLINGEKVDALSIIVHRANSQYRGREVAAKMRELIPRQMFDVAIQAAIGANIIS 538

Query: 548 RETVKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISILKTDNE 606
           RE VKA RK+V AKCYGGDI+RK+KLLEKQK GKKRM++ G V+IPQ AF++IL+ D++
Sbjct: 539 RENVKALRKNVLAKCYGGDISRKKKLLEKQKAGKKRMKQVGSVEIPQEAFLAILRVDDK 597


>gi|218767887|ref|YP_002342399.1| GTP-binding protein LepA [Neisseria meningitidis Z2491]
 gi|24211954|sp|Q9JV65|LEPA_NEIMA RecName: Full=Elongation factor 4; Short=EF-4; AltName:
           Full=Ribosomal back-translocase LepA
 gi|121051895|emb|CAM08201.1| putative GTP-binding protein [Neisseria meningitidis Z2491]
 gi|319410134|emb|CBY90470.1| putative GTP-binding protein LepA [Neisseria meningitidis WUE 2594]
          Length = 597

 Score =  746 bits (1927), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 342/599 (57%), Positives = 467/599 (77%), Gaps = 2/599 (0%)

Query: 8   LSRIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVR 67
           +  IRNFSI+AHIDHGKSTLADRFIQ+C GL  REMS+QVLD+MDIE+ERGITIKAQT  
Sbjct: 1   MKNIRNFSIIAHIDHGKSTLADRFIQYCGGLDLREMSTQVLDSMDIEKERGITIKAQTAA 60

Query: 68  LNYTSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQAI 127
           LNY + D + YQLNLIDTPGHVDF+YEVSRSLSACEG+LLVVDA+QGVEAQT+AN Y AI
Sbjct: 61  LNYKARDGQVYQLNLIDTPGHVDFSYEVSRSLSACEGALLVVDASQGVEAQTVANCYTAI 120

Query: 128 DNNHEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERIVQQL 187
           D   E++ VLNK DLP+ADP+RV+++IE+ IGI    A+  SAK+G G+  +LE IV ++
Sbjct: 121 DLGVEVVPVLNKIDLPAADPERVEQEIEDIIGIDAVGAVQCSAKSGIGVEDVLEEIVAKI 180

Query: 188 PSPTSPEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVERIG 247
           P+P   E  NAPL+A+++DSW+++Y+GV++L+R+ NG +     +R M T A+ QVE++G
Sbjct: 181 PAPAGDE--NAPLQAVIVDSWFDNYVGVVMLIRVKNGTIKLKDKVRFMSTKAETQVEQLG 238

Query: 248 ILTPKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVVFCG 307
           + TPK +  + L  GE+G +I  +KE+   +VGDT+T  ++P +  LPGF+ +Q  VF G
Sbjct: 239 VFTPKSVQKQELKAGEVGFLITGVKELGQAKVGDTVTLIANPASEPLPGFQEVQSQVFAG 298

Query: 308 LFPVDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERLERE 367
           L+PV++  +E LR A+ KL+LNDAS  FE E S ALGFGFRCGFLGLLHLEI+QERLERE
Sbjct: 299 LYPVESHDYEALRDALEKLQLNDASLKFEPEVSQALGFGFRCGFLGLLHLEIVQERLERE 358

Query: 368 FSLNLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEYLGSI 427
           F ++LI T+P+VVYE+ + +G   ++ NP  +P++  I  + EP I  TI+ P EY+G++
Sbjct: 359 FDMDLITTAPTVVYEVVLKNGEKIEVENPSKLPDIGSIETILEPIITATILVPQEYVGNV 418

Query: 428 LKLCQERRGIQIDMSHLDNRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDYRDS 487
           + LC ++RG+Q++M ++  + M+ Y+LP+NEV+ DF+D+LKS S+GYAS DY+  +++ S
Sbjct: 419 MTLCNQKRGVQVNMQYMGRQVMLTYDLPMNEVVMDFFDKLKSTSRGYASLDYHFKEFQPS 478

Query: 488 DLVKLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGGRIIA 547
           DL+KL I+VN E +DALS++VHR  +  RGR +  K++ LIP+QMF IA+QAAIG +IIA
Sbjct: 479 DLIKLDIMVNGEKVDALSLIVHRQSAVHRGRELASKMRELIPRQMFDIAVQAAIGSQIIA 538

Query: 548 RETVKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISILKTDNE 606
           RE VKA RK+V AKCYGGDITRK+KLLEKQK GK+RM++ G V+IPQSAF++IL+  ++
Sbjct: 539 RENVKALRKNVLAKCYGGDITRKKKLLEKQKAGKRRMKQVGNVEIPQSAFLAILQVSDK 597


>gi|239827779|ref|YP_002950403.1| GTP-binding protein LepA [Geobacillus sp. WCH70]
 gi|239808072|gb|ACS25137.1| GTP-binding protein LepA [Geobacillus sp. WCH70]
          Length = 610

 Score =  746 bits (1927), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 340/597 (56%), Positives = 471/597 (78%), Gaps = 3/597 (0%)

Query: 10  RIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVRLN 69
           RIRNFSI+AHIDHGKSTLADR ++    L+EREM  Q LD+M++ERERGITIK   V+L 
Sbjct: 13  RIRNFSIIAHIDHGKSTLADRILEKTGALSEREMREQTLDSMELERERGITIKLNAVQLK 72

Query: 70  YTSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQAIDN 129
           Y + + ++Y  +LIDTPGHVDFTYEVSRSL+ACEG++LVVDA QG+EAQTLANVY A+DN
Sbjct: 73  YKAKNGEEYIFHLIDTPGHVDFTYEVSRSLAACEGAILVVDAAQGIEAQTLANVYLALDN 132

Query: 130 NHEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERIVQQLPS 189
           N EI+ V+NK DLPSADP+RV+++IEE IG+   +A+L SAK G GI  +LE+IV+++P+
Sbjct: 133 NLEILPVINKIDLPSADPERVRQEIEEVIGLDASEAVLASAKVGIGIEEILEQIVEKIPA 192

Query: 190 PTSPEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVERIGIL 249
           P+     +APLKAL+ DS Y+SY GV+  +R+++G +  GQ I++M T  +++V  +G+ 
Sbjct: 193 PSG--DPDAPLKALIFDSMYDSYRGVVAYIRVMDGTVKPGQKIKMMSTGKEFEVAEVGVF 250

Query: 250 TPKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVVFCGLF 309
           TPK   ++ L  G++G + ASIK VS TRVGDTITD  +P    LPG++ + P+VFCG++
Sbjct: 251 TPKPKLVDELTVGDVGFLTASIKNVSDTRVGDTITDAENPAAEPLPGYRKLNPMVFCGMY 310

Query: 310 PVDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERLEREFS 369
           P+D  ++ +LR A+ KL+LNDA+  FE E S ALGFGFRCGFLGLLH+EIIQER+EREF+
Sbjct: 311 PIDTARYNDLREALEKLQLNDAALHFEPETSQALGFGFRCGFLGLLHMEIIQERIEREFN 370

Query: 370 LNLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEYLGSILK 429
           ++LI T+PSVVY++Y+ DG+  ++ NP +MP+  KI  + EP+++ TI+ PN+Y+G +++
Sbjct: 371 IDLITTAPSVVYKVYLTDGTEVQVDNPSNMPDPQKIDHVEEPYVKATIMVPNDYVGPVME 430

Query: 430 LCQERRGIQIDMSHLD-NRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDYRDSD 488
           LCQ +RG  +DM +LD  R  ++YE+PL+E+++DF+D LKS +KGYASFDY +I Y+ S 
Sbjct: 431 LCQGKRGNFVDMQYLDEKRVTLIYEIPLSEIVYDFFDTLKSSTKGYASFDYELIGYKPSK 490

Query: 489 LVKLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGGRIIAR 548
           LVK+ IL+N E IDALS +VHR  + +RG+ I EKLK++IP+Q F++ +QAAIG +IIAR
Sbjct: 491 LVKMDILLNGEKIDALSFIVHRDSAYERGKVIVEKLKDVIPRQQFEVPVQAAIGNKIIAR 550

Query: 549 ETVKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISILKTDN 605
            T+KA RK+V AKCYGGD++RKRKLLEKQKEGKKRM++ G V++PQ AF++ILK D+
Sbjct: 551 STIKALRKNVLAKCYGGDVSRKRKLLEKQKEGKKRMKQIGSVEVPQEAFMAILKIDD 607


>gi|253997003|ref|YP_003049067.1| GTP-binding protein LepA [Methylotenera mobilis JLW8]
 gi|253983682|gb|ACT48540.1| GTP-binding protein LepA [Methylotenera mobilis JLW8]
          Length = 597

 Score =  746 bits (1926), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 354/599 (59%), Positives = 467/599 (77%), Gaps = 2/599 (0%)

Query: 8   LSRIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVR 67
           +  IRNFSI+AHIDHGKSTLADR I  C GL +REM +QVLD+MDIERERGITIKAQT  
Sbjct: 1   MKNIRNFSIIAHIDHGKSTLADRIIHLCGGLADREMEAQVLDSMDIERERGITIKAQTAA 60

Query: 68  LNYTSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQAI 127
           L Y + D + Y LNLIDTPGHVDF+YEVSRSLSACEG+LLVVDA+QGVEAQ++AN Y A+
Sbjct: 61  LEYKADDGQIYHLNLIDTPGHVDFSYEVSRSLSACEGALLVVDASQGVEAQSVANCYTAL 120

Query: 128 DNNHEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERIVQQL 187
           D   E+  VLNK DLPSADPDRV ++IE+ IG+   DA+  SAKTG G+  +LE ++ ++
Sbjct: 121 DLGVEVTAVLNKIDLPSADPDRVIQEIEDVIGVDASDAVRCSAKTGVGVRDVLEAVIAKV 180

Query: 188 PSPTSPEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVERIG 247
           P P     A  PLKAL+ID+W+++Y+GV++LVR+++G L     IRLM T +++  E++G
Sbjct: 181 PPPVG--DATKPLKALVIDAWFDNYVGVVMLVRVVDGTLKPKDKIRLMATGSEHLCEQVG 238

Query: 248 ILTPKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVVFCG 307
           + TPK +   AL  G++G +IA IKE++  +VGDT+T  + P    L GFK ++P VF G
Sbjct: 239 VFTPKSLQKTALSAGQVGFVIAGIKELAAAKVGDTVTLAAKPAAEPLAGFKEVKPQVFAG 298

Query: 308 LFPVDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERLERE 367
           L+PV++ QFE LRTA+ KLRLNDAS  FE ENSTALGFGFRCGFLGLLH+EI+QERLERE
Sbjct: 299 LYPVESNQFEALRTALEKLRLNDASLLFEAENSTALGFGFRCGFLGLLHMEIVQERLERE 358

Query: 368 FSLNLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEYLGSI 427
           + ++LI T+P+VVYEL + +G + ++ NP  +PE ++I E+REP I V ++ P +Y+G +
Sbjct: 359 YDMDLITTAPTVVYELLLKNGEVVQIENPSRLPEPSRIEEIREPMIVVNLLMPQDYVGPV 418

Query: 428 LKLCQERRGIQIDMSHLDNRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDYRDS 487
           + LC  +RGIQ +M ++  + M+ YE+PLNEV+ DF+DRLKSVS+GYAS DY  +++R +
Sbjct: 419 MTLCNGKRGIQRNMQYMGRQVMLSYEMPLNEVVLDFFDRLKSVSRGYASMDYEFLEFRAA 478

Query: 488 DLVKLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGGRIIA 547
           DLVKL I+VN E +DALS++VHRS S  RGR +  K++ LIP+QMF +AIQA+IG  IIA
Sbjct: 479 DLVKLDIMVNGERVDALSLIVHRSNSVYRGREVAAKMRELIPRQMFDVAIQASIGANIIA 538

Query: 548 RETVKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISILKTDNE 606
           RETVKA RK+V AKCYGGDITRKRKLLEKQKEGKKRM++ G V+IPQ AF++IL+ +++
Sbjct: 539 RETVKAMRKNVIAKCYGGDITRKRKLLEKQKEGKKRMKQVGSVEIPQEAFLAILRVEDK 597


>gi|320530573|ref|ZP_08031629.1| GTP-binding protein LepA [Selenomonas artemidis F0399]
 gi|320137188|gb|EFW29114.1| GTP-binding protein LepA [Selenomonas artemidis F0399]
          Length = 599

 Score =  746 bits (1926), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 349/598 (58%), Positives = 466/598 (77%), Gaps = 5/598 (0%)

Query: 9   SRIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVRL 68
           + IRNFSI+AHIDHGKST+ADR I++   L+EREM +QVLD+M++ERERGITIKAQTVRL
Sbjct: 4   THIRNFSIIAHIDHGKSTIADRLIEYTGTLSEREMEAQVLDSMELERERGITIKAQTVRL 63

Query: 69  NYTSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQAID 128
           +Y   D + Y+LNLIDTPGHVDF YEVSRSL+ACEG+LLVVDA QGVEAQTLANVY A++
Sbjct: 64  DYRGADGEMYELNLIDTPGHVDFNYEVSRSLAACEGALLVVDAAQGVEAQTLANVYLALE 123

Query: 129 NNHEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERIVQQLP 188
           ++ EI+ V+NK DLPSA+P+RV  +IE+TIG+ T  A+  SAKTG GI  +L+ IV  +P
Sbjct: 124 HDLEILPVINKIDLPSAEPERVAHEIEDTIGLDTSTAVFASAKTGVGIKEILDAIVAYVP 183

Query: 189 SPTSPEG-ANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVERIG 247
           +P   EG A+APL+AL+ DS+++SY GV+  VR+  G + KG  ++LM T   ++V  +G
Sbjct: 184 AP---EGDADAPLRALIFDSYFDSYKGVIANVRVKEGVIKKGMKLKLMATGKTFEVTDVG 240

Query: 248 ILTPKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVVFCG 307
              P+ +D  AL  GE+G +  ++K+V   RVGDT+T    P   ALPG++ + P+VFCG
Sbjct: 241 CFRPQPVDTGALGTGEVGFIAGALKDVRDVRVGDTVTSAERPAAEALPGYRGVTPMVFCG 300

Query: 308 LFPVDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERLERE 367
           L+P D+  ++NLR A+ KL+LNDA+  FE E S ALGFGFRCGFLGLLH+++IQERLERE
Sbjct: 301 LYPEDSKDYDNLREALEKLQLNDAALIFEPETSIALGFGFRCGFLGLLHMDVIQERLERE 360

Query: 368 FSLNLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEYLGSI 427
           ++L LI T+PSVVY +Y  DG+M+++SNP D+P  T+I  + EP+++ T+I P +Y+G++
Sbjct: 361 YNLGLIMTAPSVVYHVYRTDGTMREVSNPADLPPQTEIDHIEEPYVKATVIVPKDYVGAV 420

Query: 428 LKLCQERRGIQIDMSHLD-NRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDYRD 486
           +++ QE+RGI   M +LD  R MI+YE+PLNE+++D++DRLKS ++GYAS DY +IDYR 
Sbjct: 421 MEISQEKRGIFKTMDYLDATRVMIIYEIPLNEILYDYFDRLKSTTRGYASLDYELIDYRT 480

Query: 487 SDLVKLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGGRII 546
             LVKL IL+N + +DALS +VHR  +  RGR +  KLK +IPQQMF+I IQAAIG +II
Sbjct: 481 GSLVKLDILLNGDPVDALSTIVHRDRAVARGRQLAVKLKGIIPQQMFEIPIQAAIGSKII 540

Query: 547 ARETVKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISILKTD 604
           ARE V+ARRKDV AKCYGGDITRKRKLLEKQKEGKKRM+  G V++PQ AF+++LK D
Sbjct: 541 ARENVRARRKDVLAKCYGGDITRKRKLLEKQKEGKKRMKAVGSVELPQEAFMAVLKID 598


>gi|261380515|ref|ZP_05985088.1| GTP-binding protein LepA [Neisseria subflava NJ9703]
 gi|284796769|gb|EFC52116.1| GTP-binding protein LepA [Neisseria subflava NJ9703]
          Length = 597

 Score =  746 bits (1926), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 342/599 (57%), Positives = 467/599 (77%), Gaps = 2/599 (0%)

Query: 8   LSRIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVR 67
           +  IRNFSI+AHIDHGKSTLADRFIQ+C GL  REMS+QVLD+MDIE+ERGITIKAQT  
Sbjct: 1   MKNIRNFSIIAHIDHGKSTLADRFIQYCGGLDLREMSTQVLDSMDIEKERGITIKAQTAA 60

Query: 68  LNYTSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQAI 127
           LNY + D + YQLNLIDTPGHVDF+YEVSRSLSACEG+LLVVDA+QGVEAQT+AN Y AI
Sbjct: 61  LNYKARDGQVYQLNLIDTPGHVDFSYEVSRSLSACEGALLVVDASQGVEAQTVANCYTAI 120

Query: 128 DNNHEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERIVQQL 187
           D   E++ VLNK DLP+A+P+RV+++IE+ IGI    A+  SAK+G G+  +LE IV ++
Sbjct: 121 DLGVEVVPVLNKIDLPAAEPERVEQEIEDIIGIDAVGAVQCSAKSGIGVEDVLEEIVAKI 180

Query: 188 PSPTSPEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVERIG 247
           P+PT  E  NAPL+A+++DSW+++Y+GV++L+R+ NG +     +R M T A+ QVE++G
Sbjct: 181 PAPTGDE--NAPLQAVIVDSWFDNYVGVVMLIRVKNGTIKLKDKVRFMSTKAETQVEQLG 238

Query: 248 ILTPKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVVFCG 307
           + TPK +  + L  GE+G +I  +KE+   +VGDT+T  ++P +  LPGF+ +Q  VF G
Sbjct: 239 VFTPKSVQKQELKAGEVGFLITGVKELGQAKVGDTVTLVANPASEPLPGFQEVQSQVFAG 298

Query: 308 LFPVDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERLERE 367
           L+PV++  +E LR A+ KL+LNDAS  FE E S ALGFGFRCGFLGLLHLEI+QERLERE
Sbjct: 299 LYPVESHDYEALRDALEKLQLNDASLKFEPEVSQALGFGFRCGFLGLLHLEIVQERLERE 358

Query: 368 FSLNLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEYLGSI 427
           F ++LI T+P+VVYE+ +  G   ++ NP  +P++  I  + EP I  TI+ P EY+G++
Sbjct: 359 FDMDLITTAPTVVYEVVLKSGEKIEVENPSKLPDIGSIETILEPIITATILVPQEYVGNV 418

Query: 428 LKLCQERRGIQIDMSHLDNRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDYRDS 487
           + LC ++RG+Q++M ++  + M+ Y+LP+NEV+ DF+D+LKS S+GYAS DY+  +++ S
Sbjct: 419 MTLCNQKRGVQVNMQYMGRQVMLTYDLPMNEVVMDFFDKLKSTSRGYASLDYHFKEFQPS 478

Query: 488 DLVKLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGGRIIA 547
           DL+KL I+VN E +DALS++VHR  +  RGR +  K++ LIP+QMF IA+QAAIG +IIA
Sbjct: 479 DLIKLDIMVNGEKVDALSLIVHRQSAVHRGRELAAKMRELIPRQMFDIAVQAAIGSQIIA 538

Query: 548 RETVKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISILKTDNE 606
           RE VKA RK+V AKCYGGDITRK+KLLEKQK GK+RM++ G V+IPQSAF++IL+  ++
Sbjct: 539 RENVKALRKNVLAKCYGGDITRKKKLLEKQKAGKRRMKQVGNVEIPQSAFLAILQVSDK 597


>gi|261392865|emb|CAX50446.1| putative GTP-binding protein LepA [Neisseria meningitidis 8013]
          Length = 597

 Score =  746 bits (1926), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 342/599 (57%), Positives = 467/599 (77%), Gaps = 2/599 (0%)

Query: 8   LSRIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVR 67
           +  IRNFSI+AHIDHGKSTLADRFIQ+C GL  REMS+QVLD+MDIE+ERGITIKAQT  
Sbjct: 1   MKNIRNFSIIAHIDHGKSTLADRFIQYCGGLDLREMSTQVLDSMDIEKERGITIKAQTAA 60

Query: 68  LNYTSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQAI 127
           LNY + D + YQLNLIDTPGHVDF+YEVSRSLSACEG+LLVVDA+QGVEAQT+AN Y AI
Sbjct: 61  LNYKARDGQVYQLNLIDTPGHVDFSYEVSRSLSACEGALLVVDASQGVEAQTVANCYTAI 120

Query: 128 DNNHEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERIVQQL 187
           D   E++ VLNK DLP+ADP+RV+++IE+ IGI    A+  SAK+G G+  +LE IV ++
Sbjct: 121 DLGVEVVPVLNKIDLPAADPERVEQEIEDIIGIDAVGAVQCSAKSGIGVEDVLEEIVAKV 180

Query: 188 PSPTSPEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVERIG 247
           P+PT  E  NAPL+A+++DSW+++Y+GV++L+R+ NG +     +R M T A+ QVE++G
Sbjct: 181 PAPTGDE--NAPLQAVIVDSWFDNYVGVVMLIRVKNGTIKLKDKVRFMSTKAETQVEQLG 238

Query: 248 ILTPKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVVFCG 307
           + TPK +  + L  GE+G +I  +KE+   +VGDT+T  ++P +  LPGF+ ++  VF G
Sbjct: 239 VFTPKSVQKQELKAGEVGFLITGVKELGQAKVGDTVTLVANPASEPLPGFQEVKSQVFAG 298

Query: 308 LFPVDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERLERE 367
           L+PV++  +E LR A+ KL+LNDAS  FE E S ALGFGFRCGFLGLLHLEI+QERLERE
Sbjct: 299 LYPVESHDYEALRDALEKLQLNDASLKFEPEVSQALGFGFRCGFLGLLHLEIVQERLERE 358

Query: 368 FSLNLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEYLGSI 427
           F ++LI T+P+VVYE+ +  G   ++ NP  +P++  I  + EP I  TI+ P EY+G++
Sbjct: 359 FDMDLITTAPTVVYEVVLKSGEKIEVENPSKLPDIGSIETILEPIITATILVPQEYVGNV 418

Query: 428 LKLCQERRGIQIDMSHLDNRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDYRDS 487
           + LC ++RG+Q++M ++  + M+ Y+LP+NEV+ DF+D+LKS S+GYAS DY+  +++ S
Sbjct: 419 MTLCNQKRGVQVNMQYMGRQVMLTYDLPMNEVVMDFFDKLKSTSRGYASLDYHFKEFQPS 478

Query: 488 DLVKLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGGRIIA 547
           DL+KL I+VN E +DALS++VHR  +  RGR +  K++ LIP+QMF IA+QAAIG +IIA
Sbjct: 479 DLIKLDIMVNGEKVDALSLIVHRQSAVHRGRELASKMRELIPRQMFDIAVQAAIGSQIIA 538

Query: 548 RETVKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISILKTDNE 606
           RE VKA RK+V AKCYGGDITRK+KLLEKQK GK+RM++ G V+IPQSAF++IL+  ++
Sbjct: 539 RENVKALRKNVLAKCYGGDITRKKKLLEKQKAGKRRMKQVGNVEIPQSAFLAILQVSDK 597


>gi|53804474|ref|YP_113923.1| GTP-binding protein LepA [Methylococcus capsulatus str. Bath]
 gi|81682090|sp|Q608M4|LEPA_METCA RecName: Full=Elongation factor 4; Short=EF-4; AltName:
           Full=Ribosomal back-translocase LepA
 gi|53758235|gb|AAU92526.1| GTP-binding protein LepA [Methylococcus capsulatus str. Bath]
          Length = 601

 Score =  746 bits (1925), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 355/601 (59%), Positives = 470/601 (78%), Gaps = 2/601 (0%)

Query: 6   TPLSRIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQT 65
           T  + IRNFSI+AHIDHGKSTLADRFIQ C GL++REM+ QVLD+MDIERERGITIKAQ+
Sbjct: 2   TDQTHIRNFSIIAHIDHGKSTLADRFIQICGGLSDREMAEQVLDSMDIERERGITIKAQS 61

Query: 66  VRLNYTSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQ 125
           V L+Y S D   YQLN IDTPGHVDF+YEVSRSL+ACEG+LLVVDA QGVEAQ++AN Y 
Sbjct: 62  VTLDYQSRDGGIYQLNFIDTPGHVDFSYEVSRSLAACEGALLVVDAAQGVEAQSVANCYT 121

Query: 126 AIDNNHEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERIVQ 185
           AI+   E++ VLNK DLPSADP RVK +IEE IGI  EDA+ +SAKTG G+ LLLE +V+
Sbjct: 122 AIEQGLEVLPVLNKIDLPSADPARVKSEIEEIIGIPAEDAVEISAKTGFGVDLLLEELVK 181

Query: 186 QLPSPTSPEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVER 245
           ++P P     A  PL+AL+IDSW+++YLGV+ LVR++NG +++ Q I +M T   + VE+
Sbjct: 182 KIPPPKG--DAEGPLQALIIDSWFDNYLGVVSLVRVVNGAISRKQKITIMSTGKSHLVEK 239

Query: 246 IGILTPKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVVF 305
           +G+ TPK +D   L  GE+G ++A IK++    VGDTIT    PTT  LPGF+ +QP VF
Sbjct: 240 LGVFTPKPLDKTVLGAGEVGFVVAGIKDIFGAPVGDTITATDRPTTEPLPGFQKVQPRVF 299

Query: 306 CGLFPVDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERLE 365
            GL+PV++  +E+LR A+NKL LNDA+  FE E S ALGFGFRCGFLG+LH+EIIQERLE
Sbjct: 300 AGLYPVESDDYESLREALNKLHLNDAALHFEPEVSQALGFGFRCGFLGMLHMEIIQERLE 359

Query: 366 REFSLNLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEYLG 425
           RE+ L+LI T+P+VVYE+   DG++  + NP D+P   +I E+REP I+  I+ P +YLG
Sbjct: 360 REYDLDLITTAPTVVYEVAKSDGTVVPVDNPADLPPPNEIEEIREPIIEANILVPQDYLG 419

Query: 426 SILKLCQERRGIQIDMSHLDNRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDYR 485
           +++ LC E+RG+Q  + ++  +  + +ELPL+EV+ DF+DRLKS S+G+ASFDY  + ++
Sbjct: 420 AVISLCIEKRGVQKKLQYMGGQVALSFELPLSEVVLDFFDRLKSCSRGFASFDYEFLRFQ 479

Query: 486 DSDLVKLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGGRI 545
            + LVKL IL+N E +DALS++VHR +S  RGR + E++K+LIP+QMF++AIQAAIG +I
Sbjct: 480 AAPLVKLDILINGEKVDALSLIVHRDISMNRGRDLVERMKDLIPRQMFEVAIQAAIGSKI 539

Query: 546 IARETVKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISILKTDN 605
           IAR TVKA RK+V AKCYGGDITRKRKLLEKQK GKKRM++ G++DIPQ AF+++L+ + 
Sbjct: 540 IARSTVKAMRKNVLAKCYGGDITRKRKLLEKQKAGKKRMKQVGKIDIPQEAFLAVLRVNK 599

Query: 606 E 606
           +
Sbjct: 600 D 600


>gi|298368379|ref|ZP_06979697.1| GTP-binding protein LepA [Neisseria sp. oral taxon 014 str. F0314]
 gi|298282382|gb|EFI23869.1| GTP-binding protein LepA [Neisseria sp. oral taxon 014 str. F0314]
          Length = 597

 Score =  746 bits (1925), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 342/599 (57%), Positives = 467/599 (77%), Gaps = 2/599 (0%)

Query: 8   LSRIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVR 67
           +  IRNFSI+AHIDHGKSTLADRFIQ+C GL  REMS+QVLD+MDIE+ERGITIKAQT  
Sbjct: 1   MKNIRNFSIIAHIDHGKSTLADRFIQYCGGLDLREMSTQVLDSMDIEKERGITIKAQTAA 60

Query: 68  LNYTSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQAI 127
           L+Y + D + YQLNLIDTPGHVDF+YEVSRSLSACEG+LLVVDA+QGVEAQT+AN Y AI
Sbjct: 61  LSYKARDGQVYQLNLIDTPGHVDFSYEVSRSLSACEGALLVVDASQGVEAQTVANCYTAI 120

Query: 128 DNNHEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERIVQQL 187
           D   E++ VLNK DLP+ADP+RV+++IE+ IGI    A+  SAK+G G+  +LE IV ++
Sbjct: 121 DLGVEVVPVLNKIDLPAADPERVEQEIEDIIGIDAVGAVQCSAKSGIGVEDVLEEIVAKI 180

Query: 188 PSPTSPEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVERIG 247
           P+PT  E  NAPL+A+++DSW+++Y+GV++L+R+ NG +     +R M T A+ QVE++G
Sbjct: 181 PAPTGDE--NAPLQAVIVDSWFDNYVGVVMLIRVKNGTIKLKDKVRFMSTKAETQVEQLG 238

Query: 248 ILTPKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVVFCG 307
           + TPK +  + L  GE+G +I  +KE+   +VGDT+T  ++P +  LPGF+ +Q  VF G
Sbjct: 239 VFTPKSVQKQELKAGEVGFLITGVKELGQAKVGDTVTLVANPASEPLPGFQEVQSQVFAG 298

Query: 308 LFPVDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERLERE 367
           L+PV++  +E LR A+ KL+LNDAS  FE E S ALGFGFRCGFLGLLHLEI+QERLERE
Sbjct: 299 LYPVESHDYEALRDALEKLQLNDASLKFEPEVSQALGFGFRCGFLGLLHLEIVQERLERE 358

Query: 368 FSLNLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEYLGSI 427
           F ++LI T+P+VVYE+ +  G   ++ NP  +P++  I  + EP I  TI+ P EY+G++
Sbjct: 359 FDMDLITTAPTVVYEVVLKSGEKIEVENPSKLPDIGSIETILEPIITATILVPQEYVGNV 418

Query: 428 LKLCQERRGIQIDMSHLDNRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDYRDS 487
           + LC ++RG+Q++M ++  + M+ Y+LP+NEV+ DF+D+LKS S+GYAS DY+  +++ S
Sbjct: 419 MTLCNQKRGVQVNMQYMGRQVMLTYDLPMNEVVMDFFDKLKSTSRGYASLDYHFKEFQPS 478

Query: 488 DLVKLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGGRIIA 547
           DL+KL I+VN E +DALS++VHR  +  RGR +  K++ LIP+QMF IA+QAAIG +IIA
Sbjct: 479 DLIKLDIMVNGEKVDALSLIVHRQSAVHRGRELASKMRELIPRQMFDIAVQAAIGSQIIA 538

Query: 548 RETVKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISILKTDNE 606
           RE VKA RK+V AKCYGGDITRK+KLLEKQK GK+RM++ G V+IPQSAF++IL+  ++
Sbjct: 539 RENVKALRKNVLAKCYGGDITRKKKLLEKQKAGKRRMKQVGNVEIPQSAFLAILQVSDK 597


>gi|329770221|ref|ZP_08261611.1| GTP-binding protein lepA [Gemella sanguinis M325]
 gi|328837027|gb|EGF86671.1| GTP-binding protein lepA [Gemella sanguinis M325]
          Length = 605

 Score =  746 bits (1925), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 342/607 (56%), Positives = 477/607 (78%), Gaps = 3/607 (0%)

Query: 1   MQKKPTPLSRIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGIT 60
           M K+     +IRNFSI+AHIDHGKSTLADR ++  R L +REM +Q+LD+MDIERERGIT
Sbjct: 1   MDKRNERQKKIRNFSIIAHIDHGKSTLADRILEKTRALEQREMKAQLLDSMDIERERGIT 60

Query: 61  IKAQTVRLNYTSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTL 120
           IK   V+L YT+ + ++Y  +LIDTPGHVDFTYEVSRSL+ACEG++LVVDA QG+EAQTL
Sbjct: 61  IKLNAVQLQYTAKNGEEYIFHLIDTPGHVDFTYEVSRSLAACEGAILVVDAAQGIEAQTL 120

Query: 121 ANVYQAIDNNHEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLL 180
           ANVY A+DNN EII ++NK DLP+ADP++VK +IE+ IG+ T+D +L SAK G GI  +L
Sbjct: 121 ANVYLALDNNLEIIPIINKIDLPAADPEKVKTEIEDVIGLPTDDIVLASAKAGIGIDEIL 180

Query: 181 ERIVQQLPSPTSPEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAK 240
           E+IV+ +P+P+   G   PL+AL+ DS Y++Y GV+V VRI NG +  G  I++M T   
Sbjct: 181 EQIVEYIPAPSGDAGE--PLQALIFDSLYDAYRGVIVSVRIKNGTVKAGDKIKMMATGGV 238

Query: 241 YQVERIGILTPKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPI 300
           ++V  +GI TPK   ++ L  G++G + ASIK VS TRVGDTIT  ++P   ALPG++ +
Sbjct: 239 FEVTEVGIHTPKEKIVDELTAGDVGFICASIKNVSETRVGDTITLANNPAKEALPGYRKL 298

Query: 301 QPVVFCGLFPVDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEII 360
            P+VFCGL+P+D++++ +LR A+ KL LND++  +E E S ALGFGFRCGFLG+LH+EII
Sbjct: 299 NPMVFCGLYPIDSSKYNDLREALEKLELNDSALQYEAETSQALGFGFRCGFLGMLHMEII 358

Query: 361 QERLEREFSLNLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITP 420
           QER+EREF++++I T+PSV+Y++   DG+M  +SNP +MP+  KI  + EP+++ +I+ P
Sbjct: 359 QERIEREFNIDIIATAPSVIYKVEKTDGTMVDVSNPSEMPDPQKINRITEPFVKASIMVP 418

Query: 421 NEYLGSILKLCQERRGIQIDMSHLDN-RAMIVYELPLNEVIFDFYDRLKSVSKGYASFDY 479
           N+Y+G+++ LCQ++RGI ++M ++D+ R  I Y++PL+E++FDF+D+LKS +KGYASFDY
Sbjct: 419 NDYVGAVMDLCQKKRGIFLNMEYIDDTRVNITYDIPLSEIVFDFFDQLKSNTKGYASFDY 478

Query: 480 NVIDYRDSDLVKLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQA 539
            +  Y+DS+LVK+ IL+N E +DALS +VHR  + +RG+ I EKLK LIP+Q F+I IQA
Sbjct: 479 ELTGYKDSNLVKMDILLNGEQVDALSFIVHREFAYQRGKVIVEKLKKLIPKQQFEIPIQA 538

Query: 540 AIGGRIIARETVKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFIS 599
           AIG +II+RET+KA RK+V AKCYGGDI+RKRKLLEKQK+GK+RM+  G V++PQ AF++
Sbjct: 539 AIGNKIISRETIKAMRKNVLAKCYGGDISRKRKLLEKQKKGKERMKAVGSVEVPQDAFMA 598

Query: 600 ILKTDNE 606
           +LK D E
Sbjct: 599 VLKMDEE 605


>gi|261400452|ref|ZP_05986577.1| GTP-binding protein LepA [Neisseria lactamica ATCC 23970]
 gi|269209904|gb|EEZ76359.1| GTP-binding protein LepA [Neisseria lactamica ATCC 23970]
          Length = 597

 Score =  745 bits (1924), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 343/599 (57%), Positives = 466/599 (77%), Gaps = 2/599 (0%)

Query: 8   LSRIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVR 67
           +  IRNFSI+AHIDHGKSTLADRFIQ+C GL  REMS+QVLD+MDIE+ERGITIKAQT  
Sbjct: 1   MKNIRNFSIIAHIDHGKSTLADRFIQYCGGLDLREMSTQVLDSMDIEKERGITIKAQTAA 60

Query: 68  LNYTSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQAI 127
           LNY + D + YQLNLIDTPGHVDF+YEVSRSLSACEG+LLVVDA+QGVEAQT+AN Y AI
Sbjct: 61  LNYKARDGQVYQLNLIDTPGHVDFSYEVSRSLSACEGALLVVDASQGVEAQTVANCYTAI 120

Query: 128 DNNHEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERIVQQL 187
           D   E++ VLNK DLP+ADP+RV+++IE+ IGI    A+  SAK+G G+  +LE IV ++
Sbjct: 121 DLGVEVVPVLNKIDLPAADPERVEQEIEDIIGIDAVGAVQCSAKSGIGVEDVLEEIVAKI 180

Query: 188 PSPTSPEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVERIG 247
           P+PT  E  NAPL+A+++DSW+++Y+GV++L+R+ NG +     +R M T A+ QVE++G
Sbjct: 181 PAPTGDE--NAPLQAVIVDSWFDNYVGVVMLIRVKNGIIKLKDKVRFMSTKAETQVEQLG 238

Query: 248 ILTPKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVVFCG 307
           + TPK +  + L  GE+G +I  +KE+   +VGDT+T  ++P +  LPGF+ +Q  VF G
Sbjct: 239 VFTPKSVQKQELKAGEVGFLITGVKELGQAKVGDTVTLVANPASEPLPGFQEVQSQVFAG 298

Query: 308 LFPVDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERLERE 367
           L+PV++  +E LR A+ KL+LNDAS  FE E S ALGFGFRCGFLGLLHLEI+QERLERE
Sbjct: 299 LYPVESHDYEALRDALEKLQLNDASLKFEPEVSQALGFGFRCGFLGLLHLEIVQERLERE 358

Query: 368 FSLNLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEYLGSI 427
           F ++LI T+P+VVYE+ +  G   ++ NP  +P++  I  + EP I  TI+ P EY+G++
Sbjct: 359 FDMDLITTAPTVVYEVVLKSGEKIEVENPSKLPDIGSIETILEPIITATILVPQEYVGNV 418

Query: 428 LKLCQERRGIQIDMSHLDNRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDYRDS 487
           + LC ++RG+Q +M ++  + M+ Y+LP+NEV+ DF+D+LKS S+GYAS DY+  +++ S
Sbjct: 419 MTLCNQKRGVQANMQYMGRQVMLTYDLPMNEVVMDFFDKLKSTSRGYASLDYHFKEFQPS 478

Query: 488 DLVKLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGGRIIA 547
           DL+KL I+VN E +DALS++VHR  +  RGR +  K++ LIP+QMF IA+QAAIG +IIA
Sbjct: 479 DLIKLDIMVNGEKVDALSLIVHRQSAVHRGRELASKMRELIPRQMFDIAVQAAIGSQIIA 538

Query: 548 RETVKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISILKTDNE 606
           RE VKA RK+V AKCYGGDITRK+KLLEKQK GK+RM++ G V+IPQSAF++IL+  ++
Sbjct: 539 RENVKALRKNVLAKCYGGDITRKKKLLEKQKAGKRRMKQVGNVEIPQSAFLAILQVSDK 597


>gi|56421043|ref|YP_148361.1| GTP-binding protein LepA [Geobacillus kaustophilus HTA426]
 gi|81557830|sp|Q5KWZ3|LEPA_GEOKA RecName: Full=Elongation factor 4; Short=EF-4; AltName:
           Full=Ribosomal back-translocase LepA
 gi|56380885|dbj|BAD76793.1| GTP-binding protein [Geobacillus kaustophilus HTA426]
          Length = 609

 Score =  745 bits (1924), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 338/598 (56%), Positives = 468/598 (78%), Gaps = 3/598 (0%)

Query: 10  RIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVRLN 69
           RIRNFSI+AHIDHGKSTLADR ++    L+ERE+  Q LD M++ERERGITIK   V+L 
Sbjct: 12  RIRNFSIIAHIDHGKSTLADRILEKTGALSERELREQTLDTMELERERGITIKLNAVQLT 71

Query: 70  YTSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQAIDN 129
           Y + + ++Y  +LIDTPGHVDFTYEVSRSL+ACEG++LVVDA QG+EAQTLANVY AIDN
Sbjct: 72  YKAKNGEEYIFHLIDTPGHVDFTYEVSRSLAACEGAILVVDAAQGIEAQTLANVYLAIDN 131

Query: 130 NHEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERIVQQLPS 189
           N EI+ V+NK DLPSA+P+RV+++IE+ IG+   DA+L SAK G GI  +LE+IV+++P+
Sbjct: 132 NLEILPVINKIDLPSAEPERVRQEIEDVIGLDASDAVLASAKVGIGIEEILEKIVEKIPA 191

Query: 190 PTSPEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVERIGIL 249
           P+     +APLKAL+ DS Y+ Y GV+  VR+++G +  GQ I++M T  +++V  +G+ 
Sbjct: 192 PSG--DPDAPLKALIFDSLYDPYRGVVAYVRVVDGTVKPGQRIKMMSTGKEFEVTEVGVF 249

Query: 250 TPKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVVFCGLF 309
           TPK   ++ L  G++G + ASIK V  TRVGDTITD   P    LPG++ + P+VFCG++
Sbjct: 250 TPKQKVVDELTVGDVGYLTASIKNVKDTRVGDTITDAERPAAEPLPGYRKLNPMVFCGMY 309

Query: 310 PVDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERLEREFS 369
           P+D  ++ +LR A+ KL+LNDA+  FE E S ALGFGFRCGFLGLLH+EIIQERLEREF 
Sbjct: 310 PIDTARYNDLREALEKLQLNDAALHFEPETSQALGFGFRCGFLGLLHMEIIQERLEREFH 369

Query: 370 LNLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEYLGSILK 429
           ++LI T+PSVVY++++ DG+   + NP +MP+  KI  + EP+++ TI+ PN+Y+G +++
Sbjct: 370 IDLITTAPSVVYKVHLTDGTEVDVDNPTNMPDPQKIDRIEEPYVKATIMVPNDYVGPVME 429

Query: 430 LCQERRGIQIDMSHLD-NRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDYRDSD 488
           LCQ +RG  +DM +LD  R M++Y++PL+E+++DF+D LKS +KGYASFDY +I YR S+
Sbjct: 430 LCQGKRGTFVDMQYLDEKRVMLIYDIPLSEIVYDFFDALKSNTKGYASFDYELIGYRPSN 489

Query: 489 LVKLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGGRIIAR 548
           LVK+ IL+N E IDALS +VHR  + +RG+ I EKLK+LIP+Q F++ +QAAIG ++IAR
Sbjct: 490 LVKMDILLNGEKIDALSFIVHRDSAYERGKAIVEKLKDLIPRQQFEVPVQAAIGNKVIAR 549

Query: 549 ETVKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISILKTDNE 606
            T+KA RK+V AKCYGGD++RKRKLLEKQKEGKKRM++ G V++PQ AF+++LK D++
Sbjct: 550 STIKALRKNVLAKCYGGDVSRKRKLLEKQKEGKKRMKQIGSVEVPQEAFMAVLKIDDQ 607


>gi|225075619|ref|ZP_03718818.1| hypothetical protein NEIFLAOT_00635 [Neisseria flavescens
           NRL30031/H210]
 gi|224953041|gb|EEG34250.1| hypothetical protein NEIFLAOT_00635 [Neisseria flavescens
           NRL30031/H210]
          Length = 597

 Score =  745 bits (1924), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 342/596 (57%), Positives = 465/596 (78%), Gaps = 2/596 (0%)

Query: 8   LSRIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVR 67
           +  IRNFSI+AHIDHGKSTLADRFIQ+C GL  REMS+QVLD+MDIE+ERGITIKAQT  
Sbjct: 1   MKNIRNFSIIAHIDHGKSTLADRFIQYCGGLDLREMSTQVLDSMDIEKERGITIKAQTAA 60

Query: 68  LNYTSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQAI 127
           LNY + + + YQLNLIDTPGHVDF+YEVSRSLSACEG+LLVVDA+QGVEAQT+AN Y AI
Sbjct: 61  LNYKARNGQVYQLNLIDTPGHVDFSYEVSRSLSACEGALLVVDASQGVEAQTVANCYTAI 120

Query: 128 DNNHEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERIVQQL 187
           D   E++ VLNK DLP+ADP+RV+++IE+ IGI    A+  SAK+G G+  +LE IV ++
Sbjct: 121 DLGVEVVPVLNKIDLPAADPERVEQEIEDIIGIDAVGAVQCSAKSGIGVEDVLEEIVAKI 180

Query: 188 PSPTSPEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVERIG 247
           P+PT  E  NAPL+A+++DSW+++Y+GV++L+R+ NG +     +R M T A+ QVE++G
Sbjct: 181 PAPTGDE--NAPLQAVIVDSWFDNYVGVVMLIRVKNGTIKLKDKVRFMSTKAETQVEQLG 238

Query: 248 ILTPKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVVFCG 307
           + TPK +  + L  GE+G +I  +KE+   +VGDT+T  ++P +  LPGF+ +Q  VF G
Sbjct: 239 VFTPKSVQKQELKAGEVGFLITGVKELGQAKVGDTVTLVANPASEPLPGFQEVQSQVFAG 298

Query: 308 LFPVDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERLERE 367
           L+PV++  +E LR A+ KL+LNDAS  FE E S ALGFGFRCGFLGLLHLEI+QERLERE
Sbjct: 299 LYPVESHDYEALRDALEKLQLNDASLKFEPEVSQALGFGFRCGFLGLLHLEIVQERLERE 358

Query: 368 FSLNLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEYLGSI 427
           F ++LI T+P+VVYE+ +  G   ++ NP  +P++  I  + EP I  TI+ P EY+G++
Sbjct: 359 FDMDLITTAPTVVYEVVLKSGEKIEVENPSKLPDIGSIETILEPIITATILVPQEYVGNV 418

Query: 428 LKLCQERRGIQIDMSHLDNRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDYRDS 487
           + LC ++RG+Q++M ++  + M+ Y+LP+NEV+ DF+D+LKS S+GYAS DY+  +++ S
Sbjct: 419 MTLCNQKRGVQVNMQYMGRQVMLTYDLPMNEVVMDFFDKLKSTSRGYASLDYHFKEFQPS 478

Query: 488 DLVKLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGGRIIA 547
           DL+KL I+VN E +DALS++VHR  +  RGR +  K++ LIP+QMF IA+QAAIG +IIA
Sbjct: 479 DLIKLDIMVNGEKVDALSLIVHRQSAVHRGRELASKMRELIPRQMFDIAVQAAIGSQIIA 538

Query: 548 RETVKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISILKT 603
           RE VKA RK+V AKCYGGDITRK+KLLEKQK GK+RM++ G V+IPQSAF++IL+ 
Sbjct: 539 RENVKALRKNVLAKCYGGDITRKKKLLEKQKAGKRRMKQVGNVEIPQSAFLAILQV 594


>gi|300113375|ref|YP_003759950.1| GTP-binding protein lepA [Nitrosococcus watsonii C-113]
 gi|299539312|gb|ADJ27629.1| GTP-binding protein LepA [Nitrosococcus watsonii C-113]
          Length = 598

 Score =  745 bits (1924), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 349/596 (58%), Positives = 467/596 (78%), Gaps = 2/596 (0%)

Query: 8   LSRIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVR 67
           +  IRNFSI+AHIDHGKST+ADRFIQ C GL++REM+ QVLD+MD+ERERGITIKAQ+V 
Sbjct: 1   MKNIRNFSIIAHIDHGKSTIADRFIQICGGLSKREMAQQVLDSMDLERERGITIKAQSVS 60

Query: 68  LNYTSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQAI 127
           LNY   + + Y LNLIDTPGHVDF+YEVSRSL+ACEG+LLVVDA+QGVEAQ++AN Y AI
Sbjct: 61  LNYRGRNGEVYHLNLIDTPGHVDFSYEVSRSLAACEGALLVVDASQGVEAQSVANCYTAI 120

Query: 128 DNNHEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERIVQQL 187
           +   E++ VLNK DLPSA+P+RV ++IEE IG+ T DAL VSAKTG+GI  LL  +V ++
Sbjct: 121 EQGLEVVPVLNKIDLPSAEPERVCQEIEEIIGLDTSDALQVSAKTGQGIEELLAALVARV 180

Query: 188 PSPTSPEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVERIG 247
           P P     +  PL+AL+IDSW+++YLGV+ LVR+++G L     I++M T   Y+VE++G
Sbjct: 181 PPPQGDPAS--PLRALIIDSWFDNYLGVISLVRVVDGCLKPKDKIKIMSTGQHYRVEKVG 238

Query: 248 ILTPKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVVFCG 307
           + TPK  ++E L  G +G +IA IK+V    VGDT+T      T ALPGFK ++P VF G
Sbjct: 239 LFTPKRREVEQLPAGSVGYVIAGIKDVDGAPVGDTMTHAERLATKALPGFKDVKPQVFAG 298

Query: 308 LFPVDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERLERE 367
           LFPVD+  +E+LR A+ KLRLNDA+  +E E S ALGFGFRCGFLG+LH+EIIQERLERE
Sbjct: 299 LFPVDSDDYEDLREALAKLRLNDAALFYEPETSQALGFGFRCGFLGMLHMEIIQERLERE 358

Query: 368 FSLNLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEYLGSI 427
           +SLNLI T+P+VVY++    G + ++ NP  +PE  ++AE+REP IQ  I+ P +++G++
Sbjct: 359 YSLNLITTAPTVVYQVLTSKGEVLRIDNPSILPEPGQVAEVREPIIQADILVPQQHVGAV 418

Query: 428 LKLCQERRGIQIDMSHLDNRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDYRDS 487
           + LC+E+RG Q  + +L N+ ++ YELPL+EV+ DF++RLKSVS+GYAS DY+   ++ +
Sbjct: 419 IGLCEEKRGTQKQLQYLGNQVLLNYELPLSEVVLDFFERLKSVSRGYASLDYHFSRFQVA 478

Query: 488 DLVKLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGGRIIA 547
           DLVKL +L+N E +DALS++VHR+ +  RGR + EK++ LIP+Q+F +AIQAAIG  I+A
Sbjct: 479 DLVKLDLLINGERVDALSLIVHRNQAHHRGRELAEKMRELIPRQLFDVAIQAAIGAHIVA 538

Query: 548 RETVKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISILKT 603
           R TVKA RK+VTAKCYGGDITRKRKLLEKQK GKKRM++ G V+IPQ+AF+++LK 
Sbjct: 539 RTTVKALRKNVTAKCYGGDITRKRKLLEKQKAGKKRMKQVGSVEIPQAAFLAVLKV 594


>gi|241888780|ref|ZP_04776086.1| GTP-binding protein LepA [Gemella haemolysans ATCC 10379]
 gi|241864456|gb|EER68832.1| GTP-binding protein LepA [Gemella haemolysans ATCC 10379]
          Length = 605

 Score =  745 bits (1923), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 341/607 (56%), Positives = 478/607 (78%), Gaps = 3/607 (0%)

Query: 1   MQKKPTPLSRIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGIT 60
           M K+     +IRNFSI+AHIDHGKSTLADR ++  + L +REM +Q+LD+MDIERERGIT
Sbjct: 1   MDKRNERQKKIRNFSIIAHIDHGKSTLADRILEKTKALEQREMKAQLLDSMDIERERGIT 60

Query: 61  IKAQTVRLNYTSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTL 120
           IK   V+L YT+ + ++Y  +LIDTPGHVDFTYEVSRSL+ACEG++LVVDA QG+EAQTL
Sbjct: 61  IKLNAVQLQYTAKNGEEYIFHLIDTPGHVDFTYEVSRSLAACEGAILVVDAAQGIEAQTL 120

Query: 121 ANVYQAIDNNHEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLL 180
           ANVY A+DNN EII ++NK DLP+ADP++VK +IE+ IG+ T+D +L SAK G GI  +L
Sbjct: 121 ANVYLALDNNLEIIPIINKIDLPAADPEKVKTEIEDVIGLPTDDIVLASAKAGIGIDEIL 180

Query: 181 ERIVQQLPSPTSPEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAK 240
           E+IV+ +P+P+   G   PL+AL+ DS Y++Y GV+V VRI NG +  G  I++M T   
Sbjct: 181 EQIVEYIPAPSGDAGE--PLQALIFDSLYDAYRGVIVSVRIKNGTVKAGDKIKMMATGGV 238

Query: 241 YQVERIGILTPKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPI 300
           ++V  +GI TPK   ++ L  G++G + ASIK VS TRVGDTIT  ++P   ALPG++ +
Sbjct: 239 FEVTEVGIHTPKEKIVDELTAGDVGFICASIKNVSETRVGDTITLANNPAKEALPGYRKL 298

Query: 301 QPVVFCGLFPVDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEII 360
            P+VFCGL+P+D++++ +LR A+ KL LND++  +E E S ALGFGFRCGFLG+LH+EII
Sbjct: 299 NPMVFCGLYPIDSSKYNDLREALEKLELNDSALQYEAETSQALGFGFRCGFLGMLHMEII 358

Query: 361 QERLEREFSLNLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITP 420
           QER+EREF++++I T+PSV+Y++   DG+M  +SNP +MP+  KI ++ EP+++ +I+ P
Sbjct: 359 QERIEREFNIDIIATAPSVIYKVEKTDGTMVDVSNPSEMPDPQKINKITEPFVKASIMVP 418

Query: 421 NEYLGSILKLCQERRGIQIDMSHLDN-RAMIVYELPLNEVIFDFYDRLKSVSKGYASFDY 479
           N+Y+G+++ LCQ++RGI ++M ++D+ R  I Y++PL+E++FDF+D+LKS +KGYASFDY
Sbjct: 419 NDYVGAVMDLCQKKRGIFLNMEYIDDTRVNITYDIPLSEIVFDFFDQLKSNTKGYASFDY 478

Query: 480 NVIDYRDSDLVKLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQA 539
            +  Y+DS+LVK+ IL+N E +DALS +VHR  + +RG+ I EKLK LIP+Q F+I IQA
Sbjct: 479 ELTGYKDSNLVKMDILLNGEQVDALSFIVHREFAYQRGKVIVEKLKKLIPKQQFEIPIQA 538

Query: 540 AIGGRIIARETVKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFIS 599
           AIG +II+RET+KA RK+V AKCYGGDI+RKRKLLEKQK+GK+RM+  G V++PQ AF++
Sbjct: 539 AIGNKIISRETIKAMRKNVLAKCYGGDISRKRKLLEKQKKGKERMKAVGSVEVPQDAFMA 598

Query: 600 ILKTDNE 606
           +LK D E
Sbjct: 599 VLKMDEE 605


>gi|89101069|ref|ZP_01173908.1| GTP-binding protein LepA [Bacillus sp. NRRL B-14911]
 gi|89084212|gb|EAR63374.1| GTP-binding protein LepA [Bacillus sp. NRRL B-14911]
          Length = 611

 Score =  745 bits (1923), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 337/598 (56%), Positives = 467/598 (78%), Gaps = 3/598 (0%)

Query: 9   SRIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVRL 68
           S+ RNFSI+AHIDHGKSTLADR ++    LT REM  Q+LD+MD+ERERGITIK  +V+L
Sbjct: 11  SKTRNFSIIAHIDHGKSTLADRILERTNALTAREMKDQLLDSMDLERERGITIKLNSVQL 70

Query: 69  NYTSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQAID 128
            Y + D + Y  +LIDTPGHVDFTYEVSRSL+ACEG++LVVDA QG+EAQTLANVY AID
Sbjct: 71  KYKAKDGEIYTFHLIDTPGHVDFTYEVSRSLAACEGAVLVVDAAQGIEAQTLANVYLAID 130

Query: 129 NNHEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERIVQQLP 188
           N+ EI+ V+NK DLPSADP+RV+ +IE+ IG+   +A+L SAK G GI  +LE++V+++P
Sbjct: 131 NDLEIVPVINKIDLPSADPERVRGEIEDVIGLDASEAVLASAKAGIGIEEILEQVVEKVP 190

Query: 189 SPTSPEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVERIGI 248
           +P      +APLKAL+ DS Y++Y GV+  +R++ G +  G  +++M T  +++V  +G+
Sbjct: 191 APQG--DPDAPLKALIFDSLYDAYRGVVAYIRVVEGTVKVGDKVKMMATGKEFEVTEVGV 248

Query: 249 LTPKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVVFCGL 308
            TPK   +  L  G++G + A+IK V  TRVGDTIT   +     LPG++ + P+V+CGL
Sbjct: 249 FTPKSTPLPELSVGDVGFLTAAIKNVGDTRVGDTITSAKNGAAEPLPGYRKLNPMVYCGL 308

Query: 309 FPVDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERLEREF 368
           +P+D+ +F +LR A+ KL LND++  FE E S ALGFGFRCGFLGLLH+EIIQER+EREF
Sbjct: 309 YPIDSARFNDLREALEKLELNDSALQFEPETSQALGFGFRCGFLGLLHMEIIQERIEREF 368

Query: 369 SLNLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEYLGSIL 428
            ++LI T+PSV+Y++ M DG++ K+ NP DMP+  KI  + EP+++ T++ PN+Y+G+I+
Sbjct: 369 KIDLITTAPSVIYDVVMTDGTLLKVDNPSDMPDAQKIDRVEEPYVKATMMAPNDYVGAIM 428

Query: 429 KLCQERRGIQIDMSHLD-NRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDYRDS 487
           +LCQE+RGI IDM ++D  R  IVYE+PL+E+++DF+D+LKS +KGYASFDY +I Y++S
Sbjct: 429 ELCQEKRGIFIDMQYMDETRVSIVYEIPLSEIVYDFFDQLKSSTKGYASFDYELIGYKES 488

Query: 488 DLVKLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGGRIIA 547
            LVK+ IL+N E +DALS +VHR  + +RG+ I EKLK+LIP+Q F++ IQAAIG +I+A
Sbjct: 489 KLVKMDILLNAEKVDALSFIVHRDFAYERGKVIVEKLKDLIPRQQFEVPIQAAIGQKIVA 548

Query: 548 RETVKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISILKTDN 605
           R T+KA RK+V AKCYGGDI+RKRKLLEKQKEGKKRM++ G V++PQ AF+++LK D+
Sbjct: 549 RSTIKAMRKNVLAKCYGGDISRKRKLLEKQKEGKKRMKQVGSVEVPQEAFMAVLKMDD 606


>gi|295399234|ref|ZP_06809216.1| GTP-binding protein LepA [Geobacillus thermoglucosidasius C56-YS93]
 gi|312110164|ref|YP_003988480.1| GTP-binding protein LepA [Geobacillus sp. Y4.1MC1]
 gi|294978700|gb|EFG54296.1| GTP-binding protein LepA [Geobacillus thermoglucosidasius C56-YS93]
 gi|311215265|gb|ADP73869.1| GTP-binding protein LepA [Geobacillus sp. Y4.1MC1]
          Length = 609

 Score =  744 bits (1922), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 338/594 (56%), Positives = 471/594 (79%), Gaps = 3/594 (0%)

Query: 13  NFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVRLNYTS 72
           NFSI+AHIDHGKSTLADR ++    L+EREM  Q+LD+M++ERERGITIK   V+L Y +
Sbjct: 15  NFSIIAHIDHGKSTLADRILEKTGALSEREMKEQMLDSMELERERGITIKLNAVQLKYKA 74

Query: 73  TDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQAIDNNHE 132
            + ++Y  +LIDTPGHVDFTYEVSRSL+ACEG++LVVDA QG+EAQTLANVY A+DN+ E
Sbjct: 75  KNGEEYIFHLIDTPGHVDFTYEVSRSLAACEGAILVVDAAQGIEAQTLANVYLALDNDLE 134

Query: 133 IITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERIVQQLPSPTS 192
           I+ V+NK DLPSADP+RV+++IEE IG+   +A+L SAK G GI  +LE+IV+++P+P+ 
Sbjct: 135 ILPVINKIDLPSADPERVRREIEEVIGLDASEAVLASAKVGIGIEEILEKIVEKIPAPSG 194

Query: 193 PEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVERIGILTPK 252
               +APLKAL+ DS Y+SY GV+  +R+++G +  GQ I++M T  +++V  +G+ TPK
Sbjct: 195 --DPDAPLKALIFDSHYDSYRGVVAYIRVVDGTVKPGQKIKMMSTGKEFEVVEVGVFTPK 252

Query: 253 MIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVVFCGLFPVD 312
              ++ L  G++G + ASIK VS TRVGDTITD  +P T  LPG++ + P+VFCG++P+D
Sbjct: 253 PKQVDELTVGDVGYLTASIKNVSDTRVGDTITDAENPATEPLPGYRKLNPMVFCGMYPID 312

Query: 313 ATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERLEREFSLNL 372
             ++ +LR A+ KL+LNDA+  FE E S ALGFGFRCGFLGLLH+EIIQER+EREF+++L
Sbjct: 313 TARYNDLREALEKLQLNDAALHFEPETSQALGFGFRCGFLGLLHMEIIQERIEREFNIDL 372

Query: 373 IGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEYLGSILKLCQ 432
           I T+PSVVY++++ DG+  ++ NP +MPE  KI  + EP+++ TI+ PN+Y+G +++LCQ
Sbjct: 373 ITTAPSVVYKVFLTDGTEVQVDNPSNMPEPQKIDHIEEPYVKATIMVPNDYVGPVMELCQ 432

Query: 433 ERRGIQIDMSHLD-NRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDYRDSDLVK 491
            +RG  +DM +LD  R  ++YE+PL+E+++DF+D LKS +KGYASFDY +I Y+ S+LVK
Sbjct: 433 GKRGNFVDMQYLDEKRVTLIYEIPLSEIVYDFFDTLKSSTKGYASFDYELIGYKPSNLVK 492

Query: 492 LTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGGRIIARETV 551
           + IL+N E IDALS +VHR  + +RG+ I EKLK+LIP+Q F++ +QAAIG +IIAR T+
Sbjct: 493 MDILLNGEKIDALSFIVHRDSAYERGKVIVEKLKDLIPRQQFEVPVQAAIGNKIIARSTI 552

Query: 552 KARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISILKTDN 605
           KA RK+V AKCYGGD++RKRKLLEKQKEGKKRM++ G V++PQ AF++ILK D+
Sbjct: 553 KALRKNVLAKCYGGDVSRKRKLLEKQKEGKKRMKQIGSVEVPQEAFMAILKIDD 606


>gi|261418474|ref|YP_003252156.1| GTP-binding protein LepA [Geobacillus sp. Y412MC61]
 gi|319767565|ref|YP_004133066.1| GTP-binding protein LepA [Geobacillus sp. Y412MC52]
 gi|261374931|gb|ACX77674.1| GTP-binding protein LepA [Geobacillus sp. Y412MC61]
 gi|317112431|gb|ADU94923.1| GTP-binding protein LepA [Geobacillus sp. Y412MC52]
          Length = 609

 Score =  744 bits (1922), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 337/598 (56%), Positives = 468/598 (78%), Gaps = 3/598 (0%)

Query: 10  RIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVRLN 69
           RIRNFSI+AHIDHGKSTLADR ++    L+ERE+  Q LD M++ERERGITIK   V+L 
Sbjct: 12  RIRNFSIIAHIDHGKSTLADRILEKTGALSERELREQTLDTMELERERGITIKLNAVQLT 71

Query: 70  YTSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQAIDN 129
           Y + + ++Y  +LIDTPGHVDFTYEVSRSL+ACEG++LVVDA QG+EAQTLANVY AIDN
Sbjct: 72  YKAKNGEEYIFHLIDTPGHVDFTYEVSRSLAACEGAILVVDAAQGIEAQTLANVYLAIDN 131

Query: 130 NHEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERIVQQLPS 189
           N EI+ V+NK DLPSA+P+RV+++IE+ IG+   DA+L SAK G GI  +LE+IV+++P+
Sbjct: 132 NLEILPVINKIDLPSAEPERVRQEIEDVIGLDASDAVLASAKVGIGIEEILEKIVEKIPA 191

Query: 190 PTSPEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVERIGIL 249
           P+     +APLKAL+ DS Y+ Y GV+  VR+++G +  GQ I++M T  +++V  +G+ 
Sbjct: 192 PSG--DPDAPLKALIFDSLYDPYRGVVAYVRVVDGTVKPGQRIKMMSTGKEFEVTEVGVF 249

Query: 250 TPKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVVFCGLF 309
           TPK   ++ L  G++G + ASIK V  TRVGDTITD   P    LPG++ + P+VFCG++
Sbjct: 250 TPKQKVVDELTVGDVGYLTASIKNVKDTRVGDTITDAERPAAEPLPGYRKLNPMVFCGMY 309

Query: 310 PVDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERLEREFS 369
           P+D  ++ +LR A+ KL+LNDA+  FE E S ALGFGFRCGFLGLLH+EI+QERLEREF 
Sbjct: 310 PIDTARYNDLREALEKLQLNDAALHFEPETSQALGFGFRCGFLGLLHMEILQERLEREFH 369

Query: 370 LNLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEYLGSILK 429
           ++LI T+PSVVY++++ DG+   + NP +MP+  KI  + EP+++ TI+ PN+Y+G +++
Sbjct: 370 IDLITTAPSVVYKVHLTDGTEVDVDNPTNMPDPQKIDRIEEPYVKATIMVPNDYVGPVME 429

Query: 430 LCQERRGIQIDMSHLD-NRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDYRDSD 488
           LCQ +RG  +DM +LD  R M++Y++PL+E+++DF+D LKS +KGYASFDY +I YR S+
Sbjct: 430 LCQGKRGTFVDMQYLDEKRVMLIYDIPLSEIVYDFFDALKSNTKGYASFDYELIGYRPSN 489

Query: 489 LVKLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGGRIIAR 548
           LVK+ IL+N E IDALS +VHR  + +RG+ I EKLK+LIP+Q F++ +QAAIG ++IAR
Sbjct: 490 LVKMDILLNGEKIDALSFIVHRDSAYERGKAIVEKLKDLIPRQQFEVPVQAAIGNKVIAR 549

Query: 549 ETVKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISILKTDNE 606
            T+KA RK+V AKCYGGD++RKRKLLEKQKEGKKRM++ G V++PQ AF+++LK D++
Sbjct: 550 STIKALRKNVLAKCYGGDVSRKRKLLEKQKEGKKRMKQIGSVEVPQEAFMAVLKIDDQ 607


>gi|251770937|gb|EES51522.1| GTP-binding protein LepA [Leptospirillum ferrodiazotrophum]
          Length = 606

 Score =  744 bits (1921), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 349/597 (58%), Positives = 465/597 (77%), Gaps = 3/597 (0%)

Query: 7   PLSRIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTV 66
           P+ RIRNF I+AHIDHGKSTLADR +     +++RE   Q+LD MD+ERERGITIKA  V
Sbjct: 4   PIERIRNFCIIAHIDHGKSTLADRLLDLTGAVSKRESREQILDAMDLERERGITIKAHNV 63

Query: 67  RLNYTSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQA 126
           RLNY + D +DY LNLIDTPGHVDFTYEVSRSL+ACEG+LLVVDA+QGVEAQT+AN Y A
Sbjct: 64  RLNYRAKDGQDYLLNLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGVEAQTIANAYLA 123

Query: 127 IDNNHEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERIVQQ 186
           ++N+  +I V+NK DLP AD  R K+QIE+ +G+  E+A+L+SAK G GI  +LE IV +
Sbjct: 124 LENDVHMIPVINKIDLPGADIPRAKEQIEDAVGLDAEEAILISAKEGIGITDVLEAIVTR 183

Query: 187 LPSPTSPEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVERI 246
           +P P+     +APL+ALL DSW++ YLG ++LVR+ +G++  G+SIRL+ T   + V  +
Sbjct: 184 VPPPSGDR--SAPLRALLFDSWFDVYLGAVILVRVFDGEIRPGKSIRLLSTGKDHPVLSV 241

Query: 247 GILTPKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVVFC 306
           G  TPK +D+ +L  GE+G ++  IK V  T +GDT+ D  +   +  PGF+  +P+VFC
Sbjct: 242 GAFTPKRVDLPSLSAGEVGFVVTGIKSVRETPIGDTLADAGNTQITPYPGFQETKPMVFC 301

Query: 307 GLFPVDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERLER 366
           GLFP D+ Q+E+L+ A++KLR+NDASF+FE+E+S ALGFGFRCGFLGLLH+EI+QERLER
Sbjct: 302 GLFPTDSDQYEDLKEALDKLRMNDASFTFEMESSLALGFGFRCGFLGLLHMEIVQERLER 361

Query: 367 EFSLNLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEYLGS 426
           EFSL+LI T+P+VVY++ +  G    + NP D+P VT+I  + EP+I  ++  P EYLG 
Sbjct: 362 EFSLSLISTAPTVVYQVRLTSGEEVTVVNPADLPPVTQIDTIFEPFILGSLYMPTEYLGP 421

Query: 427 ILKLCQERRGIQIDMSHLDNRAMIV-YELPLNEVIFDFYDRLKSVSKGYASFDYNVIDYR 485
           ++ LCQERRGIQ ++ +LD+R + V YELPLNEV+ DFYDRLKS+SKGYASFDY  +D R
Sbjct: 422 VMTLCQERRGIQRELRYLDSRRVQVQYELPLNEVVLDFYDRLKSLSKGYASFDYEWLDTR 481

Query: 486 DSDLVKLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGGRI 545
            ++L K+ +LV+ E +DALS +VH+  +  RGR + EKLK +IP+QMF++AIQAAIG RI
Sbjct: 482 PAELEKVDVLVSGERVDALSFIVHKDRAYSRGRLLVEKLKEVIPRQMFEVAIQAAIGSRI 541

Query: 546 IARETVKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISILK 602
           IARET+ A RK+V AKCYGGDITRKRKLLEKQKEGKKRM++ GRV++PQ AF+++L+
Sbjct: 542 IARETIGAMRKNVLAKCYGGDITRKRKLLEKQKEGKKRMKQIGRVEVPQEAFMAVLR 598


>gi|317495801|ref|ZP_07954164.1| GTP-binding protein LepA [Gemella moribillum M424]
 gi|316913978|gb|EFV35461.1| GTP-binding protein LepA [Gemella moribillum M424]
          Length = 605

 Score =  744 bits (1921), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 342/607 (56%), Positives = 480/607 (79%), Gaps = 3/607 (0%)

Query: 1   MQKKPTPLSRIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGIT 60
           M K+     +IRNFSI+AHIDHGKSTLADR ++    L +REM +Q+LD+MDIERERGIT
Sbjct: 1   MNKRNERQKKIRNFSIIAHIDHGKSTLADRILEKTGALEQREMKAQLLDSMDIERERGIT 60

Query: 61  IKAQTVRLNYTSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTL 120
           IK   V+L YT+ + ++Y L+LIDTPGHVDFTYEVSRSL+ACEG++LVVDA QG+EAQTL
Sbjct: 61  IKLNAVQLKYTAKNGEEYILHLIDTPGHVDFTYEVSRSLAACEGAILVVDAAQGIEAQTL 120

Query: 121 ANVYQAIDNNHEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLL 180
           ANVY A+DNN EII ++NK DLP+ADP++VK +IE+ IG+ T+D +L SAK G GI  +L
Sbjct: 121 ANVYLALDNNLEIIPIINKIDLPAADPEKVKTEIEDIIGLPTDDIVLASAKAGIGIDEIL 180

Query: 181 ERIVQQLPSPTSPEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAK 240
           E+IV+ +P+P+   G   PL+AL+ DS Y++Y GV+V VRI NG +  G  I++M T   
Sbjct: 181 EQIVEYIPAPSGDAGE--PLQALIFDSLYDAYRGVIVSVRIKNGTVKAGDKIKMMATGGV 238

Query: 241 YQVERIGILTPKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPI 300
           ++V  +GI TPK   ++ L  G++G + ASIK VS TRVGDTIT  ++P   ALPG++ +
Sbjct: 239 FEVTEVGIHTPKEKIVDELTVGDVGFICASIKNVSETRVGDTITLANNPAKEALPGYRKL 298

Query: 301 QPVVFCGLFPVDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEII 360
            P+VFCGL+P+D++++ +LR A+ KL LND++  +E E S ALGFGFRCGFLG+LH+EII
Sbjct: 299 NPMVFCGLYPIDSSKYNDLREALEKLELNDSALQYEAETSQALGFGFRCGFLGMLHMEII 358

Query: 361 QERLEREFSLNLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITP 420
           QER+EREF++++I T+PSV+Y++   DG+M  +SNP +MP+  KI ++ EP+++ +I+ P
Sbjct: 359 QERIEREFNIDIIATAPSVIYKVEKTDGTMVDVSNPSEMPDPQKINKITEPFVKASIMVP 418

Query: 421 NEYLGSILKLCQERRGIQIDMSHLDN-RAMIVYELPLNEVIFDFYDRLKSVSKGYASFDY 479
           N+Y+G++++LCQ++RGI ++M ++D+ R  I Y++PL+E++FDF+D+LKS +KGYASFDY
Sbjct: 419 NDYVGAVIELCQKKRGIFLNMEYIDDTRVNITYDIPLSEIVFDFFDQLKSNTKGYASFDY 478

Query: 480 NVIDYRDSDLVKLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQA 539
            +  Y+DS+LVK+ IL+N E +DALS +VHR  + +RG+ I EKLK LIP+Q F+I IQA
Sbjct: 479 ELTGYKDSNLVKMDILLNGEQVDALSFIVHREFAYQRGKVIVEKLKKLIPKQQFEIPIQA 538

Query: 540 AIGGRIIARETVKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFIS 599
           AIG +II+RET+KA RK+V AKCYGGDI+RKRKLLEKQK+GK+RM+  G V++PQ AF++
Sbjct: 539 AIGNKIISRETIKAMRKNVLAKCYGGDISRKRKLLEKQKKGKERMKAVGSVEVPQDAFMA 598

Query: 600 ILKTDNE 606
           +LK D+E
Sbjct: 599 VLKMDDE 605


>gi|332970853|gb|EGK09831.1| GTP-binding protein LepA [Kingella kingae ATCC 23330]
          Length = 597

 Score =  744 bits (1920), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 346/596 (58%), Positives = 466/596 (78%), Gaps = 4/596 (0%)

Query: 8   LSRIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVR 67
           +  IRNFSI+AHIDHGKSTLADRFIQ+C GL  REMS+QVLD+MDIE+ERGITIKAQT  
Sbjct: 1   MKNIRNFSIIAHIDHGKSTLADRFIQYCGGLDLREMSTQVLDSMDIEKERGITIKAQTAA 60

Query: 68  LNYTSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQAI 127
           LNY + + + YQLNLIDTPGHVDF+YEVSRSLSACEG+LLVVDA+QGVEAQT+AN Y AI
Sbjct: 61  LNYKAKNGEIYQLNLIDTPGHVDFSYEVSRSLSACEGALLVVDASQGVEAQTVANCYTAI 120

Query: 128 DNNHEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERIVQQL 187
           D   E++ VLNK DLP+ADPDRV ++IE+ IGI    A+  SAK+G G+  +LE IV ++
Sbjct: 121 DLGVEVVPVLNKIDLPAADPDRVSQEIEDIIGIDAVGAVTCSAKSGLGVEDVLEEIVAKI 180

Query: 188 PSPTSPEG-ANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVERI 246
           P+P   EG +NAPL+A++IDSW+++Y+GV++L+R+ NG +     ++ M T A+ QVE++
Sbjct: 181 PAP---EGDSNAPLQAVIIDSWFDNYVGVVMLIRVKNGTIKLKDKVQFMATKAETQVEQL 237

Query: 247 GILTPKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVVFC 306
           G+ TPK +  + L  GE+G +I  +KE+   +VGDT+T  ++P  + L GFK +Q  VF 
Sbjct: 238 GVFTPKSVQKQQLSAGEVGFLITGVKELGSAKVGDTVTLANNPAVAPLAGFKEVQSQVFA 297

Query: 307 GLFPVDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERLER 366
           GL+PV++  +ENLR A+ KL+LNDAS  FE E S ALGFGFRCGFLGLLHLEI+QERLER
Sbjct: 298 GLYPVESHDYENLRDALEKLQLNDASLKFEPEVSQALGFGFRCGFLGLLHLEIVQERLER 357

Query: 367 EFSLNLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEYLGS 426
           EF ++LI T+P+VVY++ + +G   ++ NP  +P++  I  + EP I  TI+ P +Y+G+
Sbjct: 358 EFDMDLITTAPTVVYDVVLKNGEKIEVENPSKLPDIATIDTILEPIITATILVPQDYVGN 417

Query: 427 ILKLCQERRGIQIDMSHLDNRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDYRD 486
           ++ LC ++RG+Q +M +L  + M+ Y+LP+NEV+ DF+D+LKS S+GYAS DY   +++ 
Sbjct: 418 VMTLCNQKRGVQRNMQYLGRQVMLTYDLPMNEVVMDFFDKLKSTSRGYASLDYEFKEFQP 477

Query: 487 SDLVKLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGGRII 546
           SDLVKL I+VN + +DALS++VHR  S +RGR +  K++ LIP+QMF IA+QAAIGG+II
Sbjct: 478 SDLVKLDIMVNGDKVDALSLIVHRQTSVQRGRELASKMRELIPRQMFDIAVQAAIGGQII 537

Query: 547 ARETVKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISILK 602
           ARE VKA RK+V AKCYGGDITRK+KLLEKQK GKKRM++ G V+IPQSAF++IL+
Sbjct: 538 ARENVKALRKNVLAKCYGGDITRKKKLLEKQKAGKKRMKQVGNVEIPQSAFLAILE 593


>gi|134300340|ref|YP_001113836.1| GTP-binding protein LepA [Desulfotomaculum reducens MI-1]
 gi|172044333|sp|A4J7F8|LEPA_DESRM RecName: Full=Elongation factor 4; Short=EF-4; AltName:
           Full=Ribosomal back-translocase LepA
 gi|134053040|gb|ABO51011.1| GTP-binding protein LepA [Desulfotomaculum reducens MI-1]
          Length = 601

 Score =  744 bits (1920), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 343/600 (57%), Positives = 468/600 (78%), Gaps = 3/600 (0%)

Query: 6   TPLSRIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQT 65
           TP +RIRNF I+AHIDHGKSTLADR ++    L++REM+ QVLD MD+ERERGITIK Q 
Sbjct: 3   TPQNRIRNFCIIAHIDHGKSTLADRILEETGALSQREMTEQVLDKMDLERERGITIKLQA 62

Query: 66  VRLNYTSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQ 125
           VRL + + D ++YQLNLIDTPGHVDFTYEVSRSL+ACEG+LLVVDA+QG+EAQTLANVY 
Sbjct: 63  VRLFHRAEDGQEYQLNLIDTPGHVDFTYEVSRSLAACEGALLVVDASQGIEAQTLANVYL 122

Query: 126 AIDNNHEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERIVQ 185
           A++N+ EII V+NK DLPSA+P+RVK++IE+ IG+ T +A+L SAKTG GI  +LE++V 
Sbjct: 123 ALENDLEIIPVINKIDLPSAEPERVKQEIEDVIGLDTSEAVLASAKTGAGIKEILEQVVT 182

Query: 186 QLPSPTSPEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVER 245
           ++  P     + APL+AL+ DS Y++Y GV+  +R++ G L  G  IR+M T  +++V  
Sbjct: 183 KIAPPKG--DSEAPLQALIFDSHYDAYRGVIAYIRVVQGTLKPGMRIRMMATKKEFEVTE 240

Query: 246 IGILTPKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVVF 305
           +G+ TP M  ++ L  GE+G++ AS+K V   RVGDTIT   +P  + LPG++ + P+VF
Sbjct: 241 VGVFTPHMTFVDELKTGEVGLVAASMKNVQDVRVGDTITAAQNPAPAPLPGYRKVTPMVF 300

Query: 306 CGLFPVDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERLE 365
           CGL+PVD   +E+LR A++KL+LNDAS  +E E S ALGFGFRCGFLGLLH+EIIQERLE
Sbjct: 301 CGLYPVDTVDYEDLRDALDKLKLNDASLIYEPETSDALGFGFRCGFLGLLHMEIIQERLE 360

Query: 366 REFSLNLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEYLG 425
           RE+ L+LI T+PSVVY +    G + ++ NP ++P+V KI  + EP+++ T++ P +++G
Sbjct: 361 REYGLSLITTAPSVVYRVTTTKGEVMEIDNPANLPQVNKIEIIEEPFVKATVMVPKDFVG 420

Query: 426 SILKLCQERRGIQIDMSHLD-NRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDY 484
           +++ LCQ +RGI  +M +L  NR M+ YE+PL+E+I+DF+D+LKS +KGYAS DY +I Y
Sbjct: 421 TVMDLCQGKRGIFSNMEYLGINRVMLTYEIPLSEIIYDFFDQLKSRTKGYASLDYEMIGY 480

Query: 485 RDSDLVKLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGGR 544
           R S+LVK+ I++N E +DALS +VH   +  RGR + EKL++LIP+QMF+I +QAAIG +
Sbjct: 481 RQSELVKMDIMLNGEVLDALSCIVHSERAYTRGRALVEKLRSLIPRQMFEIPVQAAIGNK 540

Query: 545 IIARETVKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISILKTD 604
           IIARETVKA RKDV AKCYGGDI+RKRKLLEKQKEGK+RM++ G V+IPQ AF+++L  +
Sbjct: 541 IIARETVKAMRKDVLAKCYGGDISRKRKLLEKQKEGKRRMKQVGNVEIPQEAFMAVLSIE 600


>gi|304437687|ref|ZP_07397639.1| GTP-binding protein LepA [Selenomonas sp. oral taxon 149 str.
           67H29BP]
 gi|304369320|gb|EFM22993.1| GTP-binding protein LepA [Selenomonas sp. oral taxon 149 str.
           67H29BP]
          Length = 599

 Score =  744 bits (1920), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 345/597 (57%), Positives = 467/597 (78%), Gaps = 5/597 (0%)

Query: 11  IRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVRLNY 70
           IRNFSI+AHIDHGKST+ADR I++   L+EREM +QVLD+MD+ERERGITIKAQTVRL+Y
Sbjct: 6   IRNFSIIAHIDHGKSTIADRLIEYTGTLSEREMEAQVLDSMDLERERGITIKAQTVRLDY 65

Query: 71  TSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQAIDNN 130
              D + Y+LNLIDTPGHVDF YEVSRSL+ACEG+LLVVDA QGVEAQTLANVY A++++
Sbjct: 66  RGEDGELYELNLIDTPGHVDFNYEVSRSLAACEGALLVVDAAQGVEAQTLANVYLALEHD 125

Query: 131 HEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERIVQQLPSP 190
            EI+ V+NK DLPSA+P+RVK++IE++IG+ T  A+L SAKTG GI  +L+ +V  +P P
Sbjct: 126 LEIVPVINKIDLPSAEPERVKEEIEDSIGLDTSAAVLASAKTGIGIKEILDAVVAYIPPP 185

Query: 191 TSPEG-ANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVERIGIL 249
              EG A+APL+AL+ DS++++Y GV+  VR+  G + KG  ++LM T   ++V  +G  
Sbjct: 186 ---EGDADAPLRALIFDSYFDAYKGVIAHVRVKEGVIQKGMKLKLMATGKTFEVTDVGCF 242

Query: 250 TPKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVVFCGLF 309
            P+ +D   L  GE+G +  ++K+V   RVGDT+T    PT  ALPG++ + P+VFCGL+
Sbjct: 243 RPRPVDTGELRTGEVGFIAGALKDVRDVRVGDTVTGAERPTAEALPGYRGVTPMVFCGLY 302

Query: 310 PVDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERLEREFS 369
           P D+  ++NLR A+ KL+LNDA+  FE E S ALGFGFRCGFLGLLH+++IQERLERE++
Sbjct: 303 PEDSKDYDNLREALEKLQLNDAALVFEPETSIALGFGFRCGFLGLLHMDVIQERLEREYN 362

Query: 370 LNLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEYLGSILK 429
           L LI T+PSVVY +Y  DG+M+++SNP D+P  T+I  + EP ++ T+I P +Y+G++++
Sbjct: 363 LGLIMTAPSVVYHVYRTDGTMREVSNPADLPPATEIEHIEEPCVKATVIVPKDYVGAVME 422

Query: 430 LCQERRGIQIDMSHLD-NRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDYRDSD 488
           + QE+RG+   M +LD  R  ++Y +PLNE+++D++DRLKS ++GYAS DY +IDY+ S+
Sbjct: 423 ISQEKRGVFQTMDYLDATRVTVIYHIPLNEILYDYFDRLKSATRGYASLDYELIDYQTSN 482

Query: 489 LVKLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGGRIIAR 548
           LVKL IL+N + +DALS +VHR  +  RGR +  KLK +IPQQMF+I IQAAIG +IIAR
Sbjct: 483 LVKLDILLNGDPVDALSTIVHRDRAAARGRQLAAKLKEIIPQQMFEIPIQAAIGSKIIAR 542

Query: 549 ETVKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISILKTDN 605
           E V+ARRKDV AKCYGGDITRKRKLLEKQKEGKKRM+  G V++PQ AF+++LK D+
Sbjct: 543 ENVRARRKDVLAKCYGGDITRKRKLLEKQKEGKKRMKAVGSVELPQEAFMAVLKIDD 599


>gi|108761403|ref|YP_631702.1| GTP-binding protein LepA [Myxococcus xanthus DK 1622]
 gi|119371370|sp|Q1D6M1|LEPA_MYXXD RecName: Full=Elongation factor 4; Short=EF-4; AltName:
           Full=Ribosomal back-translocase LepA
 gi|108465283|gb|ABF90468.1| GTP-binding protein LepA [Myxococcus xanthus DK 1622]
          Length = 603

 Score =  743 bits (1919), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 349/604 (57%), Positives = 461/604 (76%), Gaps = 5/604 (0%)

Query: 5   PTPLSRIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQ 64
           P   + IRNF I+AHIDHGKSTLADR +     LT+RE  +Q LDNM IERERGITIKAQ
Sbjct: 2   PAENAHIRNFCIIAHIDHGKSTLADRLLDKTGTLTKREAQAQFLDNMAIERERGITIKAQ 61

Query: 65  TVRLNYTSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVY 124
           +VR+NYT+ D K Y LNLIDTPGHVDF YEVSRSL+ACEG+LLVVDATQGVEAQTL+NVY
Sbjct: 62  SVRMNYTAKDGKQYVLNLIDTPGHVDFAYEVSRSLAACEGALLVVDATQGVEAQTLSNVY 121

Query: 125 QAIDNNHEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERIV 184
            A+D+N EII V+NK DLPSAD DR + +IE+ IGI    A+  SAK G GI  +LE +V
Sbjct: 122 MALDHNLEIIPVINKIDLPSADVDRTRAEIEDVIGIDASVAVPCSAKEGIGIQDILESVV 181

Query: 185 QQLPSPTSPEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVE 244
           Q +P P+    A+APLKAL+ DSWY++Y GV+ LVR++ G L   Q I+L   N  ++V+
Sbjct: 182 QNVPPPSG--SADAPLKALIFDSWYDNYRGVVTLVRVLEGTLKLKQKIKLFSNNKVFEVQ 239

Query: 245 RIGILTPKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVV 304
            +G+ +P    +  L  GE+GV++A++KE+   +VGDT+T++S PT    PGF+ ++P+V
Sbjct: 240 ELGVFSPFSRPVPQLIAGEVGVLVANVKELQDAKVGDTVTEESRPTAEPFPGFQEVKPMV 299

Query: 305 FCGLFPVDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERL 364
           F G+FPVD+  +ENLR A+ KL LND++F++E E+STALGFGFRCG+LGLLH+EI+QERL
Sbjct: 300 FSGIFPVDSADYENLRDALAKLVLNDSAFTYEPESSTALGFGFRCGYLGLLHMEIVQERL 359

Query: 365 EREFSLNLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEYL 424
           ERE++LNLI T+PSVVY +    G    + NP  +P V  I +  EP +   I  PN++L
Sbjct: 360 EREYNLNLITTAPSVVYRITTSKGETLLVDNPAKLPPVQHIEKFEEPILTCHIHVPNDHL 419

Query: 425 GSILKLCQERRGIQIDMSHLDN---RAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNV 481
           G+ILKLCQERRG+Q DM +L +   R  + YE+PL EV+FDF+D+LKSVS+GYAS DY +
Sbjct: 420 GAILKLCQERRGVQKDMKYLGSSGQRVQVTYEMPLAEVVFDFFDKLKSVSRGYASLDYEL 479

Query: 482 IDYRDSDLVKLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAI 541
             Y +SDL +L IL+N + +DALS++VHR  +  RGR +C+KLK +IP+QM+++AIQAAI
Sbjct: 480 AGYIESDLARLDILINGDPVDALSVIVHRERAYLRGREVCQKLKEVIPKQMYEVAIQAAI 539

Query: 542 GGRIIARETVKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISIL 601
           G +II+RET+ A RK+V AKCYGGDI+RKRKLLEKQKEGKKRM++ G V+IPQ AF+++L
Sbjct: 540 GAKIISRETISAIRKNVLAKCYGGDISRKRKLLEKQKEGKKRMKQVGTVEIPQEAFLAVL 599

Query: 602 KTDN 605
           K++ 
Sbjct: 600 KSEQ 603


>gi|16079605|ref|NP_390429.1| GTP-binding protein LepA [Bacillus subtilis subsp. subtilis str.
           168]
 gi|221310475|ref|ZP_03592322.1| GTP-binding protein LepA [Bacillus subtilis subsp. subtilis str.
           168]
 gi|221314799|ref|ZP_03596604.1| GTP-binding protein LepA [Bacillus subtilis subsp. subtilis str.
           NCIB 3610]
 gi|221319721|ref|ZP_03601015.1| GTP-binding protein LepA [Bacillus subtilis subsp. subtilis str.
           JH642]
 gi|221323999|ref|ZP_03605293.1| GTP-binding protein LepA [Bacillus subtilis subsp. subtilis str.
           SMY]
 gi|321312035|ref|YP_004204322.1| GTP-binding protein LepA [Bacillus subtilis BSn5]
 gi|1708794|sp|P37949|LEPA_BACSU RecName: Full=Elongation factor 4; Short=EF-4; AltName:
           Full=Ribosomal back-translocase LepA
 gi|1122398|emb|CAA62842.1| lepA [Bacillus subtilis subsp. subtilis str. 168]
 gi|1303804|dbj|BAA12460.1| YqeQ [Bacillus subtilis]
 gi|2634997|emb|CAB14493.1| ribosomal elongation factor, GTPase [Bacillus subtilis subsp.
           subtilis str. 168]
 gi|291484999|dbj|BAI86074.1| GTP-binding protein LepA [Bacillus subtilis subsp. natto BEST195]
 gi|320018309|gb|ADV93295.1| GTP-binding protein LepA [Bacillus subtilis BSn5]
          Length = 612

 Score =  743 bits (1919), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 335/599 (55%), Positives = 470/599 (78%), Gaps = 5/599 (0%)

Query: 9   SRIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVRL 68
           SRIRNFSI+AHIDHGKSTLADR ++    +T+REM  Q+LD+MD+ERERGITIK  +V+L
Sbjct: 12  SRIRNFSIIAHIDHGKSTLADRILEKTSAITQREMKEQLLDSMDLERERGITIKLNSVQL 71

Query: 69  NYTSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQAID 128
            Y + D ++Y  +LIDTPGHVDFTYEVSRSL+ACEG++LVVDA QG+EAQTLANVY A+D
Sbjct: 72  KYKAKDGEEYIFHLIDTPGHVDFTYEVSRSLAACEGAILVVDAAQGIEAQTLANVYLALD 131

Query: 129 NNHEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERIVQQLP 188
           N+ EI+ V+NK DLPSA+P+RV++++E+ IG+   +A+L SAK G GI  +LE+IV+++P
Sbjct: 132 NDLEILPVINKIDLPSAEPERVRQEVEDVIGLDASEAVLASAKAGIGIEEILEQIVEKVP 191

Query: 189 SPTS-PEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVERIG 247
           +PT  PE   APLKAL+ DS Y++Y GV+  +R++ G +  GQ I++M T  +++V  +G
Sbjct: 192 APTGDPE---APLKALIFDSLYDAYRGVVAYIRVVEGTVKPGQKIKMMATGKEFEVTEVG 248

Query: 248 ILTPKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVVFCG 307
           + TPK      L  G++G + ASIK V  TRVGDTIT  ++P   ALPG++ + P+V+CG
Sbjct: 249 VFTPKATPTNELTVGDVGFLTASIKNVGDTRVGDTITSAANPAEEALPGYRKLNPMVYCG 308

Query: 308 LFPVDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERLERE 367
           L+P+D  ++ +LR A+ KL LND+S  +E E S ALGFGFRCGFLG+LH+EIIQER+ERE
Sbjct: 309 LYPIDTAKYNDLREALEKLELNDSSLQYEAETSQALGFGFRCGFLGMLHMEIIQERIERE 368

Query: 368 FSLNLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEYLGSI 427
           F+++LI T+PSV+Y++YM DG    + NP +MP+  KI  + EP+++ T++ PN+Y+G++
Sbjct: 369 FNIDLITTAPSVIYDVYMTDGEKVVVDNPSNMPDPQKIERVEEPYVKATMMVPNDYVGAV 428

Query: 428 LKLCQERRGIQIDMSHLD-NRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDYRD 486
           ++LCQ +RG  IDM +LD NR  I+Y++PL E++++F+D+LKS +KGYASFDY +I Y+ 
Sbjct: 429 MELCQGKRGNFIDMQYLDANRVSIIYDMPLAEIVYEFFDQLKSSTKGYASFDYELIGYKP 488

Query: 487 SDLVKLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGGRII 546
           S LVK+ I++N E IDALS +VHR  + +RG+ I EKLK LIP+Q F++ +QAAIG +I+
Sbjct: 489 SKLVKMDIMLNGEKIDALSFIVHRDYAYERGKVIVEKLKELIPRQQFEVPVQAAIGQKIV 548

Query: 547 ARETVKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISILKTDN 605
           AR T+KA RK+V AKCYGGDI+RKRKLLEKQKEGK+RM++ G V++PQ AF+++LK D+
Sbjct: 549 ARSTIKAMRKNVLAKCYGGDISRKRKLLEKQKEGKRRMKQVGSVEVPQEAFMAVLKMDD 607


>gi|15613905|ref|NP_242208.1| GTP-binding protein LepA [Bacillus halodurans C-125]
 gi|20138760|sp|Q9KD76|LEPA_BACHD RecName: Full=Elongation factor 4; Short=EF-4; AltName:
           Full=Ribosomal back-translocase LepA
 gi|10173958|dbj|BAB05061.1| GTP-binding protein (elongation factor family) [Bacillus halodurans
           C-125]
          Length = 609

 Score =  743 bits (1919), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 341/598 (57%), Positives = 469/598 (78%), Gaps = 5/598 (0%)

Query: 9   SRIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVRL 68
           SRIRNFSI+AHIDHGKSTLADR ++    LT+REM  Q+LD MD+ERERGITIK   V+L
Sbjct: 11  SRIRNFSIIAHIDHGKSTLADRILEKTSALTQREMKDQMLDAMDLERERGITIKLNAVQL 70

Query: 69  NYTSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQAID 128
            Y + D  +Y  +LIDTPGHVDF+YEVSRSL+ACEG+LL+VDA QG+EAQTLANVY A+D
Sbjct: 71  VYKANDGNEYIFHLIDTPGHVDFSYEVSRSLAACEGALLIVDAAQGIEAQTLANVYLALD 130

Query: 129 NNHEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERIVQQLP 188
           N+ EI+ V+NK DLPSA+P+RV++++E+ IG+   +A+L SAK G GI  +LE+IV+++P
Sbjct: 131 NDLEILPVINKIDLPSAEPERVRQEVEDVIGLDASEAVLASAKNGIGIEEILEQIVEKVP 190

Query: 189 SPTS-PEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVERIG 247
           +P+  PEG   PLKAL+ DS Y+SY GV+  +RI+ G +  GQ I++M T  +++V  +G
Sbjct: 191 APSGDPEG---PLKALIFDSLYDSYRGVVAYIRIVEGSVKPGQKIKMMATGKEFEVTEVG 247

Query: 248 ILTPKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVVFCG 307
           + TPK    E L  G++G + ASIK V  TRVGDTIT  ++P    LPG++ + P+V+CG
Sbjct: 248 VFTPKPEKREELTVGDVGFLTASIKNVGDTRVGDTITSANNPADEPLPGYRRMNPMVYCG 307

Query: 308 LFPVDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERLERE 367
           L+PVD   + +LR A+ +L LNDAS  +E E S ALGFGFRCGFLGLLH+EIIQER+ERE
Sbjct: 308 LYPVDTNDYNDLREALERLELNDASLQYEPETSQALGFGFRCGFLGLLHMEIIQERIERE 367

Query: 368 FSLNLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEYLGSI 427
           F ++LI T+PSVVY + + +G +Q++ NP +MP+  KI E+ EP+++ TI+ PN+++G++
Sbjct: 368 FGIDLITTAPSVVYSVQLTNGEVQQIDNPSNMPDRQKIEEVEEPYVKATIMVPNDFVGAV 427

Query: 428 LKLCQERRGIQIDMSHLD-NRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDYRD 486
           ++LCQ +RGI IDM +LD NR  I+YE+PL+E+++DF+D+LKS +KGYASFDY +I Y+ 
Sbjct: 428 MELCQGKRGIFIDMQYLDENRVQIIYEIPLSEIVYDFFDQLKSNTKGYASFDYELIGYKP 487

Query: 487 SDLVKLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGGRII 546
           S+LVK+ IL+N E +DALS++VHR  + +RG+ I EKLK LIP+Q F++ +QA+IG +II
Sbjct: 488 SNLVKMDILLNGEVVDALSVIVHRDSAYERGKQIVEKLKELIPRQQFEVPVQASIGTKII 547

Query: 547 ARETVKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISILKTD 604
           AR T+KA RK+V AKCYGGDI+RKRKLLEKQKEGKKRM+  G V++PQ AF+++L+ D
Sbjct: 548 ARSTIKAMRKNVLAKCYGGDISRKRKLLEKQKEGKKRMKAVGNVEVPQEAFMAVLRMD 605


>gi|146329364|ref|YP_001209603.1| GTP-binding protein LepA [Dichelobacter nodosus VCS1703A]
 gi|146232834|gb|ABQ13812.1| GTP-binding protein LepA [Dichelobacter nodosus VCS1703A]
          Length = 600

 Score =  743 bits (1919), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 348/595 (58%), Positives = 464/595 (77%), Gaps = 2/595 (0%)

Query: 10  RIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVRLN 69
            IRNFSI+AHIDHGKSTL+DRFIQ C GL+EREM+ QVLD+MDIERERGITIKAQ+V LN
Sbjct: 4   HIRNFSIIAHIDHGKSTLSDRFIQTCGGLSEREMAEQVLDSMDIERERGITIKAQSVSLN 63

Query: 70  YTSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQAIDN 129
           YT+ D + YQLN IDTPGHVDF+YEVSRSL ACEG+LLVVDA QGVEAQ++AN Y AID+
Sbjct: 64  YTAKDGQTYQLNFIDTPGHVDFSYEVSRSLYACEGALLVVDAAQGVEAQSVANCYTAIDH 123

Query: 130 NHEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERIVQQLPS 189
           N E++ VLNK DLPSA+P++VK++IEE IG+ T + L VSAKTG GI  LLE+IV ++P+
Sbjct: 124 NLEVLPVLNKIDLPSANPEKVKQEIEEIIGLDTAETLNVSAKTGVGITELLEQIVAKIPA 183

Query: 190 PTSPEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVERIGIL 249
           P+     +AP +AL+IDSW+++Y+GV+ LVR+ +GQL   Q +++M T  +Y + ++GI 
Sbjct: 184 PSG--NPDAPTRALIIDSWFDAYVGVVSLVRVFDGQLRLRQKMKVMSTGEEYVITKLGIF 241

Query: 250 TPKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVVFCGLF 309
           TPK  D E L  G++G +IA IK+++   VGDT+TD + PT   LPGFK +QP VF GLF
Sbjct: 242 TPKPCDRELLNTGDVGFVIAGIKDINGAPVGDTLTDAARPTAERLPGFKKVQPRVFSGLF 301

Query: 310 PVDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERLEREFS 369
           PV++  +ENLR A++KL LNDAS  FE E S ALGFGFRCGFLG+LH+EIIQERLERE+ 
Sbjct: 302 PVESDNYENLRDALSKLCLNDASLFFEPEVSQALGFGFRCGFLGMLHMEIIQERLEREYD 361

Query: 370 LNLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEYLGSILK 429
           L+LI T+P+VVYE+    G +  + NP  +P V  I E+REP I   I+ P +Y+G+++K
Sbjct: 362 LDLITTAPTVVYEVLTTAGELLHIDNPSKLPPVNHIEEIREPIIAAHILLPQDYVGAVMK 421

Query: 430 LCQERRGIQIDMSHLDNRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDYRDSDL 489
           LC ++RG+Q +M     +  + +E+P++EV+ DF+DRLKSVS+G+AS DY  + +  ++L
Sbjct: 422 LCIDKRGVQKNMQFAGQQVQLTFEMPMSEVVLDFFDRLKSVSRGFASLDYEFLRFEAANL 481

Query: 490 VKLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGGRIIARE 549
             L IL+N + +D+LSI+VH+  ++ RGR + +K+K LIP+QMF++AIQAAIG  IIAR 
Sbjct: 482 QCLDILINGDKVDSLSIIVHKEQAQFRGRELVDKMKELIPRQMFEVAIQAAIGNSIIARS 541

Query: 550 TVKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISILKTD 604
           TVKA RK+V AKCYGGD++RKRKLLEKQK GKKRM++ G V+IPQ AF+++LK D
Sbjct: 542 TVKALRKNVLAKCYGGDVSRKRKLLEKQKAGKKRMKQVGSVEIPQEAFLAVLKVD 596


>gi|197122651|ref|YP_002134602.1| GTP-binding protein LepA [Anaeromyxobacter sp. K]
 gi|238689859|sp|B4UDQ7|LEPA_ANASK RecName: Full=Elongation factor 4; Short=EF-4; AltName:
           Full=Ribosomal back-translocase LepA
 gi|196172500|gb|ACG73473.1| GTP-binding protein LepA [Anaeromyxobacter sp. K]
          Length = 601

 Score =  743 bits (1919), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 346/599 (57%), Positives = 468/599 (78%), Gaps = 5/599 (0%)

Query: 9   SRIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVRL 68
           S IRNFSI+AHIDHGKSTLADR ++H   +T+RE  +Q LDNM++ERERGITIKAQTVR+
Sbjct: 6   SHIRNFSIIAHIDHGKSTLADRLLEHTGTVTKREAQAQFLDNMELERERGITIKAQTVRM 65

Query: 69  NYTSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQAID 128
            Y + D +DY+LNLIDTPGHVDF YEVSRS++ACEG++LVVDATQGVEAQTLANVYQA+D
Sbjct: 66  KYRAKDGRDYELNLIDTPGHVDFAYEVSRSMAACEGAILVVDATQGVEAQTLANVYQALD 125

Query: 129 NNHEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERIVQQLP 188
           ++ EI+ V+NK DLPSAD + V+++IEE IG+  +DA+  SAK G GI  +LE+IV ++P
Sbjct: 126 HDLEIVPVINKIDLPSADVEGVRQEIEEVIGLDAKDAVPASAKEGIGIGEILEQIVHRVP 185

Query: 189 SPTSPEG-ANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVERIG 247
           +P   EG  +APLKA++ DSWY+SY GV++LVR+  G +   Q IRL     +++V+ +G
Sbjct: 186 AP---EGDPDAPLKAIVFDSWYDSYRGVVMLVRVFEGTVRPKQKIRLWSNRKEFEVQELG 242

Query: 248 ILTPKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVVFCG 307
           +  P    +  L  GE+GV++A++K+V   +VGDTITD + PT    PGFK ++P+VF G
Sbjct: 243 VFAPFAKAVGELQAGEVGVVVANVKDVHDAKVGDTITDAARPTEEPFPGFKVVKPMVFSG 302

Query: 308 LFPVDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERLERE 367
           +FP++A  +E LR A+ KL LND++F++E E S ALGFGFRCG+LGLLH+EI+QERLERE
Sbjct: 303 VFPIEAADYEQLRDALEKLSLNDSAFTYEPETSQALGFGFRCGYLGLLHMEIVQERLERE 362

Query: 368 FSLNLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEYLGSI 427
           + L LI T+PSVVY +    G+++++ NP  +P V KIA+L EP +   I    E +G+I
Sbjct: 363 YQLALITTAPSVVYRVTDTSGAVEEIDNPAKLPPVQKIAKLEEPHLTCHIHARTEDVGAI 422

Query: 428 LKLCQERRGIQIDMSHLD-NRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDYRD 486
           LKLCQERRG+Q D+ +L   R  I Y++PL EV+FDF+D+LKSVS+GYAS DY +  Y +
Sbjct: 423 LKLCQERRGLQRDLKYLGTKRVQITYDIPLAEVVFDFFDKLKSVSRGYASLDYELKGYEE 482

Query: 487 SDLVKLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGGRII 546
           +DLVKL IL+N E +DALS++VHR  + +RGR +C++L+ +IP+QM+++AIQAAIG ++I
Sbjct: 483 ADLVKLDILINGEPVDALSVIVHRERAYQRGRDLCQRLREVIPKQMYEVAIQAAIGAKVI 542

Query: 547 ARETVKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISILKTDN 605
           ARETVKA RK+V AKCYGGDI+RKRKLLEKQKEGKKRM++ G V+IPQ AF+++LK + 
Sbjct: 543 ARETVKAFRKNVLAKCYGGDISRKRKLLEKQKEGKKRMKQVGSVEIPQEAFLAVLKVEE 601


>gi|307823636|ref|ZP_07653865.1| GTP-binding protein LepA [Methylobacter tundripaludum SV96]
 gi|307735621|gb|EFO06469.1| GTP-binding protein LepA [Methylobacter tundripaludum SV96]
          Length = 599

 Score =  743 bits (1918), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 343/600 (57%), Positives = 468/600 (78%), Gaps = 4/600 (0%)

Query: 8   LSRIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVR 67
           L  IRNFSI+AHIDHGKSTLADRFIQ C GL+ REMS+QVLD+MDIE+ERGITIKAQ+V 
Sbjct: 3   LKHIRNFSIIAHIDHGKSTLADRFIQICGGLSAREMSAQVLDSMDIEKERGITIKAQSVT 62

Query: 68  LNYTSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQAI 127
           L++ + D + YQLN IDTPGHVDF+YEVSRSL+ACEG+LLVVDA QGVEAQ++AN Y AI
Sbjct: 63  LDFKAKDGETYQLNFIDTPGHVDFSYEVSRSLAACEGALLVVDAAQGVEAQSVANCYTAI 122

Query: 128 DNNHEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERIVQQL 187
           +   E++ VLNK DLPSA+P+RV+ +IEE IGI  ++AL++SAKTG G+  +LE++V ++
Sbjct: 123 EQGLEVVPVLNKIDLPSAEPERVQAEIEEVIGIPADEALMISAKTGLGVEDVLEQLVLKV 182

Query: 188 PSPTSPEGANA-PLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVERI 246
           P P   EG  A PL+AL+IDSW++SYLGV+ LVRI++G + + Q I +M T   +  E++
Sbjct: 183 PPP---EGNTAGPLQALIIDSWFDSYLGVVSLVRIMHGSIRRKQKITIMSTGKSFIAEKV 239

Query: 247 GILTPKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVVFC 306
           G+ TPK ++ E L  GE+G ++A IK++    VGDTIT   +P    L GF+ +QP VF 
Sbjct: 240 GVFTPKRLEKEILNTGEVGYVVAGIKDIFGAPVGDTITWTDNPAAEQLTGFQKVQPRVFA 299

Query: 307 GLFPVDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERLER 366
           GL+PV +  +E+LR A+NKL LNDAS  FE E S ALGFGFRCGFLG+LH+EI+QERLER
Sbjct: 300 GLYPVSSDHYEDLREALNKLNLNDASLHFEPETSQALGFGFRCGFLGMLHMEIVQERLER 359

Query: 367 EFSLNLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEYLGS 426
           E+ ++LI T+P+V+YE+  H+  +  + NP  +P++  I E+REP I+  I+ P  YLG 
Sbjct: 360 EYDVDLITTAPTVIYEVITHNDQVLMIDNPAKLPDMGTIKEVREPIIRANILVPQAYLGG 419

Query: 427 ILKLCQERRGIQIDMSHLDNRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDYRD 486
           ++ LC E+RG+Q DM ++  +  + YE+PL+EV+ DF+DRLKSVS+G+ASFDY  + ++ 
Sbjct: 420 VITLCIEKRGVQKDMQYVGRQVSLHYEMPLSEVVLDFFDRLKSVSRGFASFDYEFLRFQP 479

Query: 487 SDLVKLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGGRII 546
           ++LVKL +L+N E +DALSI+VHR +S  RGR + EK+K+LIP+QM+++AIQAAIG ++I
Sbjct: 480 AELVKLDVLINAEKVDALSIIVHRDLSNNRGRDLVEKMKDLIPRQMYEVAIQAAIGSKVI 539

Query: 547 ARETVKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISILKTDNE 606
           AR TVKA RK+V AKCYGGDI+RK+KLLEKQK GKKRM++ G ++IPQ AF+++L+ + E
Sbjct: 540 ARSTVKAMRKNVIAKCYGGDISRKKKLLEKQKAGKKRMKQVGNIEIPQEAFLAVLQLNKE 599


>gi|220917434|ref|YP_002492738.1| GTP-binding protein LepA [Anaeromyxobacter dehalogenans 2CP-1]
 gi|254808371|sp|B8JAF3|LEPA_ANAD2 RecName: Full=Elongation factor 4; Short=EF-4; AltName:
           Full=Ribosomal back-translocase LepA
 gi|219955288|gb|ACL65672.1| GTP-binding protein LepA [Anaeromyxobacter dehalogenans 2CP-1]
          Length = 601

 Score =  743 bits (1918), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 346/599 (57%), Positives = 468/599 (78%), Gaps = 5/599 (0%)

Query: 9   SRIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVRL 68
           S IRNFSI+AHIDHGKSTLADR ++H   +T+RE  +Q LDNM++ERERGITIKAQTVR+
Sbjct: 6   SHIRNFSIIAHIDHGKSTLADRLLEHTGTVTKREAQAQFLDNMELERERGITIKAQTVRM 65

Query: 69  NYTSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQAID 128
            Y + D +DY+LNLIDTPGHVDF YEVSRS++ACEG++LVVDATQGVEAQTLANVYQA+D
Sbjct: 66  KYRAQDGRDYELNLIDTPGHVDFAYEVSRSMAACEGAILVVDATQGVEAQTLANVYQALD 125

Query: 129 NNHEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERIVQQLP 188
           ++ EI+ V+NK DLPSAD + V+++IEE IG+  +DA+  SAK G GI  +LE+IV ++P
Sbjct: 126 HDLEIVPVINKIDLPSADVEGVRQEIEEVIGLDAKDAVPASAKEGIGIGEILEQIVHRVP 185

Query: 189 SPTSPEG-ANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVERIG 247
           +P   EG  +APLKA++ DSWY+SY GV++LVR+  G +   Q IRL     +++V+ +G
Sbjct: 186 AP---EGDPDAPLKAIVFDSWYDSYRGVVMLVRVFEGTVRPKQKIRLWSNRKEFEVQELG 242

Query: 248 ILTPKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVVFCG 307
           +  P    +  L  GE+GV++A++K+V   +VGDTITD + PT    PGFK ++P+VF G
Sbjct: 243 VFAPFAKAVVELQAGEVGVVVANVKDVHDAKVGDTITDATRPTEEPFPGFKVVKPMVFSG 302

Query: 308 LFPVDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERLERE 367
           +FP++A  +E LR A+ KL LND++F++E E S ALGFGFRCG+LGLLH+EI+QERLERE
Sbjct: 303 VFPIEAADYEQLRDALEKLSLNDSAFTYEPETSQALGFGFRCGYLGLLHMEIVQERLERE 362

Query: 368 FSLNLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEYLGSI 427
           + L LI T+PSVVY +    G+++++ NP  +P V KIA+L EP +   I    E +G+I
Sbjct: 363 YQLALITTAPSVVYRVTDTSGAVEEIDNPAKLPPVQKIAKLEEPHLTCHIHARTEDVGAI 422

Query: 428 LKLCQERRGIQIDMSHLD-NRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDYRD 486
           LKLCQERRG+Q D+ +L   R  I Y++PL EV+FDF+D+LKSVS+GYAS DY +  Y +
Sbjct: 423 LKLCQERRGLQRDLKYLGTKRVQITYDIPLAEVVFDFFDKLKSVSRGYASLDYELKGYEE 482

Query: 487 SDLVKLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGGRII 546
           +DLVKL IL+N E +DALS++VHR  + +RGR +C++L+ +IP+QM+++AIQAAIG ++I
Sbjct: 483 ADLVKLDILINGEPVDALSVIVHRERAYQRGRDLCQRLREVIPKQMYEVAIQAAIGAKVI 542

Query: 547 ARETVKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISILKTDN 605
           ARETVKA RK+V AKCYGGDI+RKRKLLEKQKEGKKRM++ G V+IPQ AF+++LK + 
Sbjct: 543 ARETVKAFRKNVLAKCYGGDISRKRKLLEKQKEGKKRMKQVGSVEIPQEAFLAVLKVEE 601


>gi|86158039|ref|YP_464824.1| GTP-binding protein LepA [Anaeromyxobacter dehalogenans 2CP-C]
 gi|119371327|sp|Q2IIA6|LEPA_ANADE RecName: Full=Elongation factor 4; Short=EF-4; AltName:
           Full=Ribosomal back-translocase LepA
 gi|85774550|gb|ABC81387.1| GTP-binding protein LepA [Anaeromyxobacter dehalogenans 2CP-C]
          Length = 601

 Score =  743 bits (1918), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 347/599 (57%), Positives = 467/599 (77%), Gaps = 5/599 (0%)

Query: 9   SRIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVRL 68
           S IRNFSI+AHIDHGKSTLADR ++H   +T+RE  +Q LDNM++ERERGITIKAQTVR+
Sbjct: 6   SHIRNFSIIAHIDHGKSTLADRLLEHTGTVTKREAQAQFLDNMELERERGITIKAQTVRM 65

Query: 69  NYTSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQAID 128
            Y + D +DY+LNLIDTPGHVDF YEVSRS++ACEG++LVVDATQGVEAQTLANVYQA+D
Sbjct: 66  KYRAQDGRDYELNLIDTPGHVDFAYEVSRSMAACEGAILVVDATQGVEAQTLANVYQALD 125

Query: 129 NNHEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERIVQQLP 188
           ++ EI+ V+NK DLPSAD + V+++IEE IG+  +DA+  SAK G GI  +LE+IV ++P
Sbjct: 126 HDLEIVPVINKIDLPSADVEGVRQEIEEVIGLDAKDAVPASAKEGIGIGEILEQIVHRVP 185

Query: 189 SPTS-PEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVERIG 247
            P   PE   APLKA++ DSWY+SY GV++LVR+  G +   Q IRL     +++V+ +G
Sbjct: 186 PPEGDPE---APLKAIVFDSWYDSYRGVVMLVRVFEGTVRPKQKIRLWSNRKEFEVQELG 242

Query: 248 ILTPKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVVFCG 307
           I  P    +  L  GE+GV++A++K+V   +VGDTITD + PT +  PGFK ++P+VF G
Sbjct: 243 IFAPFAKAVGELQAGEVGVVVANVKDVHDAKVGDTITDAARPTEAPFPGFKVVKPMVFSG 302

Query: 308 LFPVDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERLERE 367
           +FP++A  +E LR A+ KL LND++F++E E S ALGFGFRCG+LGLLH+EI+QERLERE
Sbjct: 303 VFPIEAADYEQLRDALEKLSLNDSAFTYEPETSQALGFGFRCGYLGLLHMEIVQERLERE 362

Query: 368 FSLNLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEYLGSI 427
           + L LI T+PSVVY +    G+++++ NP  +P V KIA+L EP +   I    E +G+I
Sbjct: 363 YQLALITTAPSVVYRVTDTTGAVEEIDNPAKLPPVQKIAKLEEPHLTCHIHARTEDVGAI 422

Query: 428 LKLCQERRGIQIDMSHLD-NRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDYRD 486
           LKLCQERRG+Q D+ +L   R  I Y++PL EV+FDF+D+LKSVS+GYAS DY +  Y +
Sbjct: 423 LKLCQERRGLQRDLKYLGTKRVQITYDIPLAEVVFDFFDKLKSVSRGYASLDYELKGYEE 482

Query: 487 SDLVKLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGGRII 546
           +DLVKL IL+N E +DALS++VHR  + +RGR +C++L+ +IP+QM+++AIQAAIG ++I
Sbjct: 483 ADLVKLDILINGEPVDALSVIVHRERAYQRGRDLCQRLREVIPKQMYEVAIQAAIGAKVI 542

Query: 547 ARETVKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISILKTDN 605
           ARETVKA RK+V AKCYGGDI+RKRKLLEKQKEGKKRM++ G V+IPQ AF+++LK + 
Sbjct: 543 ARETVKAFRKNVLAKCYGGDISRKRKLLEKQKEGKKRMKQVGSVEIPQEAFLAVLKVEE 601


>gi|34497518|ref|NP_901733.1| GTP-binding protein LepA [Chromobacterium violaceum ATCC 12472]
 gi|46396311|sp|Q7NWC7|LEPA_CHRVO RecName: Full=Elongation factor 4; Short=EF-4; AltName:
           Full=Ribosomal back-translocase LepA
 gi|34103373|gb|AAQ59735.1| GTP-binding protein LepA [Chromobacterium violaceum ATCC 12472]
          Length = 597

 Score =  743 bits (1918), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 354/599 (59%), Positives = 464/599 (77%), Gaps = 2/599 (0%)

Query: 8   LSRIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVR 67
           +  IRNFSI+AHIDHGKSTLADRFIQ C GL  REMS+QVLD+MDIE+ERGITIKAQT  
Sbjct: 1   MKNIRNFSIIAHIDHGKSTLADRFIQFCGGLELREMSAQVLDSMDIEKERGITIKAQTAA 60

Query: 68  LNYTSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQAI 127
           L Y + D + Y LNLIDTPGHVDF+YEVSRSLSACEG+LLVVDA+QGVEAQT+AN Y AI
Sbjct: 61  LQYKARDGQVYNLNLIDTPGHVDFSYEVSRSLSACEGALLVVDASQGVEAQTVANCYTAI 120

Query: 128 DNNHEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERIVQQL 187
           D   E++ VLNK DLP+ADP+R+ ++IE+ IGI   +A+  SAK+G GI  +LE +V ++
Sbjct: 121 DLGVEVVPVLNKIDLPAADPERISQEIEDIIGIEAVEAVRASAKSGIGIEDILEEVVNKI 180

Query: 188 PSPTSPEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVERIG 247
           P P      + PLKAL++DSW+++Y+GV++LVR+I+G L     I+ M T A++  E++G
Sbjct: 181 PPPKGD--PDGPLKALIVDSWFDNYVGVVMLVRVIDGSLKPKDKIKFMATGAEHLCEQVG 238

Query: 248 ILTPKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVVFCG 307
           + TPK +   +L  GE+G +IA IKE+   +VGDTIT  S P T ALPGFK +Q  VF G
Sbjct: 239 VFTPKSVQRPSLNAGEVGFVIAGIKELKSAKVGDTITLVSKPATEALPGFKDVQSQVFAG 298

Query: 308 LFPVDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERLERE 367
           L+PV++  +E LR A+ KL+LNDAS  +E E S ALGFGFRCGFLGLLHLEI+QERLERE
Sbjct: 299 LYPVESHDYEALRDALEKLQLNDASLKYEPEVSQALGFGFRCGFLGLLHLEIVQERLERE 358

Query: 368 FSLNLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEYLGSI 427
           F ++LI T+P+V YE+ M DG+++ +SNP  MPE  K  ELREP I  TI+ P +Y+GS+
Sbjct: 359 FDMDLITTAPTVNYEVVMKDGTVEVVSNPSRMPEAGKYDELREPIITSTILVPQDYVGSV 418

Query: 428 LKLCQERRGIQIDMSHLDNRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDYRDS 487
           + LC ++RG+Q +M ++  + M+ Y+LP+NEV+ DF+D+LKS S+GYAS DY   +++ +
Sbjct: 419 MTLCNQKRGVQRNMQYMGRQVMLTYDLPMNEVVMDFFDKLKSTSRGYASLDYEFKEFQSA 478

Query: 488 DLVKLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGGRIIA 547
           DLVKL +LVN E +DALS++VHR+ S  RGR +  K++ LIP+QMF IA+QAAIGG IIA
Sbjct: 479 DLVKLDVLVNGEKVDALSLIVHRASSVYRGRELVAKMRELIPRQMFDIAVQAAIGGHIIA 538

Query: 548 RETVKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISILKTDNE 606
           RETVKA RK+V AKCYGGDITRK+KLLEKQK GKKRM++ G V+IPQ AF++IL+  ++
Sbjct: 539 RETVKALRKNVLAKCYGGDITRKKKLLEKQKAGKKRMKQVGNVEIPQEAFLAILQVGDK 597


>gi|292670104|ref|ZP_06603530.1| GTP-binding protein LepA [Selenomonas noxia ATCC 43541]
 gi|292648292|gb|EFF66264.1| GTP-binding protein LepA [Selenomonas noxia ATCC 43541]
          Length = 599

 Score =  743 bits (1918), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 348/595 (58%), Positives = 461/595 (77%), Gaps = 3/595 (0%)

Query: 11  IRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVRLNY 70
           IRNFSI+AHIDHGKST+ADR I++   LTEREM +QVLD+MD+ERERGITIKAQTVRL+Y
Sbjct: 6   IRNFSIIAHIDHGKSTIADRLIEYTGTLTEREMEAQVLDSMDLERERGITIKAQTVRLDY 65

Query: 71  TSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQAIDNN 130
              D + Y+LNLIDTPGHVDF YEVSRSL+ACEG+LLVVDA QGVEAQTLANVY A++++
Sbjct: 66  RGEDGEMYELNLIDTPGHVDFNYEVSRSLAACEGALLVVDAAQGVEAQTLANVYLALEHD 125

Query: 131 HEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERIVQQLPSP 190
            EI+ V+NK DLPSA+PDRVK +IE+TIG+ T  A+L SAKTG GI  +L+ +V  +P P
Sbjct: 126 LEIVPVINKIDLPSAEPDRVKAEIEDTIGLDTSAAVLTSAKTGIGIKEVLDAVVAYIPPP 185

Query: 191 TSPEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVERIGILT 250
                A+APL+AL+ DS+++ Y GV+  VR+  G + KG  ++LM T   + V  +G   
Sbjct: 186 EG--SADAPLRALIFDSYFDPYKGVIANVRVKEGTIKKGMKLKLMATGKTFDVTDVGCFR 243

Query: 251 PKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVVFCGLFP 310
           P+ +D  AL  GE+G +  ++K+V   RVGDT+T    P   ALPG++ + P+VFCGL+P
Sbjct: 244 PQPVDTGALGTGEVGFIAGALKDVRDVRVGDTVTTAEHPAKEALPGYRGVTPMVFCGLYP 303

Query: 311 VDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERLEREFSL 370
            D+  ++NLR A+ KL+LNDA+  FE E S ALGFGFRCGFLGLLH+++IQERLERE++L
Sbjct: 304 EDSKDYDNLREALEKLQLNDAALVFEPETSIALGFGFRCGFLGLLHMDVIQERLEREYNL 363

Query: 371 NLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEYLGSILKL 430
            LI T+PSVVY +Y  DG+M ++SNP D+P  T+I  + EP ++ T+I P +Y+G+++++
Sbjct: 364 GLIMTAPSVVYHVYRTDGNMVEVSNPADLPPQTEIDRIEEPCVKATVIVPKDYVGAVMEI 423

Query: 431 CQERRGIQIDMSHLD-NRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDYRDSDL 489
            QE+RG+   M +LD  R M+VY +PLNE+++D++DRLKS ++GYAS DY +IDY+ S+L
Sbjct: 424 SQEKRGVFQTMDYLDATRVMVVYHIPLNEILYDYFDRLKSATRGYASLDYELIDYQTSNL 483

Query: 490 VKLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGGRIIARE 549
           VKL IL+N + +DALS +VHR  +  RGR +  KLK +IPQQMF+I IQAAIG +IIARE
Sbjct: 484 VKLDILLNGDPVDALSTIVHRDRAVTRGRQLAVKLKGIIPQQMFEIPIQAAIGSKIIARE 543

Query: 550 TVKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISILKTD 604
            V+ARRKDV AKCYGGDITRKRKLLEKQKEGKKRM+  G V++PQ AF+++LK D
Sbjct: 544 NVRARRKDVLAKCYGGDITRKRKLLEKQKEGKKRMKAVGSVELPQEAFMAVLKID 598


>gi|163856072|ref|YP_001630370.1| GTP-binding protein LepA [Bordetella petrii DSM 12804]
 gi|229621850|sp|A9III9|LEPA_BORPD RecName: Full=Elongation factor 4; Short=EF-4; AltName:
           Full=Ribosomal back-translocase LepA
 gi|163259800|emb|CAP42101.1| membrane GTPase [Bordetella petrii]
          Length = 597

 Score =  743 bits (1917), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 343/600 (57%), Positives = 466/600 (77%), Gaps = 4/600 (0%)

Query: 8   LSRIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVR 67
           +  IRNFSI+AHIDHGKSTLADR IQ C GL  REMS+QVLD+M+IERERGITIKAQT  
Sbjct: 1   MQHIRNFSIIAHIDHGKSTLADRLIQRCGGLAAREMSAQVLDSMEIERERGITIKAQTAA 60

Query: 68  LNYTSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQAI 127
           L Y + D K Y LNLIDTPGHVDF+YEVSRSLSACEG+LLVVDA+QGVEAQT+AN Y AI
Sbjct: 61  LQYQAQDGKTYNLNLIDTPGHVDFSYEVSRSLSACEGALLVVDASQGVEAQTVANCYTAI 120

Query: 128 DNNHEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERIVQQL 187
           +   E++ VLNK DLP ADPD  ++++E+ IGI   +A+L SAKTG GI  +LE IV ++
Sbjct: 121 ELGVEVLPVLNKMDLPQADPDAARQEVEDVIGIDASNAVLASAKTGMGIDEILETIVARV 180

Query: 188 PSPT-SPEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVERI 246
           P+P  +P+GA   L+AL+IDSW+++Y+GV++LVRIING L     I LM + A +  E++
Sbjct: 181 PAPQGNPDGA---LQALIIDSWFDNYVGVVMLVRIINGVLRPKDKILLMASGATHLCEQV 237

Query: 247 GILTPKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVVFC 306
           G+ TPK      L  GE+G +IA IKE++H +VGDT+T    P  + LPGFK ++P VF 
Sbjct: 238 GVFTPKSQPRTELSAGEVGFIIAGIKELAHAKVGDTVTLAGKPANAPLPGFKEVKPQVFA 297

Query: 307 GLFPVDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERLER 366
           GL+PV++++++ LR ++ KL+LNDA+  FE E S ALGFGFRCGFLGLLH+EI+QERLER
Sbjct: 298 GLYPVESSEYDQLRDSLEKLKLNDAALMFEPEVSQALGFGFRCGFLGLLHMEIVQERLER 357

Query: 367 EFSLNLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEYLGS 426
           EF +++I T+PSVVYE+   DGS++ + +P  MPEV KIA++REP ++VT+  P EY+G 
Sbjct: 358 EFDMDIITTAPSVVYEVEQRDGSIEIVDSPARMPEVGKIADIREPIVKVTLFMPQEYVGP 417

Query: 427 ILKLCQERRGIQIDMSHLDNRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDYRD 486
           ++ LC  +RG+QI+MS+   +  + YE+PL E++ DF+D+LKSVS+GYAS DY  ++YR 
Sbjct: 418 VMTLCNNKRGVQINMSYHGRQVHLTYEIPLAEIVLDFFDKLKSVSRGYASMDYEFLEYRS 477

Query: 487 SDLVKLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGGRII 546
           +D+V++ +L+N + +DAL+++VHR+ +  R R +  +++ LIP+QMF +AIQAAIG  +I
Sbjct: 478 ADVVRVDLLINGDRVDALAMIVHRANARYRARDVVTRMRGLIPRQMFDVAIQAAIGAEVI 537

Query: 547 ARETVKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISILKTDNE 606
           ARE VKA RK+V AKCYGGDITRK+KLLEKQK GKKRM++ G V+IPQ AF++IL+ +++
Sbjct: 538 ARENVKALRKNVLAKCYGGDITRKKKLLEKQKAGKKRMKQVGSVEIPQEAFLAILQVEDK 597


>gi|308069971|ref|YP_003871576.1| GTP-binding protein lepA [Paenibacillus polymyxa E681]
 gi|305859250|gb|ADM71038.1| GTP-binding protein lepA [Paenibacillus polymyxa E681]
          Length = 604

 Score =  743 bits (1917), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 337/596 (56%), Positives = 466/596 (78%), Gaps = 3/596 (0%)

Query: 10  RIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVRLN 69
           +IRNFSI+AHIDHGKSTLADR +++   LT REM  QVLD MD+ERERGITIK Q VRL 
Sbjct: 10  KIRNFSIIAHIDHGKSTLADRILEYTGALTSREMQEQVLDQMDLERERGITIKLQAVRLT 69

Query: 70  YTSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQAIDN 129
           Y + D ++Y LNLIDTPGHVDFTYEVSRSL+ACEG+LLVVDA QG+EAQTLANVY A+DN
Sbjct: 70  YKADDGEEYILNLIDTPGHVDFTYEVSRSLAACEGALLVVDAAQGIEAQTLANVYLALDN 129

Query: 130 NHEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERIVQQLPS 189
           N EI+ VLNK DLPSADP+RVK++IE+ IG+ T + +  SAK G GI  +LE++V+ +P+
Sbjct: 130 NLEILPVLNKIDLPSADPERVKQEIEDVIGLDTSETVHASAKAGIGIKEILEQVVRSVPA 189

Query: 190 PTSPEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVERIGIL 249
           P      + PLKAL+ DS Y+ Y GV+V VR+++G +  G  I++M T+  ++V  +G  
Sbjct: 190 PQG--NPDNPLKALIFDSHYDPYKGVIVYVRVVDGSIKAGSKIKMMATDKTFEVIEVGAF 247

Query: 250 TPKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVVFCGLF 309
            P+M  ++ L  G++G ++A IK V  TRVGDT+TD  +PT   +PG++ I P+V+CGL+
Sbjct: 248 MPRMSIVDELNIGDVGFIVAGIKHVGDTRVGDTVTDAKNPTLEPMPGYRKINPMVYCGLY 307

Query: 310 PVDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERLEREFS 369
           P++ +++ +LR A+ KL+LNDAS SFE E S+ALGFGFRCGFLGLLH+++IQER+EREF+
Sbjct: 308 PIETSEYNDLREALEKLQLNDASLSFEPETSSALGFGFRCGFLGLLHMDVIQERIEREFN 367

Query: 370 LNLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEYLGSILK 429
           + LI T+PSV+Y + + +G   ++ NP + PE+ +I  + EP+++  II PN+Y+G++++
Sbjct: 368 IPLITTAPSVIYRIKLTNGETIQIDNPSNYPEIGRIEHVEEPYVKAGIIVPNDYVGTVME 427

Query: 430 LCQERRGIQIDMSHLD-NRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDYRDSD 488
           LCQ +RG  ++M +LD  R  I Y++PL+E+++DF+D+LKS +KGYASFDY +  YR S+
Sbjct: 428 LCQTKRGEYVNMEYLDTTRVTITYQIPLSEIVYDFFDQLKSSTKGYASFDYEISGYRQSN 487

Query: 489 LVKLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGGRIIAR 548
           LVK+ IL+N E +DALS +VHR  +  RGR ICEKL+ LIP+QMF++ IQA++G +++AR
Sbjct: 488 LVKMDILLNGEQVDALSFIVHRDRAYHRGRIICEKLRELIPRQMFEVPIQASVGTKVVAR 547

Query: 549 ETVKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISILKTD 604
           ETVKA RK+V AKCYGGDI+RKRKLLEKQKEGKKRM++ G V++PQ AF+++LK D
Sbjct: 548 ETVKAMRKNVLAKCYGGDISRKRKLLEKQKEGKKRMKQVGNVEVPQEAFMAVLKID 603


>gi|238927753|ref|ZP_04659513.1| membrane GTPase LepA [Selenomonas flueggei ATCC 43531]
 gi|238884469|gb|EEQ48107.1| membrane GTPase LepA [Selenomonas flueggei ATCC 43531]
          Length = 599

 Score =  743 bits (1917), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 345/597 (57%), Positives = 467/597 (78%), Gaps = 5/597 (0%)

Query: 11  IRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVRLNY 70
           IRNFSI+AHIDHGKST+ADR I++   L+EREM +QVLD+MD+ERERGITIKAQTVRL+Y
Sbjct: 6   IRNFSIIAHIDHGKSTIADRLIEYTGTLSEREMEAQVLDSMDLERERGITIKAQTVRLDY 65

Query: 71  TSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQAIDNN 130
              D + Y+LNLIDTPGHVDF YEVSRSL+ACEG+LLVVDA QGVEAQTLANVY A++++
Sbjct: 66  RGEDGELYELNLIDTPGHVDFNYEVSRSLAACEGALLVVDAAQGVEAQTLANVYLALEHD 125

Query: 131 HEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERIVQQLPSP 190
            EI+ V+NK DLPSA+P+RVK++IE++IG+ T  A+L SAKTG GI  +L+ +V  +P P
Sbjct: 126 LEIVPVINKIDLPSAEPERVKEEIEDSIGLDTSAAVLASAKTGIGIKEILDAVVAYIPPP 185

Query: 191 TSPEG-ANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVERIGIL 249
              EG A+APL+AL+ DS++++Y GV+  VRI  G + KG  ++LM T   ++V  +G  
Sbjct: 186 ---EGDADAPLRALIFDSYFDAYKGVIAHVRIKEGMIKKGMKLKLMATGKTFEVTDVGCF 242

Query: 250 TPKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVVFCGLF 309
            P+ +D   L  GE+G +  ++K+V   RVGDT+T    P   ALPG++ + P+VFCGL+
Sbjct: 243 RPRPVDTGELRTGEVGFIAGALKDVRDVRVGDTVTSAERPAAEALPGYRGVTPMVFCGLY 302

Query: 310 PVDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERLEREFS 369
           P D+  ++NLR A+ KL+LNDA+  FE E S ALGFGFRCGFLGLLH+++IQERLERE++
Sbjct: 303 PEDSKDYDNLREALEKLQLNDAALVFEPETSIALGFGFRCGFLGLLHMDVIQERLEREYN 362

Query: 370 LNLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEYLGSILK 429
           L LI T+PSVVY +Y  DG+M+++SNP D+P  T+I  + EP ++ T+I P +Y+G++++
Sbjct: 363 LGLIMTAPSVVYHVYRTDGTMREVSNPADLPPQTEIDHIEEPCVKATVIVPKDYVGAVME 422

Query: 430 LCQERRGIQIDMSHLD-NRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDYRDSD 488
           + QE+RG+   M +LD  R  ++Y +PLNE+++D++DRLKS ++GYAS DY +IDY+ S+
Sbjct: 423 ISQEKRGVFQTMDYLDATRVTVIYHIPLNEILYDYFDRLKSATRGYASLDYELIDYQTSN 482

Query: 489 LVKLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGGRIIAR 548
           LVKL IL+N + +DALS +VHR  + +RGR +  KLK +IPQQMF+I IQAAIG +IIAR
Sbjct: 483 LVKLDILLNGDPVDALSTIVHRDRAAQRGRQLAAKLKEIIPQQMFEIPIQAAIGSKIIAR 542

Query: 549 ETVKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISILKTDN 605
           E V+ARRKDV AKCYGGDITRKRKLLEKQKEGKKRM+  G V++PQ AF+++LK D+
Sbjct: 543 ENVRARRKDVLAKCYGGDITRKRKLLEKQKEGKKRMKAVGSVELPQEAFMAVLKIDD 599


>gi|187477628|ref|YP_785652.1| GTP-binding protein LepA [Bordetella avium 197N]
 gi|119371332|sp|Q2KWY3|LEPA_BORA1 RecName: Full=Elongation factor 4; Short=EF-4; AltName:
           Full=Ribosomal back-translocase LepA
 gi|115422214|emb|CAJ48738.1| GTP-binding elongation factor [Bordetella avium 197N]
          Length = 597

 Score =  742 bits (1916), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 347/600 (57%), Positives = 461/600 (76%), Gaps = 4/600 (0%)

Query: 8   LSRIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVR 67
           +  IRNFSI+AHIDHGKSTLADR IQ C GL  REMS+QVLD+MDIERERGITIKAQT  
Sbjct: 1   MQHIRNFSIIAHIDHGKSTLADRLIQRCGGLAAREMSAQVLDSMDIERERGITIKAQTAA 60

Query: 68  LNYTSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQAI 127
           L Y + D K Y LNLIDTPGHVDF+YEVSRSLSACEG+LLVVDA+QGVEAQT+AN Y AI
Sbjct: 61  LEYKAQDGKVYNLNLIDTPGHVDFSYEVSRSLSACEGALLVVDASQGVEAQTVANCYTAI 120

Query: 128 DNNHEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERIVQQL 187
           D   E++ VLNK DLP ADP+  ++++E+ IGI   DA+L SAKTG GI  +LE IV ++
Sbjct: 121 DLGVEVLAVLNKMDLPQADPEGARQEVEDVIGIDASDAVLASAKTGMGIDEILEAIVARV 180

Query: 188 PSPTS-PEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVERI 246
           PSP   PE A   L+AL+IDSW+++Y+GV++LVRI+NG L     I LM + A +  E+ 
Sbjct: 181 PSPEGDPEAA---LQALIIDSWFDNYVGVVMLVRIVNGVLRPKDKILLMASGATHLCEQT 237

Query: 247 GILTPKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVVFC 306
           G+ TPK      L  GE+G +IA IKE++H +VGDTIT    P  + LPGFK +QP VF 
Sbjct: 238 GVFTPKSQPRAQLSAGEVGFIIAGIKELAHAKVGDTITLAGKPAAAPLPGFKEVQPQVFA 297

Query: 307 GLFPVDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERLER 366
           GL+PV++++++ LR ++ KL+LNDA+  FE E S ALGFGFRCGFLGLLH+EI+QERLER
Sbjct: 298 GLYPVESSEYDQLRDSLEKLKLNDAALMFEPEVSQALGFGFRCGFLGLLHMEIVQERLER 357

Query: 367 EFSLNLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEYLGS 426
           EF +++I T+PSVVYE+   DG++  + +P  MPEV KIAE+REP ++VT+  P EY+G 
Sbjct: 358 EFDMDIITTAPSVVYEVVERDGTVLTIESPSRMPEVGKIAEIREPIVKVTLFMPQEYVGP 417

Query: 427 ILKLCQERRGIQIDMSHLDNRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDYRD 486
           ++ LC  +RG QI+M++   +  + YE+PL E++ DF+DRLKSVS+GYAS DY  ++YR 
Sbjct: 418 VMTLCNNKRGNQINMTYHGRQVHLTYEIPLAEIVLDFFDRLKSVSRGYASMDYEFLEYRP 477

Query: 487 SDLVKLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGGRII 546
           +D+VK+ +L+N + +DAL+++VHRS +  R R +  +++ LIP+QM+ +AIQAAIG  +I
Sbjct: 478 ADVVKVDLLINGDRVDALAMIVHRSNARYRARDVVSRMRALIPRQMYDVAIQAAIGAEVI 537

Query: 547 ARETVKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISILKTDNE 606
           ARE VKA RK+V AKCYGGDI+RK+KLLEKQK GKKRM++ G V+IPQ AF++IL+ +++
Sbjct: 538 ARENVKALRKNVLAKCYGGDISRKKKLLEKQKAGKKRMKQVGTVEIPQEAFLAILQVEDK 597


>gi|95929131|ref|ZP_01311875.1| Small GTP-binding protein domain [Desulfuromonas acetoxidans DSM
           684]
 gi|95134629|gb|EAT16284.1| Small GTP-binding protein domain [Desulfuromonas acetoxidans DSM
           684]
          Length = 599

 Score =  742 bits (1916), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 347/594 (58%), Positives = 465/594 (78%), Gaps = 3/594 (0%)

Query: 11  IRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVRLNY 70
           IRNFSI+AHIDHGKSTLADR ++    +++RE + Q LD MD+ERERGITIKAQ V L Y
Sbjct: 6   IRNFSIIAHIDHGKSTLADRLLEDTGTVSDREKTDQFLDKMDLERERGITIKAQAVCLKY 65

Query: 71  TSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQAIDNN 130
            + + +DY LNLIDTPGHVDF+YEVSRSL+ACEG+LLVVDA+QGVEAQTLANVY A+D +
Sbjct: 66  RADNGEDYTLNLIDTPGHVDFSYEVSRSLTACEGALLVVDASQGVEAQTLANVYLALDED 125

Query: 131 HEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERIVQQLPSP 190
            EI  VLNK DLP A+P+RVK++IE+ IG+ T DA++ SAK G GI  +LER+VQQ+P+P
Sbjct: 126 LEIFPVLNKVDLPGAEPERVKEEIEDIIGLDTSDAIVASAKEGIGIHDILERVVQQVPAP 185

Query: 191 TSPEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVERIGILT 250
                 +APLKAL+ DSWY+SY GV+V+VRI++G++ KG  I LM +   Y+V ++G+ +
Sbjct: 186 QG--DVDAPLKALIFDSWYDSYQGVVVMVRIVDGEIKKGDKIYLMASKGSYEVLKVGVFS 243

Query: 251 PKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVVFCGLFP 310
           P  +   +L  GE+G ++A IK V   +VGDTIT       +ALPGF+ ++P+VF GL+P
Sbjct: 244 PGAVPQSSLKAGEVGFVVAGIKVVQDAKVGDTITHFHKRADNALPGFQEVKPMVFSGLYP 303

Query: 311 VDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERLEREFSL 370
           +D ++++ LR A+ KL+LNDAS S+E ENS ALGFGFRCGFLGLLH+EIIQERLEREF++
Sbjct: 304 IDTSEYDLLRDALEKLQLNDASISYEPENSVALGFGFRCGFLGLLHMEIIQERLEREFNI 363

Query: 371 NLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEYLGSILKL 430
           +LI T+P+VVY++      +  + +   +PEV  I  + EP+I  +I  PNE++GSIL L
Sbjct: 364 DLITTAPTVVYQVTTVKNELIHVDSANKLPEVQYIDRIEEPFILASIHVPNEFVGSILAL 423

Query: 431 CQERRGIQIDMSHL-DNRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDYRDSDL 489
           C+E+RGIQ ++ +L + R MIVYELPLNE++ DFYDRLKS+S+GYAS DY  +DYR S L
Sbjct: 424 CEEKRGIQREIKYLTETRVMIVYELPLNEIVMDFYDRLKSISRGYASLDYEPLDYRPSKL 483

Query: 490 VKLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGGRIIARE 549
           V++ +++N +T+DALS++VH+  ++ RGR +  K+K  IP+Q + +AIQAA+GG+IIARE
Sbjct: 484 VRMNVMINGDTVDALSLIVHQDKAQARGRELVSKMKEFIPRQQYVVAIQAAVGGKIIARE 543

Query: 550 TVKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISILKT 603
           TVKA RKDVTAKCYGGDI+RKRKLLEKQKEGKKRM++ G V++PQ AF++ILK 
Sbjct: 544 TVKALRKDVTAKCYGGDISRKRKLLEKQKEGKKRMKQVGSVELPQEAFLAILKV 597


>gi|332284938|ref|YP_004416849.1| GTP-binding protein LepA [Pusillimonas sp. T7-7]
 gi|330428891|gb|AEC20225.1| GTP-binding protein LepA [Pusillimonas sp. T7-7]
          Length = 597

 Score =  742 bits (1915), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 343/599 (57%), Positives = 463/599 (77%), Gaps = 2/599 (0%)

Query: 8   LSRIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVR 67
           +  IRNFSI+AHIDHGKSTLADR I  C GL +REMS+QVLD+MDIERERGITIKAQT  
Sbjct: 1   MDHIRNFSIIAHIDHGKSTLADRLIHRCGGLADREMSTQVLDSMDIERERGITIKAQTAA 60

Query: 68  LNYTSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQAI 127
           L+Y + D K Y LNLIDTPGHVDF+YEVSRSLSACEG+LLVVDA+QGVEAQT+AN Y AI
Sbjct: 61  LSYKAQDGKTYALNLIDTPGHVDFSYEVSRSLSACEGALLVVDASQGVEAQTVANCYTAI 120

Query: 128 DNNHEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERIVQQL 187
           +   E+I VLNK DLPSA+P+  +++IE+ IGI   +A+L SAKTG GI  +LE IV ++
Sbjct: 121 ELGVEVIPVLNKMDLPSAEPENARQEIEDVIGIDASEAVLCSAKTGLGIDEILETIVAKV 180

Query: 188 PSPTSPEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVERIG 247
           P+P      + PL+AL+IDSW+++Y+GV++LVRI+NG L     I LM   A +  E IG
Sbjct: 181 PAPVG--DPSQPLQALIIDSWFDNYVGVVMLVRIVNGVLRPKDKILLMAAGASHLCEHIG 238

Query: 248 ILTPKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVVFCG 307
           + TPK +  + L  GE+G +IA IKE+ H +VGDTIT    P ++ALPGFK ++P VF G
Sbjct: 239 VFTPKSVPRQQLSAGEVGFVIAGIKELEHAKVGDTITLAGKPASTALPGFKEVKPQVFAG 298

Query: 308 LFPVDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERLERE 367
           L+PV++++++ LR ++ KL+LND+S  FE E S ALGFGFRCGFLGLLH+EI+QERLERE
Sbjct: 299 LYPVESSEYDQLRDSLEKLKLNDSSLMFEPEVSQALGFGFRCGFLGLLHMEIVQERLERE 358

Query: 368 FSLNLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEYLGSI 427
           F +++I T+PSVVYE+   DG++  + +P  MPEV  I E+REP + +T+  P EY+G +
Sbjct: 359 FDMDIITTAPSVVYEVEQRDGTVAMIESPSRMPEVGNITEIREPIVTITLFMPQEYVGPV 418

Query: 428 LKLCQERRGIQIDMSHLDNRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDYRDS 487
           + LC  +RGIQ++M++   +  + YE+PL E++ DF+D+LKSVS+GYAS DY   +YR +
Sbjct: 419 MSLCMVKRGIQLNMTYHGRQVHLSYEMPLAEIVLDFFDKLKSVSRGYASMDYEFKEYRSA 478

Query: 488 DLVKLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGGRIIA 547
           D+V++ +L+N + +DALS++VHRS +  RGR +  K+++LIP+QMF IAIQAAIG  ++A
Sbjct: 479 DVVRVDLLINGDRVDALSMIVHRSNARYRGREVVSKMRSLIPRQMFDIAIQAAIGAEVVA 538

Query: 548 RETVKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISILKTDNE 606
           RE VKA RK+V AKCYGGDI+RK+KLLEKQK GKKRM++ G V+IPQ AF++IL+ +++
Sbjct: 539 RENVKALRKNVLAKCYGGDISRKKKLLEKQKAGKKRMKQVGNVEIPQEAFLAILQVEDK 597


>gi|310643083|ref|YP_003947841.1| gtp-binding protein lepa [Paenibacillus polymyxa SC2]
 gi|309248033|gb|ADO57600.1| GTP-binding protein lepA [Paenibacillus polymyxa SC2]
          Length = 604

 Score =  742 bits (1915), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 337/596 (56%), Positives = 466/596 (78%), Gaps = 3/596 (0%)

Query: 10  RIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVRLN 69
           +IRNFSI+AHIDHGKSTLADR +++   LT REM  QVLD M++ERERGITIK Q VRL 
Sbjct: 10  KIRNFSIIAHIDHGKSTLADRILEYTGALTSREMQEQVLDQMELERERGITIKLQAVRLT 69

Query: 70  YTSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQAIDN 129
           Y + D ++Y LNLIDTPGHVDFTYEVSRSL+ACEG+LLVVDA QG+EAQTLANVY A+DN
Sbjct: 70  YKADDGEEYILNLIDTPGHVDFTYEVSRSLAACEGALLVVDAAQGIEAQTLANVYLALDN 129

Query: 130 NHEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERIVQQLPS 189
           N EI+ VLNK DLPSADP+RVK++IE+ IG+ T + +  SAK G GI  +LE++V+ +P+
Sbjct: 130 NLEILPVLNKIDLPSADPERVKQEIEDVIGLDTSETVHASAKAGIGIKEILEQVVRSVPA 189

Query: 190 PTSPEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVERIGIL 249
           P      + PLKAL+ DS Y+ Y GV+V VR+++G +  G  I++M T+  ++V  +G  
Sbjct: 190 PQG--NPDNPLKALIFDSHYDPYKGVIVYVRVVDGSIRAGSKIKMMATDKTFEVIEVGAF 247

Query: 250 TPKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVVFCGLF 309
            P+M  ++ L  G++G ++A IK V  TRVGDT+TD  +PT   +PG++ I P+V+CGL+
Sbjct: 248 MPRMTIVDELNIGDVGFIVAGIKHVGDTRVGDTVTDAKNPTPEPMPGYRKINPMVYCGLY 307

Query: 310 PVDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERLEREFS 369
           P++ +++ +LR A+ KL+LNDAS SFE E S+ALGFGFRCGFLGLLH+++IQER+EREF+
Sbjct: 308 PIETSEYNDLREALEKLQLNDASLSFEPETSSALGFGFRCGFLGLLHMDVIQERIEREFN 367

Query: 370 LNLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEYLGSILK 429
           + LI T+PSV+Y + + +G   ++ NP + PEV +I  + EP+++  II PN+Y+G++++
Sbjct: 368 IPLITTAPSVIYRVQLTNGETIEIDNPSNYPEVGRIEHVEEPYVKAGIIVPNDYVGTVME 427

Query: 430 LCQERRGIQIDMSHLD-NRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDYRDSD 488
           LCQ +RG  ++M +LD  R  I Y++PL+E+++DF+D+LKS +KGYASFDY +  YR S+
Sbjct: 428 LCQSKRGEYVNMEYLDTTRVTITYQIPLSEIVYDFFDQLKSSTKGYASFDYEISGYRQSN 487

Query: 489 LVKLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGGRIIAR 548
           LVK+ IL+N E +DALS +VHR  +  RGR ICEKL+ LIP+QMF++ IQA++G +++AR
Sbjct: 488 LVKMDILLNGEQVDALSFIVHRDRAYHRGRIICEKLRELIPRQMFEVPIQASVGTKVVAR 547

Query: 549 ETVKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISILKTD 604
           ETVKA RK+V AKCYGGDI+RKRKLLEKQKEGKKRM++ G V++PQ AF+++LK D
Sbjct: 548 ETVKAMRKNVLAKCYGGDISRKRKLLEKQKEGKKRMKQVGNVEVPQEAFMAVLKID 603


>gi|322383627|ref|ZP_08057378.1| LepA-like protein [Paenibacillus larvae subsp. larvae B-3650]
 gi|321151839|gb|EFX44782.1| LepA-like protein [Paenibacillus larvae subsp. larvae B-3650]
          Length = 604

 Score =  742 bits (1915), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 342/598 (57%), Positives = 470/598 (78%), Gaps = 5/598 (0%)

Query: 10  RIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVRLN 69
           +IRNFSI+AHIDHGKSTLADR +++   L+ REM  QVLD MD+ERERGITIK Q VRLN
Sbjct: 10  QIRNFSIIAHIDHGKSTLADRILEYTGALSSREMQQQVLDQMDLERERGITIKLQAVRLN 69

Query: 70  YTSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQAIDN 129
           Y + D ++Y LNLIDTPGHVDFTYEVSRSL+ACEG+LLVVDA QG+EAQTLANVY A+DN
Sbjct: 70  YKADDGQEYILNLIDTPGHVDFTYEVSRSLAACEGALLVVDAAQGIEAQTLANVYLALDN 129

Query: 130 NHEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERIVQQLPS 189
           + EI+ V+NK DLPSADP+RVK++IE+ IG+   DA+L SAK G GI  +LE++  ++P+
Sbjct: 130 DLEILPVINKIDLPSADPERVKQEIEDVIGLDASDAVLASAKAGIGIKEILEQVCTKVPA 189

Query: 190 PTSPEG-ANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVERIGI 248
           P   EG  + PLKAL+ DS Y+ Y GV+V VR+++G +  G  I+ M T+  ++V  +G 
Sbjct: 190 P---EGDPDKPLKALIFDSHYDPYKGVIVYVRVMDGAIKAGTKIKFMATDKTFEVIEVGA 246

Query: 249 LTPKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVVFCGL 308
             P+M  I+ L  G++G ++A IK V  TRVGDT+T+  +P    LPG++ I P+VFCGL
Sbjct: 247 FMPRMTIIDQLNVGDVGFIVAGIKNVGDTRVGDTVTEAKNPAPEPLPGYRKINPMVFCGL 306

Query: 309 FPVDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERLEREF 368
           +P++ + + +LR A+ KL LNDAS S+E E S+ALGFGFRCGFLGLLH+EIIQER+EREF
Sbjct: 307 YPIETSDYNDLREALQKLELNDASLSYEPETSSALGFGFRCGFLGLLHMEIIQERIEREF 366

Query: 369 SLNLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEYLGSIL 428
           ++ LI T+PSVV+++ M  G + ++ NP +MP+  KI  + EP+++ +II PN+++G+I+
Sbjct: 367 NIPLITTAPSVVFKVTMTSGEVLEIDNPSNMPDPQKIEYIEEPYVKASIIVPNDFVGAIM 426

Query: 429 KLCQERRGIQIDMSHLD-NRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDYRDS 487
           +LCQ +RG  ++M +LD NR  + Y++PL+E+++DF+D+LKS +KGYASFDY++  Y+ S
Sbjct: 427 ELCQGKRGEFLNMEYLDTNRVTLTYDIPLSEIVYDFFDQLKSSTKGYASFDYDLSGYKKS 486

Query: 488 DLVKLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGGRIIA 547
           +LVK+ IL+N E +DALS +VHR  +  RG+ +CEKLK LIP+QMF++ +QAAIG +I+A
Sbjct: 487 NLVKMDILLNGEQVDALSFIVHRDRAYHRGKILCEKLKELIPRQMFEVPVQAAIGQKIVA 546

Query: 548 RETVKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISILKTDN 605
           RETVKA RK+V AKCYGGDI+RKRKLLEKQKEGKKRM++ G V++PQ AF+++LK D+
Sbjct: 547 RETVKAMRKNVLAKCYGGDISRKRKLLEKQKEGKKRMKQVGSVEVPQEAFMAVLKIDD 604


>gi|311069152|ref|YP_003974075.1| GTP-binding protein LepA [Bacillus atrophaeus 1942]
 gi|310869669|gb|ADP33144.1| GTP-binding protein LepA [Bacillus atrophaeus 1942]
          Length = 611

 Score =  741 bits (1914), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 336/599 (56%), Positives = 469/599 (78%), Gaps = 5/599 (0%)

Query: 9   SRIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVRL 68
           SRIRNFSI+AHIDHGKSTLADR ++    +T+REM  Q+LD+MD+ERERGITIK  +V+L
Sbjct: 12  SRIRNFSIIAHIDHGKSTLADRILEKTSAITQREMKEQLLDSMDLERERGITIKLNSVQL 71

Query: 69  NYTSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQAID 128
            Y + D ++Y  +LIDTPGHVDFTYEVSRSL+ACEG++LVVDA QG+EAQTLANVY A+D
Sbjct: 72  KYKAKDGEEYIFHLIDTPGHVDFTYEVSRSLAACEGAILVVDAAQGIEAQTLANVYLALD 131

Query: 129 NNHEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERIVQQLP 188
           N+ EI+ V+NK DLPSA+P+RV++++E+ IG+   +A+L SAK G GI  +LE+IV+++P
Sbjct: 132 NDLEILPVINKIDLPSAEPERVRQEVEDVIGLDASEAVLASAKAGIGIEEILEQIVEKVP 191

Query: 189 SPTS-PEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVERIG 247
           +PT  PE   APLKAL+ DS Y++Y GV+  +R++ G +  GQ IR+M T  +++V  +G
Sbjct: 192 APTGDPE---APLKALIFDSLYDAYRGVVAYIRVVEGTVKPGQKIRMMATGKEFEVTEVG 248

Query: 248 ILTPKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVVFCG 307
           + TPK    + L  G++G + A+IK V  TRVGDTIT  ++    ALPG++ + P+V+CG
Sbjct: 249 VFTPKATPTDELTVGDVGFLTAAIKNVGDTRVGDTITSAANQAAEALPGYRKLNPMVYCG 308

Query: 308 LFPVDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERLERE 367
           L+P+D  ++ +LR A+ KL LND+S  +E E S ALGFGFRCGFLG+LH+EIIQER+ERE
Sbjct: 309 LYPIDTAKYNDLREALEKLELNDSSLQYEAETSQALGFGFRCGFLGMLHMEIIQERIERE 368

Query: 368 FSLNLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEYLGSI 427
           F ++LI T+PSV+Y++YM DG    + NP +MP+  KI  + EP+++ T++ PN+Y+G++
Sbjct: 369 FKIDLITTAPSVIYDVYMTDGEKVVVDNPSNMPDPQKIERIEEPYVKATMMVPNDYVGAV 428

Query: 428 LKLCQERRGIQIDMSHLD-NRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDYRD 486
           ++LCQ +RG  IDM +LD NR  IVY++PL E++++F+D+LKS +KGYASFDY +I Y+ 
Sbjct: 429 MELCQGKRGNFIDMQYLDANRVSIVYDMPLAEIVYEFFDQLKSSTKGYASFDYELIGYKP 488

Query: 487 SDLVKLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGGRII 546
           S LVK+ I++N E IDALS +VHR  + +RG+ I EKLK LIP+Q F++ IQAAIG +I+
Sbjct: 489 SQLVKMDIMLNGEKIDALSFIVHRDYAYERGKVIVEKLKELIPRQHFEVPIQAAIGQKIV 548

Query: 547 ARETVKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISILKTDN 605
           AR T+KA RK+V AKCYGGDI+RKRKLLEKQKEGK+RM++ G V++PQ AF+++LK D+
Sbjct: 549 ARSTIKAMRKNVLAKCYGGDISRKRKLLEKQKEGKRRMKQVGSVEVPQEAFMAVLKMDD 607


>gi|56963420|ref|YP_175151.1| GTP-binding protein LepA [Bacillus clausii KSM-K16]
 gi|60389909|sp|Q5WHG5|LEPA_BACSK RecName: Full=Elongation factor 4; Short=EF-4; AltName:
           Full=Ribosomal back-translocase LepA
 gi|56909663|dbj|BAD64190.1| GTP-binding protein LepA [Bacillus clausii KSM-K16]
          Length = 607

 Score =  741 bits (1914), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 337/599 (56%), Positives = 465/599 (77%), Gaps = 3/599 (0%)

Query: 9   SRIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVRL 68
           SRIRNFSI+AHIDHGKSTLADR ++    LT+REM  Q LD MD+ERERGITIK   V+L
Sbjct: 11  SRIRNFSIIAHIDHGKSTLADRILERTGALTDREMKEQALDAMDLERERGITIKLNAVQL 70

Query: 69  NYTSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQAID 128
            Y + D  +Y  +LIDTPGHVDFTYEVSRSL+ACEG+LL+VD+ QG+EAQTLANVY A+D
Sbjct: 71  KYKAKDGNEYIFHLIDTPGHVDFTYEVSRSLAACEGALLIVDSAQGIEAQTLANVYLALD 130

Query: 129 NNHEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERIVQQLP 188
           N+ EI+ V+NK DLPSA+P+RVKK++E+ IG+   DA+L SAK G GI  +LE++V+++P
Sbjct: 131 NDLEILPVINKIDLPSAEPERVKKEVEDVIGLDASDAVLASAKNGIGIEDILEQVVEKVP 190

Query: 189 SPTSPEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVERIGI 248
           +P       APLKAL+ DS Y+ Y GV+  +RI+ G +  G+ IR+M T  +++V  +G+
Sbjct: 191 APAG--DPTAPLKALIFDSLYDPYRGVIAYIRIVEGTVRPGEKIRMMQTGKEFEVNEVGV 248

Query: 249 LTPKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVVFCGL 308
            TPK +  E L  G++G + A+IK VS +RVGDTIT   +P   ALPG++ + P+V+CGL
Sbjct: 249 FTPKAVKCEELTVGDVGFLTAAIKNVSDSRVGDTITSAVNPAQEALPGYRRMNPMVYCGL 308

Query: 309 FPVDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERLEREF 368
           +P+D   + +LR A+ +L LNDAS  +E E S ALGFGFRCGFLGLLH+EIIQER+EREF
Sbjct: 309 YPIDTNDYNDLREALERLELNDASLQYEPETSQALGFGFRCGFLGLLHMEIIQERIEREF 368

Query: 369 SLNLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEYLGSIL 428
            ++LI T+PSV+Y + + DG+  ++ NP +MP+  K+  + EP+++ T++ PN+Y+G+++
Sbjct: 369 GISLITTAPSVIYHVTLTDGNTIQIDNPTNMPDPQKMDHVEEPYVKSTVMVPNDYVGAVM 428

Query: 429 KLCQERRGIQIDMSHLD-NRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDYRDS 487
           +LCQ +RGI +DM +LD NR  I+YE+PL+E+++DF+D+LKS +KGYASFDY +I YR S
Sbjct: 429 ELCQSKRGIFVDMQYLDENRVQIIYEIPLSEIVYDFFDQLKSNTKGYASFDYELIGYRQS 488

Query: 488 DLVKLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGGRIIA 547
            LVK+ IL+N E +DALS++VHR  + +RG+ I EKLK LIP+Q F++ +QA+IG +IIA
Sbjct: 489 KLVKMDILLNGEKVDALSVIVHRDSAYERGKVIVEKLKELIPRQQFEVPVQASIGTKIIA 548

Query: 548 RETVKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISILKTDNE 606
           R T+KA RK+V AKCYGGDI+RKRKLLEKQKEGKKRM+  G V+IPQ AF+++L+ D++
Sbjct: 549 RSTIKAIRKNVLAKCYGGDISRKRKLLEKQKEGKKRMKAVGNVEIPQEAFMAVLRMDDK 607


>gi|146306504|ref|YP_001186969.1| GTP-binding protein LepA [Pseudomonas mendocina ymp]
 gi|166224514|sp|A4XSC1|LEPA_PSEMY RecName: Full=Elongation factor 4; Short=EF-4; AltName:
           Full=Ribosomal back-translocase LepA
 gi|145574705|gb|ABP84237.1| GTP-binding protein LepA [Pseudomonas mendocina ymp]
          Length = 599

 Score =  741 bits (1914), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 347/598 (58%), Positives = 456/598 (76%), Gaps = 2/598 (0%)

Query: 8   LSRIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVR 67
           LS IRNFSI+AHIDHGKSTLADRFIQ C GL  REM +QVLD+MD+ERERGITIKA +V 
Sbjct: 4   LSHIRNFSIIAHIDHGKSTLADRFIQMCGGLAAREMEAQVLDSMDLERERGITIKAHSVT 63

Query: 68  LNYTSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQAI 127
           L+Y + D K YQLN IDTPGHVDFTYEVSRSL+ACEG+LLVVDA QGVEAQ++AN Y AI
Sbjct: 64  LHYKAKDGKTYQLNFIDTPGHVDFTYEVSRSLAACEGALLVVDAGQGVEAQSVANCYTAI 123

Query: 128 DNNHEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERIVQQL 187
           +   E++ VLNK DLP ADPDRVK +IE+ IGI   DA+  SAK+G G+  +LER+VQ +
Sbjct: 124 EQGLEVMPVLNKMDLPQADPDRVKDEIEKIIGIDATDAVACSAKSGMGVDEVLERLVQTI 183

Query: 188 PSPTSPEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVERIG 247
           P+PT      APL+AL+IDSW+++YLGV+ LVR+  G++ KG  I +  T   + V+ +G
Sbjct: 184 PAPTGD--IEAPLQALIIDSWFDNYLGVVSLVRVRQGRVKKGDKILVKSTGKVHLVDSVG 241

Query: 248 ILTPKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVVFCG 307
           + TPK      L  GE+G +IASIK++    VGDT+T  S+P    LPGFK IQP V+ G
Sbjct: 242 VFTPKHTATADLKAGEVGFIIASIKDIHGAPVGDTLTLSSTPEVEVLPGFKKIQPQVYAG 301

Query: 308 LFPVDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERLERE 367
           LFPV +  FE+ R A+ KL LND+S  +  E+S ALGFGFRCGFLG+LH+EIIQERLERE
Sbjct: 302 LFPVSSDDFEDFRDALQKLTLNDSSLQYMPESSDALGFGFRCGFLGMLHMEIIQERLERE 361

Query: 368 FSLNLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEYLGSI 427
           + L+LI T+PSV+YEL +  G    + NP  +P+V+ +A+ REP +  TI+ P E+LG++
Sbjct: 362 YDLDLITTAPSVIYELELKTGETITVDNPSKLPDVSSVADFREPIVTATILVPQEHLGNV 421

Query: 428 LKLCQERRGIQIDMSHLDNRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDYRDS 487
           + LC E+RG+Q DM  L ++  + Y+LP+NEV+ DF+DRLKS S+GYAS DY+   Y+ +
Sbjct: 422 ITLCIEKRGVQRDMQFLGSQVQVRYDLPMNEVVLDFFDRLKSTSRGYASLDYHFDRYQSA 481

Query: 488 DLVKLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGGRIIA 547
           +LVKL +L+N + +DAL+++VHR  +  +GR + EK+K LIP+QMF +AIQAAIGG+IIA
Sbjct: 482 NLVKLDVLINGDKVDALALIVHRDNAAYKGRALTEKMKELIPRQMFDVAIQAAIGGQIIA 541

Query: 548 RETVKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISILKTDN 605
           R TVKA RK+V AKCYGGD++RK+KLLEKQK GKKRM++ G V+IPQ AF+++L+ D+
Sbjct: 542 RTTVKALRKNVLAKCYGGDVSRKKKLLEKQKAGKKRMKQVGNVEIPQEAFLAVLRLDS 599


>gi|162452109|ref|YP_001614476.1| GTP-binding protein LepA [Sorangium cellulosum 'So ce 56']
 gi|189046457|sp|A9GWZ4|LEPA_SORC5 RecName: Full=Elongation factor 4; Short=EF-4; AltName:
           Full=Ribosomal back-translocase LepA
 gi|161162691|emb|CAN93996.1| GTP-binding protein LepA [Sorangium cellulosum 'So ce 56']
          Length = 600

 Score =  741 bits (1914), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 348/601 (57%), Positives = 457/601 (76%), Gaps = 3/601 (0%)

Query: 5   PTPLSRIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQ 64
           P     IRNFSI+AHIDHGKSTLADR +     LT RE   Q LD MDIERERGITIKAQ
Sbjct: 2   PVDSKLIRNFSIIAHIDHGKSTLADRILDATGALTAREQKEQFLDKMDIERERGITIKAQ 61

Query: 65  TVRLNYTSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVY 124
           TVRL+YT+ D + Y+L+LIDTPGHVDF YEVSRSL ACEG+LLVVDATQGVEAQTLANV+
Sbjct: 62  TVRLDYTAKDGQTYRLHLIDTPGHVDFNYEVSRSLQACEGALLVVDATQGVEAQTLANVF 121

Query: 125 QAIDNNHEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERIV 184
            A+DNN  I+ VLNK DLPSAD +R  ++IE+ IG+    A+  SAKTG GI  +LE +V
Sbjct: 122 LALDNNLAILPVLNKIDLPSADIERTTREIEDVIGLDCSGAIPASAKTGIGIAEILEAVV 181

Query: 185 QQLPSPTSPEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVE 244
           +++P+P      NA  +AL+ DSWY+SY G +V+VR+++G + KGQ +R M T   Y+V 
Sbjct: 182 ERIPAPKG--DPNAAPRALIFDSWYDSYRGAVVMVRVVDGIIRKGQKVRFMATGRDYEVT 239

Query: 245 RIGILTPKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVV 304
            +G+ TP    I  L PGE+G ++ +IK V  T++GDT+TD   P T+ LPGFK ++P+V
Sbjct: 240 EMGVFTPHATAITELGPGEVGFLVGNIKSVVDTKIGDTVTDAVHPATTPLPGFKEVKPMV 299

Query: 305 FCGLFPVDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERL 364
           F G+FP D+ Q+E+LR A++KL +NDA+F FE + S ALGFGFRCGFLGLLH+EIIQERL
Sbjct: 300 FAGIFPTDSAQYEDLRDALSKLHMNDAAFVFEPDTSEALGFGFRCGFLGLLHMEIIQERL 359

Query: 365 EREFSLNLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEYL 424
           ERE++L+LI T+PSVVY  Y++DGSM+ + NP  +P       + EP  ++T+  P+ Y+
Sbjct: 360 EREYNLDLITTAPSVVYHCYLNDGSMKSIENPAKLPPPNLTDRIEEPIFRMTVHVPSTYV 419

Query: 425 GSILKLCQERRGIQIDMSHL-DNRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVID 483
           G++L LCQERRG Q  + +   +R +I Y++PL+EV+FDF+D+LKSVS+GYAS DY ++ 
Sbjct: 420 GAVLALCQERRGEQKSIQYASSDRVIITYDMPLSEVLFDFHDKLKSVSRGYASMDYELVG 479

Query: 484 YRDSDLVKLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGG 543
           YR  DL+KL +LVN + +DALS++VHR  +  RGR +  KLK+++P+Q +++AIQAAIG 
Sbjct: 480 YRADDLIKLDMLVNGDPLDALSVIVHRDKAYARGRDLAVKLKDIVPRQQYEVAIQAAIGS 539

Query: 544 RIIARETVKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISILKT 603
           ++IAR TVKA RKDVTAKCYGGDI+RKRKLLEKQKEGKKRM+  G V+IPQ AF++ILK 
Sbjct: 540 KVIARTTVKAMRKDVTAKCYGGDISRKRKLLEKQKEGKKRMKMVGSVEIPQEAFLAILKI 599

Query: 604 D 604
           D
Sbjct: 600 D 600


>gi|257093150|ref|YP_003166791.1| GTP-binding protein LepA [Candidatus Accumulibacter phosphatis
           clade IIA str. UW-1]
 gi|257045674|gb|ACV34862.1| GTP-binding protein LepA [Candidatus Accumulibacter phosphatis
           clade IIA str. UW-1]
          Length = 598

 Score =  741 bits (1914), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 343/597 (57%), Positives = 464/597 (77%), Gaps = 2/597 (0%)

Query: 7   PLSRIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTV 66
           P+  IRNFSI+AHIDHGKSTLADR I  C GL++REM +QVLD+MDIERERGITIKAQT 
Sbjct: 2   PMQHIRNFSIIAHIDHGKSTLADRIIHLCGGLSDREMEAQVLDSMDIERERGITIKAQTA 61

Query: 67  RLNYTSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQA 126
            L Y +   + Y LNLIDTPGHVDF+YEVSRSLSACEG+LLVVDA+QGVEAQT+AN Y A
Sbjct: 62  ALQYRARSGETYNLNLIDTPGHVDFSYEVSRSLSACEGALLVVDASQGVEAQTVANCYTA 121

Query: 127 IDNNHEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERIVQQ 186
           I+   +++ VLNK DLPSA PD  +++IE+ IGI   +A+L SAKTG G+  +LE I+++
Sbjct: 122 IELGVDVLPVLNKIDLPSAMPDNARQEIEDVIGIDASEAVLASAKTGVGVEDILEAIIER 181

Query: 187 LPSPTSPEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVERI 246
           +P P   +  +APLKALL+D+W+++Y+GV++LVR+ +G L     IRLM + + +  E++
Sbjct: 182 IPPPKGNQ--DAPLKALLVDAWFDNYVGVVMLVRVFDGTLRPKDRIRLMASGSTHLCEQV 239

Query: 247 GILTPKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVVFC 306
           G+ TPK +  +AL  GE+G +I+ IKE+   +VGDT+T    P + ALPGFK I+  VF 
Sbjct: 240 GVFTPKAVPRDALRAGEVGYVISGIKELQAAKVGDTLTLLDRPASEALPGFKEIKSQVFA 299

Query: 307 GLFPVDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERLER 366
           GL+PV++ Q+++LR ++ KL+LNDAS  +E E S ALGFGFRCGFLGLLH+EI+QERLER
Sbjct: 300 GLYPVESNQYDSLRESLEKLKLNDASLRYEPEVSQALGFGFRCGFLGLLHMEIVQERLER 359

Query: 367 EFSLNLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEYLGS 426
           EF  +LI T+P+VVYE+ + DGS+  + NP  +PE++KI E+REP I +T+  P +YLG+
Sbjct: 360 EFDQDLITTAPTVVYEVVLRDGSLINVENPAKLPELSKIEEIREPIITITVFVPQDYLGN 419

Query: 427 ILKLCQERRGIQIDMSHLDNRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDYRD 486
           ++ LC ++RG Q+DM++   +  +VYE+P+ EV+ DF+DRLKSVS+GYAS DY+  +YR 
Sbjct: 420 VITLCNQKRGNQVDMTYHGRQVQLVYEMPMAEVVMDFFDRLKSVSRGYASLDYDFKEYRA 479

Query: 487 SDLVKLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGGRII 546
           +D+VKL IL+N E +DALS+++HR+ S  RGR +  K++ LIP+QM+ +AIQAAIG  II
Sbjct: 480 ADVVKLDILINGERVDALSVILHRANSIYRGRELAAKMRELIPRQMYDVAIQAAIGANII 539

Query: 547 ARETVKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISILKT 603
           ARE VKA RKDV AKCYGGDITRK+KLLEKQK GKKRM++ G V+IPQ AF+++L+ 
Sbjct: 540 ARENVKAMRKDVLAKCYGGDITRKKKLLEKQKAGKKRMKQVGSVEIPQEAFLAVLRV 596


>gi|196248975|ref|ZP_03147675.1| GTP-binding protein LepA [Geobacillus sp. G11MC16]
 gi|196211851|gb|EDY06610.1| GTP-binding protein LepA [Geobacillus sp. G11MC16]
          Length = 609

 Score =  741 bits (1914), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 338/598 (56%), Positives = 468/598 (78%), Gaps = 3/598 (0%)

Query: 10  RIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVRLN 69
           RIRNFSI+AHIDHGKSTLADR ++    L+ERE+  Q LD M++ERERGITIK   V+L 
Sbjct: 12  RIRNFSIIAHIDHGKSTLADRILEKTGALSERELREQTLDMMELERERGITIKLNAVQLT 71

Query: 70  YTSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQAIDN 129
           Y + + ++Y  +LIDTPGHVDFTYEVSRSL+ACEG++LVVDA QG+EAQTLANVY AIDN
Sbjct: 72  YKAKNGEEYIFHLIDTPGHVDFTYEVSRSLAACEGAILVVDAAQGIEAQTLANVYLAIDN 131

Query: 130 NHEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERIVQQLPS 189
           N EI+ V+NK DLPSA+P+RV+++IE+ IG+   +A+L SAK G G+  +LE+IV+++P+
Sbjct: 132 NLEILPVINKIDLPSAEPERVRQEIEDVIGLDASEAVLASAKVGIGVEDILEQIVEKIPA 191

Query: 190 PTSPEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVERIGIL 249
           P+     +APLKAL+ DS Y+ Y GV+  VRI++G +  GQ I++M T  +++V  +G+ 
Sbjct: 192 PSG--DPDAPLKALIFDSLYDPYRGVVAYVRIVDGTVKPGQRIKMMSTGKEFEVTEVGVF 249

Query: 250 TPKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVVFCGLF 309
           TPK   ++ L  G++G + ASIK V  TRVGDTITD   P    LPG++ + P+VFCG++
Sbjct: 250 TPKPKVVDELMVGDVGYLTASIKNVQDTRVGDTITDAERPAAEPLPGYRKLNPMVFCGMY 309

Query: 310 PVDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERLEREFS 369
           P+D  ++ +LR A+ KL+LNDA+  FE E S ALGFGFRCGFLGLLH+EIIQER+EREF 
Sbjct: 310 PIDTARYNDLREALEKLQLNDAALHFEPETSQALGFGFRCGFLGLLHMEIIQERIEREFH 369

Query: 370 LNLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEYLGSILK 429
           ++LI T+PSVVY++Y+ DG+   + NP +MP+  KI  + EP+++ TI+ PN+Y+G +++
Sbjct: 370 IDLITTAPSVVYKVYLTDGTEVDVDNPTNMPDPQKIDRIEEPYVKATIMVPNDYVGPVME 429

Query: 430 LCQERRGIQIDMSHLD-NRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDYRDSD 488
           LCQ +RG  +DM +LD  R M++Y++PL+E+++DF+D LKS +KGYASFDY +I YR S+
Sbjct: 430 LCQGKRGTFVDMQYLDEKRVMLIYDIPLSEIVYDFFDALKSNTKGYASFDYELIGYRPSN 489

Query: 489 LVKLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGGRIIAR 548
           LVK+ IL+N E IDALS +VHR  + +RG+ I EKLK+LIP+Q F++ +QAAIG +IIAR
Sbjct: 490 LVKMDILLNGEKIDALSFIVHRDSAYERGKVIVEKLKDLIPRQQFEVPVQAAIGNKIIAR 549

Query: 549 ETVKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISILKTDNE 606
            T+KA RK+V AKCYGGD++RKRKLLEKQKEGKKRM++ G V++PQ AF+++LK D++
Sbjct: 550 STIKALRKNVLAKCYGGDVSRKRKLLEKQKEGKKRMKQIGSVEVPQEAFMAVLKIDDQ 607


>gi|298530298|ref|ZP_07017700.1| GTP-binding protein LepA [Desulfonatronospira thiodismutans ASO3-1]
 gi|298509672|gb|EFI33576.1| GTP-binding protein LepA [Desulfonatronospira thiodismutans ASO3-1]
          Length = 600

 Score =  741 bits (1913), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 340/596 (57%), Positives = 466/596 (78%), Gaps = 3/596 (0%)

Query: 11  IRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVRLNY 70
           IRNFSI+AHIDHGKSTLADR ++    LT+R+   Q LD +++ERERGITIKAQTVR+ Y
Sbjct: 7   IRNFSIIAHIDHGKSTLADRILELTGLLTDRDKKEQYLDRLELERERGITIKAQTVRIPY 66

Query: 71  TSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQAIDNN 130
            + D +DY LNLIDTPGHVDF+YEVSRSL+AC+G+LLVVDATQGVEAQT+ANVY A+D++
Sbjct: 67  RARDGQDYILNLIDTPGHVDFSYEVSRSLAACDGALLVVDATQGVEAQTMANVYLALDHD 126

Query: 131 HEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERIVQQLPSP 190
            EII VLNK DLPSADP R+ ++IEE +G+   D  LVSAKTGEG+  L+E+IV   P+P
Sbjct: 127 LEIIPVLNKIDLPSADPLRIAEEIEEIVGLDCSDLSLVSAKTGEGVADLMEKIVHLTPAP 186

Query: 191 TSPEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVERIGILT 250
              +  + PLKAL+ DSWY+SYLGVMVL RI++G + +GQ I +     +++V ++GI +
Sbjct: 187 RGKK--DDPLKALIFDSWYDSYLGVMVLFRILDGSIQRGQEIMMFSNRKRFEVAKLGIFS 244

Query: 251 PKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVVFCGLFP 310
           P  +D + LY GE+G + A IK++   RVGDTIT+ + P  S  PGFK +QP+VFCGL+P
Sbjct: 245 PGPMDTDCLYTGEVGFLCAGIKDLKEARVGDTITNPARPADSPFPGFKRVQPMVFCGLYP 304

Query: 311 VDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERLEREFSL 370
           V++  ++ L+ A+ +L+LNDA+  FE E S ALGFGFRCGFLGLLH+++IQERLEREF +
Sbjct: 305 VESEDYDGLKNALERLQLNDAALEFEAETSQALGFGFRCGFLGLLHMDVIQERLEREFQV 364

Query: 371 NLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEYLGSILKL 430
           +LI T+PSVVY+++  DG + ++ NP ++P V +I E+REP++++ I  PNE++G++L L
Sbjct: 365 SLIATAPSVVYKVHRVDGEVLEVDNPANLPPVQEIDEVREPYVRMEIHVPNEFVGNVLSL 424

Query: 431 CQERRGIQIDMSHLDN-RAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDYRDSDL 489
           C+E+RG Q D+ +L + R +I YE+P  E++FDF+DRLKSV+KGYAS DY V+D+R +DL
Sbjct: 425 CEEKRGQQKDLRYLSSTRVIITYEIPFAEIVFDFFDRLKSVTKGYASLDYEVLDFRRADL 484

Query: 490 VKLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGGRIIARE 549
           VK+ IL+N E +DA+S++VHR  +  +GR +  KLK +IP+Q+F++ IQA IG ++IARE
Sbjct: 485 VKMDILINQEPVDAMSVIVHREKAYHKGRSLALKLKRVIPRQLFEVIIQATIGNKVIARE 544

Query: 550 TVKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISILKTDN 605
                RK+VTAKCYGGDITRKRKLLEKQKEGK+RM++ G V+IPQ AF++ L +D+
Sbjct: 545 RTPPMRKNVTAKCYGGDITRKRKLLEKQKEGKRRMKKMGSVEIPQEAFLAALSSDD 600


>gi|77165919|ref|YP_344444.1| GTP-binding protein LepA [Nitrosococcus oceani ATCC 19707]
 gi|254433274|ref|ZP_05046782.1| GTP-binding protein LepA [Nitrosococcus oceani AFC27]
 gi|90185162|sp|Q3J8D2|LEPA_NITOC RecName: Full=Elongation factor 4; Short=EF-4; AltName:
           Full=Ribosomal back-translocase LepA
 gi|76884233|gb|ABA58914.1| GTP-binding protein LepA [Nitrosococcus oceani ATCC 19707]
 gi|207089607|gb|EDZ66878.1| GTP-binding protein LepA [Nitrosococcus oceani AFC27]
          Length = 606

 Score =  741 bits (1913), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 348/596 (58%), Positives = 462/596 (77%), Gaps = 2/596 (0%)

Query: 8   LSRIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVR 67
           +  IRNFSI+AHIDHGKST+ADRFIQ C GL++REM+ QVLD+MD+ERERGITIKAQ+V 
Sbjct: 9   MKNIRNFSIIAHIDHGKSTIADRFIQICGGLSKREMAQQVLDSMDLERERGITIKAQSVS 68

Query: 68  LNYTSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQAI 127
           LNY   + + Y LN IDTPGHVDF+YEVSRSL+ACEG+LLVVDA+QGVEAQ++AN Y AI
Sbjct: 69  LNYCGRNGEVYHLNFIDTPGHVDFSYEVSRSLAACEGALLVVDASQGVEAQSVANCYTAI 128

Query: 128 DNNHEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERIVQQL 187
           +   E++ VLNK DLPSA+P+RV ++IEE IG+   DAL VSAKTG+GI  LL  +V ++
Sbjct: 129 EQGLEVVPVLNKIDLPSAEPERVCQEIEEIIGLDASDALQVSAKTGQGIEELLAALVARV 188

Query: 188 PSPTSPEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVERIG 247
           P P     +  PL+AL+IDSW+++YLGV+ LVR+++G L     I++M T   Y+VE+ G
Sbjct: 189 PPPQGDPAS--PLRALIIDSWFDNYLGVISLVRVVDGCLKPKDKIKIMSTGQHYRVEKAG 246

Query: 248 ILTPKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVVFCG 307
           + TPK  ++E L  G +G +IA IK+V    VGDT+T      T ALPGFK ++P VF G
Sbjct: 247 LFTPKRREVEQLLTGGVGYIIAGIKDVDGAPVGDTVTHVEQFATKALPGFKAVKPQVFAG 306

Query: 308 LFPVDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERLERE 367
           LFPVD+  +E+LR A+ KLRLNDA+  +E E S ALGFGFRCGFLG+LH+EIIQERLERE
Sbjct: 307 LFPVDSDDYEDLREALAKLRLNDAALFYEPETSQALGFGFRCGFLGMLHMEIIQERLERE 366

Query: 368 FSLNLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEYLGSI 427
           +SLNLI T+P+VVY++    G + ++ NP  +PE  ++AE+REP IQ  I+ P +Y+G++
Sbjct: 367 YSLNLITTAPTVVYQVLTSKGEVLRIDNPSILPEPGQVAEVREPIIQADILVPQQYVGAV 426

Query: 428 LKLCQERRGIQIDMSHLDNRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDYRDS 487
           + LC+E+RG Q  + +L N+  + YELPL+EV+ DF++RLKSVS+GYAS DY+   ++ +
Sbjct: 427 IGLCEEKRGTQKQLQYLGNQISLNYELPLSEVVLDFFERLKSVSRGYASLDYHFSRFQSA 486

Query: 488 DLVKLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGGRIIA 547
           DLVKL +L+N E +DALS++VHR+ +  RGR + EK++ LIP+Q+F +AIQAAIG  I+A
Sbjct: 487 DLVKLDLLINGERVDALSLIVHRNQAHYRGRELAEKMRELIPRQLFDVAIQAAIGAHIVA 546

Query: 548 RETVKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISILKT 603
           R TVKA RK+VTAKCYGGDITRKRKLLEKQK GKKRM++ G V+IPQ AF+++LK 
Sbjct: 547 RTTVKALRKNVTAKCYGGDITRKRKLLEKQKAGKKRMKQVGSVEIPQEAFLAVLKV 602


>gi|238021302|ref|ZP_04601728.1| hypothetical protein GCWU000324_01201 [Kingella oralis ATCC 51147]
 gi|237868282|gb|EEP69288.1| hypothetical protein GCWU000324_01201 [Kingella oralis ATCC 51147]
          Length = 597

 Score =  741 bits (1913), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 345/595 (57%), Positives = 459/595 (77%), Gaps = 2/595 (0%)

Query: 8   LSRIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVR 67
           +  IRNFSI+AHIDHGKSTLADRFIQ+C GL +REMS+QVLD+MDIE+ERGITIKAQT  
Sbjct: 1   MKNIRNFSIIAHIDHGKSTLADRFIQYCGGLEQREMSTQVLDSMDIEKERGITIKAQTAA 60

Query: 68  LNYTSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQAI 127
           L+Y + + + Y LNLIDTPGHVDF+YEVSRSLSACEG+LLVVDA+QGVEAQT+AN Y AI
Sbjct: 61  LHYKAKNGETYLLNLIDTPGHVDFSYEVSRSLSACEGALLVVDASQGVEAQTVANCYTAI 120

Query: 128 DNNHEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERIVQQL 187
           D   E++ VLNK DLP+ADPDRV ++IE+ IGI    A+  SAK+G G+  +LE IV ++
Sbjct: 121 DLGVEVVPVLNKIDLPAADPDRVAQEIEDIIGIDAVGAVTCSAKSGLGVEDVLEEIVAKI 180

Query: 188 PSPTSPEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVERIG 247
           P+P     A APL+A++IDSW+++Y+GV++L+RI NG L     +R M T A+ QVE++G
Sbjct: 181 PAPQGD--AAAPLQAVIIDSWFDNYVGVVMLIRIKNGSLKLKDKVRFMSTRAESQVEQLG 238

Query: 248 ILTPKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVVFCG 307
           + TPK +  + L  GE+G +I  +KE+   +VGDT+T  ++P    L GFK +Q  VF G
Sbjct: 239 VFTPKSVQKQELTAGEVGFLITGVKELGQAKVGDTVTLAANPAAEPLAGFKEVQSQVFAG 298

Query: 308 LFPVDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERLERE 367
           L+PV++  +E LR A+ KL+LNDAS  FE E S ALGFGFRCGFLGLLHLEI+QERLERE
Sbjct: 299 LYPVESHDYEALRDALEKLQLNDASLKFEPEVSQALGFGFRCGFLGLLHLEIVQERLERE 358

Query: 368 FSLNLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEYLGSI 427
           F ++LI T+P+VVYE+ + +G    + NP  +P++  I  + EP I  TI+ P +Y+G++
Sbjct: 359 FDMDLITTAPTVVYEVVLKNGEKIDVENPSKLPDIGTIETIMEPIITATILVPQDYVGNV 418

Query: 428 LKLCQERRGIQIDMSHLDNRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDYRDS 487
           + LC ++RG+Q +M +L  + M+ Y+LP+NEV+ DF+D+LKS S+GYAS DY   ++  S
Sbjct: 419 MTLCNQKRGVQRNMQYLGRQVMLTYDLPMNEVVMDFFDKLKSTSRGYASLDYEFKEFMPS 478

Query: 488 DLVKLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGGRIIA 547
           DLVKL I+VN + +DALS++VHR  S +RGR +  K++ LIP+QMF IA+QAAIGG+IIA
Sbjct: 479 DLVKLDIMVNGDKVDALSLIVHRQTSVQRGRELAAKMRELIPRQMFDIAVQAAIGGQIIA 538

Query: 548 RETVKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISILK 602
           RE VKA RK+V AKCYGGDITRK+KLLEKQK GKKRM++ G V+IPQSAF++IL+
Sbjct: 539 RENVKALRKNVLAKCYGGDITRKKKLLEKQKAGKKRMKQVGNVEIPQSAFLAILE 593


>gi|154686811|ref|YP_001421972.1| GTP-binding protein LepA [Bacillus amyloliquefaciens FZB42]
 gi|166223168|sp|A7Z6W5|LEPA_BACA2 RecName: Full=Elongation factor 4; Short=EF-4; AltName:
           Full=Ribosomal back-translocase LepA
 gi|154352662|gb|ABS74741.1| LepA [Bacillus amyloliquefaciens FZB42]
          Length = 611

 Score =  741 bits (1913), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 337/599 (56%), Positives = 467/599 (77%), Gaps = 5/599 (0%)

Query: 9   SRIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVRL 68
           SRIRNFSI+AHIDHGKSTLADR ++    +T+REM  Q+LD+MD+ERERGITIK  +V+L
Sbjct: 12  SRIRNFSIIAHIDHGKSTLADRILEKTSAITQREMKEQLLDSMDLERERGITIKLNSVQL 71

Query: 69  NYTSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQAID 128
            Y + D ++Y  +LIDTPGHVDFTYEVSRSL+ACEG++LVVDA QG+EAQTLANVY A+D
Sbjct: 72  KYKAKDGEEYIFHLIDTPGHVDFTYEVSRSLAACEGAILVVDAAQGIEAQTLANVYLALD 131

Query: 129 NNHEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERIVQQLP 188
           N+ EI+ V+NK DLPSA+P+RV++++E+ IG+   DA+L SAK G GI  +LE+IV+++P
Sbjct: 132 NDLEILPVINKIDLPSAEPERVRQEVEDVIGLDASDAVLASAKAGIGIEDILEQIVEKVP 191

Query: 189 SPTS-PEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVERIG 247
           +P   PE   APLKAL+ DS Y++Y GV+  +R++ G +  GQ I++M T  +++V  +G
Sbjct: 192 APAGDPE---APLKALIFDSLYDAYRGVVAYIRVVEGTVKPGQKIKMMATGKEFEVIEVG 248

Query: 248 ILTPKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVVFCG 307
           + TPK    + L  G++G + A+IK V  TRVGDTIT    P   ALPG++ + P+V+CG
Sbjct: 249 VFTPKAQPADELTVGDVGYLTAAIKNVGDTRVGDTITSAVKPAAEALPGYRKLNPMVYCG 308

Query: 308 LFPVDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERLERE 367
           L+P+D  ++ +LR A+ KL LND+S  +E E S ALGFGFRCGFLG+LH+EIIQER+ERE
Sbjct: 309 LYPIDTAKYNDLREALEKLELNDSSLQYEAETSQALGFGFRCGFLGMLHMEIIQERIERE 368

Query: 368 FSLNLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEYLGSI 427
           F ++LI T+PSV+Y++YM DG    + NP +MP+  KI  + EP+++ T++ PN+Y+G++
Sbjct: 369 FKIDLITTAPSVIYDVYMTDGEKIIVDNPSNMPDPQKIERVEEPYVKATMMVPNDYVGAV 428

Query: 428 LKLCQERRGIQIDMSHLD-NRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDYRD 486
           ++LCQ +RG  IDM +LD NR  IVYE+PL E++++F+D+LKS +KGYASFDY +I Y+ 
Sbjct: 429 MELCQGKRGNFIDMQYLDANRVSIVYEMPLAEIVYEFFDQLKSSTKGYASFDYELIGYKP 488

Query: 487 SDLVKLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGGRII 546
           S LVK+ I++N E IDALS +VHR  + +RG+ I EKLK LIP+Q F++ IQAAIG +I+
Sbjct: 489 SKLVKMDIMLNGEKIDALSFIVHRDYAYERGKVIVEKLKELIPRQHFEVPIQAAIGQKIV 548

Query: 547 ARETVKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISILKTDN 605
           AR T+KA RK+V AKCYGGDI+RKRKLLEKQKEGK+RM++ G V++PQ AF+++LK D+
Sbjct: 549 ARSTIKAMRKNVLAKCYGGDISRKRKLLEKQKEGKRRMKQVGSVEVPQEAFMAVLKMDD 607


>gi|194017732|ref|ZP_03056342.1| GTP-binding protein LepA [Bacillus pumilus ATCC 7061]
 gi|194010632|gb|EDW20204.1| GTP-binding protein LepA [Bacillus pumilus ATCC 7061]
          Length = 612

 Score =  741 bits (1912), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 338/599 (56%), Positives = 469/599 (78%), Gaps = 5/599 (0%)

Query: 9   SRIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVRL 68
           SRIRNFSI+AHIDHGKSTLADR ++    +T+REM  Q+LD+MD+ERERGITIK  +V+L
Sbjct: 12  SRIRNFSIIAHIDHGKSTLADRILEKTSAITQREMKEQLLDSMDLERERGITIKLNSVQL 71

Query: 69  NYTSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQAID 128
            Y + D ++Y ++LIDTPGHVDFTYEVSRSL+ACEG++LVVDA QG+EAQTLANVY A+D
Sbjct: 72  KYKAKDGEEYIMHLIDTPGHVDFTYEVSRSLAACEGAILVVDAAQGIEAQTLANVYLALD 131

Query: 129 NNHEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERIVQQLP 188
           NN EI+ ++NK DLPSA+P+RV+ +IE+ IG+   +A+L SAK G GI  +LE+IV+++P
Sbjct: 132 NNLEILPIINKIDLPSAEPERVRGEIEDVIGLDASEAVLTSAKAGIGIEDILEQIVEKVP 191

Query: 189 SPTS-PEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVERIG 247
           +P   PE   APL+AL+ DS Y++Y GV+  +RI+ G +  GQ I++M T  +++V  +G
Sbjct: 192 APAGDPE---APLQALIFDSLYDAYRGVIAYIRIVEGTVKPGQKIKMMATGKEFEVLEVG 248

Query: 248 ILTPKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVVFCG 307
           + TPK +  + L  G++G + A+IK V  TRVGDTIT   +P   ALPG++ + P+V+CG
Sbjct: 249 VFTPKAMPTDELTVGDVGYLTAAIKNVGDTRVGDTITSAVNPAKEALPGYRKLNPMVYCG 308

Query: 308 LFPVDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERLERE 367
           L+P+D  ++ +LR A+ KL LND+S  +E E S ALGFGFRCGFLG+LH+EIIQER+ERE
Sbjct: 309 LYPIDTAKYNDLREALEKLELNDSSLQYEAETSQALGFGFRCGFLGMLHMEIIQERIERE 368

Query: 368 FSLNLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEYLGSI 427
           F ++LI T+PSV+Y++YM DG    + NP ++P+  KI ++ EP+++ T++ PN+Y+GS+
Sbjct: 369 FKIDLITTAPSVIYDVYMTDGEKIIVDNPSNLPDPQKIEKIEEPYVKATMMVPNDYVGSV 428

Query: 428 LKLCQERRGIQIDMSHLD-NRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDYRD 486
           ++LCQ +RG  IDM +LD NR  IVYE+PL E++++F+D LKS +KGYASFDY +I YR 
Sbjct: 429 MELCQGKRGHFIDMQYLDANRVSIVYEIPLAEIVYEFFDMLKSNTKGYASFDYELIGYRP 488

Query: 487 SDLVKLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGGRII 546
           S LVK+ I++N E IDALS +VHR  + +RG+ I EKLK LIP+Q F++ +QAAIG +I+
Sbjct: 489 STLVKMDIMLNGEKIDALSFIVHRDYAYERGKIIVEKLKELIPRQHFEVPVQAAIGQKIV 548

Query: 547 ARETVKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISILKTDN 605
           AR T+KA RK+V AKCYGGDI+RKRKLLEKQKEGKKRM++ G V++PQ AF+++LK D+
Sbjct: 549 ARSTIKAMRKNVLAKCYGGDISRKRKLLEKQKEGKKRMKQVGSVEVPQEAFMAVLKMDD 607


>gi|308174339|ref|YP_003921044.1| ribosomal elongation factor, GTPase [Bacillus amyloliquefaciens DSM
           7]
 gi|307607203|emb|CBI43574.1| ribosomal elongation factor, GTPase [Bacillus amyloliquefaciens DSM
           7]
          Length = 611

 Score =  741 bits (1912), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 336/599 (56%), Positives = 467/599 (77%), Gaps = 5/599 (0%)

Query: 9   SRIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVRL 68
           SRIRNFSI+AHIDHGKSTLADR ++    +T+REM  Q+LD+MD+ERERGITIK  +V+L
Sbjct: 12  SRIRNFSIIAHIDHGKSTLADRILEKTSAITQREMKEQLLDSMDLERERGITIKLNSVQL 71

Query: 69  NYTSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQAID 128
            Y + D ++Y  +LIDTPGHVDFTYEVSRSL+ACEG++LVVDA QG+EAQTLANVY A+D
Sbjct: 72  KYKAKDGEEYIFHLIDTPGHVDFTYEVSRSLAACEGAILVVDAAQGIEAQTLANVYLALD 131

Query: 129 NNHEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERIVQQLP 188
           N+ EI+ V+NK DLPSA+P+RV++++E+ IG+   DA+L SAK G GI  +LE+IV+++P
Sbjct: 132 NDLEILPVINKIDLPSAEPERVRQEVEDVIGLDASDAVLASAKAGIGIEDILEQIVEKVP 191

Query: 189 SPTS-PEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVERIG 247
           +P   PE   APLKAL+ DS Y++Y GV+  +R++ G +  GQ I++M T  +++V  +G
Sbjct: 192 APAGDPE---APLKALIFDSLYDAYRGVVAYIRVVEGTVKPGQKIKMMATGKEFEVIEVG 248

Query: 248 ILTPKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVVFCG 307
           + TPK    + L  G++G + A+IK V  TRVGDTIT    P   ALPG++ + P+V+CG
Sbjct: 249 VFTPKAQPADELTVGDVGYLTAAIKNVGDTRVGDTITSAVKPAAEALPGYRKLNPMVYCG 308

Query: 308 LFPVDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERLERE 367
           L+P+D  ++ +LR A+ KL LND+S  +E E S ALGFGFRCGFLG+LH+EIIQER+ERE
Sbjct: 309 LYPIDTAKYNDLREALEKLELNDSSLQYEAETSQALGFGFRCGFLGMLHMEIIQERIERE 368

Query: 368 FSLNLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEYLGSI 427
           F ++LI T+PSV+Y++YM DG    + NP +MP+  KI  + EP+++ T++ PN+Y+G++
Sbjct: 369 FKIDLITTAPSVIYDVYMTDGEKIIVDNPSNMPDPQKIERVEEPYVKATMMVPNDYVGAV 428

Query: 428 LKLCQERRGIQIDMSHLD-NRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDYRD 486
           ++LCQ +RG  IDM +LD NR  IVYE+PL E++++F+D+LKS +KGYASFDY +I Y+ 
Sbjct: 429 MELCQGKRGNFIDMQYLDANRVSIVYEMPLAEIVYEFFDQLKSSTKGYASFDYELIGYKP 488

Query: 487 SDLVKLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGGRII 546
           S LVK+ I++N E IDALS +VHR  + +RG+ I EKLK LIP+Q F++ +QAAIG +I+
Sbjct: 489 SKLVKMDIMLNAEKIDALSFIVHRDYAYERGKVIVEKLKELIPRQQFEVPVQAAIGQKIV 548

Query: 547 ARETVKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISILKTDN 605
           AR T+KA RK+V AKCYGGDI+RKRKLLEKQKEGK+RM++ G V++PQ AF+++LK D+
Sbjct: 549 ARSTIKAMRKNVLAKCYGGDISRKRKLLEKQKEGKRRMKQVGSVEVPQEAFMAVLKMDD 607


>gi|329767731|ref|ZP_08259247.1| GTP-binding protein lepA [Gemella haemolysans M341]
 gi|328838832|gb|EGF88426.1| GTP-binding protein lepA [Gemella haemolysans M341]
          Length = 605

 Score =  741 bits (1912), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 339/607 (55%), Positives = 477/607 (78%), Gaps = 3/607 (0%)

Query: 1   MQKKPTPLSRIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGIT 60
           M K+     +IRNFSI+AHIDHGKSTLADR ++  + L +REM +Q+LD+MDIERERGIT
Sbjct: 1   MDKRNERQKKIRNFSIIAHIDHGKSTLADRILEKTKALEQREMKAQLLDSMDIERERGIT 60

Query: 61  IKAQTVRLNYTSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTL 120
           IK   V+L YT+ + ++Y  +LIDTPGHVDFTYEVSRSL+ACEG++LVVDA QG+EAQTL
Sbjct: 61  IKLNAVQLQYTAKNGEEYIFHLIDTPGHVDFTYEVSRSLAACEGAILVVDAAQGIEAQTL 120

Query: 121 ANVYQAIDNNHEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLL 180
           ANVY A+DNN EII ++NK DLP+ADP++VK +IE+ IG+  +D +L SAK G GI  +L
Sbjct: 121 ANVYLALDNNLEIIPIINKIDLPAADPEKVKTEIEDVIGLPIDDIVLASAKAGIGIDEIL 180

Query: 181 ERIVQQLPSPTSPEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAK 240
           E+IV+ +P+P+    A  PL+AL+ DS Y++Y GV+V VRI NG +  G  I++M T   
Sbjct: 181 EQIVEYIPAPSG--DAAEPLQALIFDSLYDAYRGVIVSVRIKNGTVKAGDKIKMMATGGV 238

Query: 241 YQVERIGILTPKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPI 300
           ++V  +GI TPK   ++ L  G++G + ASIK VS TRVGDTIT  ++P   ALPG++ +
Sbjct: 239 FEVTEVGIHTPKEKIVDELTAGDVGFICASIKNVSETRVGDTITLANNPAKEALPGYRKL 298

Query: 301 QPVVFCGLFPVDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEII 360
            P+VFCGL+P+D++++ +LR A+ KL LND++  +E E S ALGFGFRCGFLG+LH+EII
Sbjct: 299 NPMVFCGLYPIDSSKYNDLREALEKLELNDSALQYEAETSQALGFGFRCGFLGMLHMEII 358

Query: 361 QERLEREFSLNLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITP 420
           QER+EREF++++I T+PSV+Y++   DG++  +SNP +MP+  KI ++ EP+++ +I+ P
Sbjct: 359 QERIEREFNIDIIATAPSVIYKVEKTDGTLVDVSNPSEMPDPQKINKITEPFVKASIMVP 418

Query: 421 NEYLGSILKLCQERRGIQIDMSHLDN-RAMIVYELPLNEVIFDFYDRLKSVSKGYASFDY 479
           N+Y+G+++ LCQ++RGI ++M ++D+ R  I Y++PL+E++FDF+D+LKS +KGYASFDY
Sbjct: 419 NDYVGAVMDLCQKKRGIFLNMEYIDDTRVNITYDIPLSEIVFDFFDQLKSNTKGYASFDY 478

Query: 480 NVIDYRDSDLVKLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQA 539
            +  Y+DS+LVK+ IL+N E +DALS +VHR  + +RG+ I EKLK LIP+Q F+I IQA
Sbjct: 479 ELTGYKDSNLVKMDILLNGEQVDALSFIVHREFAYQRGKVIVEKLKKLIPKQQFEIPIQA 538

Query: 540 AIGGRIIARETVKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFIS 599
           AIG +II+RET+KA RK+V AKCYGGDI+RKRKLLEKQK+GK+RM+  G V++PQ AF++
Sbjct: 539 AIGNKIISRETIKAMRKNVLAKCYGGDISRKRKLLEKQKKGKERMKAVGSVEVPQDAFMA 598

Query: 600 ILKTDNE 606
           +LK D E
Sbjct: 599 VLKMDEE 605


>gi|296333291|ref|ZP_06875744.1| GTP-binding protein LepA [Bacillus subtilis subsp. spizizenii ATCC
           6633]
 gi|305675204|ref|YP_003866876.1| ribosomal elongation factor, GTPase [Bacillus subtilis subsp.
           spizizenii str. W23]
 gi|296149489|gb|EFG90385.1| GTP-binding protein LepA [Bacillus subtilis subsp. spizizenii ATCC
           6633]
 gi|305413448|gb|ADM38567.1| ribosomal elongation factor, GTPase [Bacillus subtilis subsp.
           spizizenii str. W23]
          Length = 611

 Score =  740 bits (1911), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 335/599 (55%), Positives = 468/599 (78%), Gaps = 5/599 (0%)

Query: 9   SRIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVRL 68
           SRIRNFSI+AHIDHGKSTLADR ++    +T+REM  Q+LD+MD+ERERGITIK  +V+L
Sbjct: 12  SRIRNFSIIAHIDHGKSTLADRILEKTSAITQREMKEQLLDSMDLERERGITIKLNSVQL 71

Query: 69  NYTSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQAID 128
            Y + D ++Y  +LIDTPGHVDFTYEVSRSL+ACEG++LVVDA QG+EAQTLANVY A+D
Sbjct: 72  KYKAKDGEEYIFHLIDTPGHVDFTYEVSRSLAACEGAILVVDAAQGIEAQTLANVYLALD 131

Query: 129 NNHEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERIVQQLP 188
           N+ EI+ V+NK DLPSA+P+RV++++E+ IG+   +A+L SAK G GI  +LE+IV+++P
Sbjct: 132 NDLEILPVINKIDLPSAEPERVRQEVEDVIGLDASEAVLASAKAGIGIEEILEQIVEKVP 191

Query: 189 SPTS-PEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVERIG 247
           +PT  PE   APLKAL+ DS Y++Y GV+  +R++ G +  GQ I++M T  +++V  +G
Sbjct: 192 APTGDPE---APLKALIFDSLYDAYRGVVAYIRVVEGTVKPGQKIKMMATGKEFEVTEVG 248

Query: 248 ILTPKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVVFCG 307
           + TPK    + L  G++G + A+IK V  TRVGDTIT  +     ALPG++ + P+V+CG
Sbjct: 249 VFTPKATPTDELTVGDVGFLTAAIKNVGDTRVGDTITSAAEQAAEALPGYRKLNPMVYCG 308

Query: 308 LFPVDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERLERE 367
           L+P+D  ++ +LR A+ KL LND+S  +E E S ALGFGFRCGFLG+LH+EIIQER+ERE
Sbjct: 309 LYPIDTAKYNDLREALEKLELNDSSLQYEAETSQALGFGFRCGFLGMLHMEIIQERIERE 368

Query: 368 FSLNLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEYLGSI 427
           F ++LI T+PSV+Y++YM DG    + NP +MP+  KI  + EP+++ T++ PN+Y+G++
Sbjct: 369 FKIDLITTAPSVIYDVYMTDGEKVVVDNPSNMPDPQKIERIEEPYVKATMMVPNDYVGAV 428

Query: 428 LKLCQERRGIQIDMSHLD-NRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDYRD 486
           ++LCQ +RG  IDM +LD NR  IVY++PL E++++F+D+LKS +KGYASFDY +I Y+ 
Sbjct: 429 MELCQGKRGNFIDMQYLDANRVSIVYDMPLAEIVYEFFDQLKSSTKGYASFDYELIGYKP 488

Query: 487 SDLVKLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGGRII 546
           S LVK+ I++N E IDALS +VHR  + +RG+ I EKLK LIP+Q F++ IQAAIG +I+
Sbjct: 489 SKLVKMDIMLNGEKIDALSFIVHRDYAYERGKVIVEKLKELIPRQHFEVPIQAAIGQKIV 548

Query: 547 ARETVKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISILKTDN 605
           AR T+KA RK+V AKCYGGDI+RKRKLLEKQKEGK+RM++ G V++PQ AF+++LK D+
Sbjct: 549 ARSTIKAMRKNVLAKCYGGDISRKRKLLEKQKEGKRRMKQVGSVEVPQEAFMAVLKMDD 607


>gi|330502442|ref|YP_004379311.1| GTP-binding protein LepA [Pseudomonas mendocina NK-01]
 gi|328916728|gb|AEB57559.1| GTP-binding protein LepA [Pseudomonas mendocina NK-01]
          Length = 599

 Score =  740 bits (1911), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 347/599 (57%), Positives = 458/599 (76%), Gaps = 4/599 (0%)

Query: 8   LSRIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVR 67
           LS IRNFSI+AHIDHGKSTLADRFIQ C GL  REM +QVLD+MD+ERERGITIKA +V 
Sbjct: 4   LSHIRNFSIIAHIDHGKSTLADRFIQMCGGLAAREMEAQVLDSMDLERERGITIKAHSVT 63

Query: 68  LNYTSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQAI 127
           L+Y + D K YQLN IDTPGHVDFTYEVSRSL+ACEG+LLVVDA QGVEAQ++AN Y AI
Sbjct: 64  LHYKAKDGKTYQLNFIDTPGHVDFTYEVSRSLAACEGALLVVDAGQGVEAQSVANCYTAI 123

Query: 128 DNNHEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERIVQQL 187
           +   E++ VLNK DLP ADPDRVK +IE+ IGI   DA+  SAK+G G+  +LER+VQ +
Sbjct: 124 EQGLEVMPVLNKMDLPQADPDRVKDEIEKIIGIDATDAVACSAKSGMGVDEVLERLVQTI 183

Query: 188 PSPTSPEGA-NAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVERI 246
           P+P   EG  +APL+AL+IDSW+++YLGV+ LVR+  G++ KG  I +  T   + V+ +
Sbjct: 184 PAP---EGEIDAPLQALIIDSWFDNYLGVVSLVRVRQGRVKKGDKILVKSTGKVHLVDSV 240

Query: 247 GILTPKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVVFC 306
           G+ TPK      L  GE+G +IASIK++    VGDT+T  S+P    LPGFK IQP V+ 
Sbjct: 241 GVFTPKHTATADLKAGEVGFIIASIKDIHGAPVGDTLTLSSTPEVEVLPGFKKIQPQVYA 300

Query: 307 GLFPVDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERLER 366
           GLFPV +  FE+ R A+ KL LND+S  +  E+S ALGFGFRCGFLG+LH+EIIQERLER
Sbjct: 301 GLFPVSSDDFEDFRDALQKLTLNDSSLQYAPESSDALGFGFRCGFLGMLHMEIIQERLER 360

Query: 367 EFSLNLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEYLGS 426
           E+ L+LI T+PSV+YE+ +  G    + NP  +P+V+ +A+ REP +  TI+ P E+LG+
Sbjct: 361 EYDLDLITTAPSVIYEIELKTGETITVDNPSKLPDVSAVADFREPIVTATILVPQEHLGN 420

Query: 427 ILKLCQERRGIQIDMSHLDNRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDYRD 486
           ++ LC E+RG+Q DM  L ++  + Y+LP+NEV+ DF+DRLKS S+GYAS DY+   Y+ 
Sbjct: 421 VITLCIEKRGVQRDMQFLGSQVQVRYDLPMNEVVLDFFDRLKSTSRGYASLDYHFDRYQS 480

Query: 487 SDLVKLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGGRII 546
           ++LVKL +L+N + +DAL+++VHR  +  +GR + EK+K LIP+QMF +AIQAAIGG+II
Sbjct: 481 ANLVKLDVLINGDKVDALALIVHRDNAAYKGRALTEKMKELIPRQMFDVAIQAAIGGQII 540

Query: 547 ARETVKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISILKTDN 605
           AR TVKA RK+V AKCYGGD++RK+KLLEKQK GKKRM++ G V+IPQ AF+++L+ D+
Sbjct: 541 ARTTVKALRKNVLAKCYGGDVSRKKKLLEKQKAGKKRMKQVGNVEIPQEAFLAVLRLDS 599


>gi|138896081|ref|YP_001126534.1| GTP-binding protein LepA [Geobacillus thermodenitrificans NG80-2]
 gi|166223198|sp|A4IR35|LEPA_GEOTN RecName: Full=Elongation factor 4; Short=EF-4; AltName:
           Full=Ribosomal back-translocase LepA
 gi|134267594|gb|ABO67789.1| GTP-binding protein LepA [Geobacillus thermodenitrificans NG80-2]
          Length = 609

 Score =  740 bits (1910), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 337/598 (56%), Positives = 468/598 (78%), Gaps = 3/598 (0%)

Query: 10  RIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVRLN 69
           RIRNFSI+AHIDHGKSTLADR ++    L+ERE+  Q LD M++ERERGITIK   V+L 
Sbjct: 12  RIRNFSIIAHIDHGKSTLADRILEKTGALSERELREQTLDMMELERERGITIKLNAVQLT 71

Query: 70  YTSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQAIDN 129
           Y + + ++Y  +LIDTPGHVDFTYEVSRSL+ACEG++LVVDA QG+EAQTLANVY AIDN
Sbjct: 72  YKAKNGEEYIFHLIDTPGHVDFTYEVSRSLAACEGAILVVDAAQGIEAQTLANVYLAIDN 131

Query: 130 NHEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERIVQQLPS 189
           N EI+ V+NK DLPSA+P+RV+++IE+ IG+   +A+L SAK G G+  +L++IV+++P+
Sbjct: 132 NLEILPVINKIDLPSAEPERVRQEIEDVIGLDASEAVLASAKVGIGVEDILKQIVEKIPA 191

Query: 190 PTSPEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVERIGIL 249
           P+     +APLKAL+ DS Y+ Y GV+  VRI++G +  GQ I++M T  +++V  +G+ 
Sbjct: 192 PSG--DPDAPLKALIFDSLYDPYRGVVAYVRIVDGTVKPGQRIKMMSTGKEFEVTEVGVF 249

Query: 250 TPKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVVFCGLF 309
           TPK   ++ L  G++G + ASIK V  TRVGDTITD   P    LPG++ + P+VFCG++
Sbjct: 250 TPKPKVVDELMVGDVGYLTASIKNVQDTRVGDTITDAERPAAEPLPGYRKLNPMVFCGMY 309

Query: 310 PVDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERLEREFS 369
           P+D  ++ +LR A+ KL+LNDA+  FE E S ALGFGFRCGFLGLLH+EIIQER+EREF 
Sbjct: 310 PIDTARYNDLREALEKLQLNDAALHFEPETSQALGFGFRCGFLGLLHMEIIQERIEREFH 369

Query: 370 LNLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEYLGSILK 429
           ++LI T+PSVVY++Y+ DG+   + NP +MP+  KI  + EP+++ TI+ PN+Y+G +++
Sbjct: 370 IDLITTAPSVVYKVYLTDGTEVDVDNPTNMPDPQKIDRIEEPYVKATIMVPNDYVGPVME 429

Query: 430 LCQERRGIQIDMSHLD-NRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDYRDSD 488
           LCQ +RG  +DM +LD  R M++Y++PL+E+++DF+D LKS +KGYASFDY +I YR S+
Sbjct: 430 LCQGKRGTFVDMQYLDEKRVMLIYDIPLSEIVYDFFDALKSNTKGYASFDYELIGYRPSN 489

Query: 489 LVKLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGGRIIAR 548
           LVK+ IL+N E IDALS +VHR  + +RG+ I EKLK+LIP+Q F++ +QAAIG +IIAR
Sbjct: 490 LVKMDILLNGEKIDALSFIVHRDSAYERGKVIVEKLKDLIPRQQFEVPVQAAIGNKIIAR 549

Query: 549 ETVKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISILKTDNE 606
            T+KA RK+V AKCYGGD++RKRKLLEKQKEGKKRM++ G V++PQ AF+++LK D++
Sbjct: 550 STIKALRKNVLAKCYGGDVSRKRKLLEKQKEGKKRMKQIGSVEVPQEAFMAVLKIDDQ 607


>gi|224437455|ref|ZP_03658417.1| GTP-binding protein LepA [Helicobacter cinaedi CCUG 18818]
 gi|313143909|ref|ZP_07806102.1| GTP-binding protein lepA [Helicobacter cinaedi CCUG 18818]
 gi|313128940|gb|EFR46557.1| GTP-binding protein lepA [Helicobacter cinaedi CCUG 18818]
          Length = 605

 Score =  740 bits (1910), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 345/597 (57%), Positives = 469/597 (78%), Gaps = 5/597 (0%)

Query: 11  IRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVRLNY 70
           IRNFSI+AHIDHGKSTLADR IQ C  ++EREM++Q++D MDIE+ERGITIKAQ+VRL+Y
Sbjct: 12  IRNFSIIAHIDHGKSTLADRLIQECGAVSEREMTAQIMDTMDIEKERGITIKAQSVRLSY 71

Query: 71  TSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQAIDNN 130
                + Y LNLIDTPGHVDF+YEVSRSLS+CEG+LLVVDA+QGVEAQT+ANVY A++NN
Sbjct: 72  -PYKGQTYILNLIDTPGHVDFSYEVSRSLSSCEGALLVVDASQGVEAQTIANVYIAMENN 130

Query: 131 HEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERIVQQLPSP 190
            EII V+NK DLP+ADP +V + IE TIG+   +AL VSAK+GEGI  L+E I++++P+P
Sbjct: 131 LEIIPVINKIDLPAADPLKVAEDIESTIGLDCTEALKVSAKSGEGITALIESIIEKIPAP 190

Query: 191 TSPEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVERIGILT 250
                +NAP KAL+ DSW+++YLG + LVR++NG+L  GQ +++M +  KY+V  +    
Sbjct: 191 QG--DSNAPTKALIYDSWFDNYLGALALVRLVNGELRVGQEVQVMSSGKKYEVLALYYPH 248

Query: 251 P-KMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVVFCGLF 309
           P + I  + +  GEIG++   +K ++   VGDTITD  +PT   + GF+P +P VF G++
Sbjct: 249 PVQKIQTQNIACGEIGILSLGLKSLTDMAVGDTITDAKNPTQEPIEGFRPAKPFVFAGIY 308

Query: 310 PVDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERLEREFS 369
           P++  +FE LR A+NKL+LND++ SFE E S ALGFGFR GFLGLLH+E+++ERLEREF 
Sbjct: 309 PIETDKFEELRDALNKLKLNDSALSFEPETSVALGFGFRVGFLGLLHMEVVKERLEREFG 368

Query: 370 LNLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEYLGSILK 429
           L+LI T+P+VVYE+Y+ DGSM  + NP ++PEV KI  ++EP+++ +IITP+EYLG+I+ 
Sbjct: 369 LSLIATAPTVVYEVYLTDGSMVAVQNPSELPEVQKIESIKEPYVRASIITPSEYLGNIIT 428

Query: 430 LCQERRGIQIDMSHL-DNRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDYRDSD 488
           L   RRGIQ  M +L  +R M+VY LP NE++ DFYD+LKS +KGYASFDY  I+YR+ D
Sbjct: 429 LLSNRRGIQEKMDYLTQSRVMLVYALPSNEIVMDFYDKLKSCTKGYASFDYEPIEYREGD 488

Query: 489 LVKLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGGRIIAR 548
           LV+L I V  E +DALSI+V +S S ++GR + E +K ++P+Q+F++AIQA++G +IIAR
Sbjct: 489 LVRLDIRVAGEVVDALSIIVDKSKSYEKGRALVESMKEIVPRQLFEVAIQASVGNKIIAR 548

Query: 549 ETVKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISILKTDN 605
           ET+K+  K+VTAKCYGGDITRKRKLLEKQKEGKKRM+  G+V++PQ AF+++LK D 
Sbjct: 549 ETIKSMGKNVTAKCYGGDITRKRKLLEKQKEGKKRMKAIGKVELPQEAFLAVLKIDG 605


>gi|157693051|ref|YP_001487513.1| GTP-binding protein LepA [Bacillus pumilus SAFR-032]
 gi|166987748|sp|A8FFD6|LEPA_BACP2 RecName: Full=Elongation factor 4; Short=EF-4; AltName:
           Full=Ribosomal back-translocase LepA
 gi|157681809|gb|ABV62953.1| membrane GTPase LepA [Bacillus pumilus SAFR-032]
          Length = 612

 Score =  740 bits (1910), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 338/599 (56%), Positives = 469/599 (78%), Gaps = 5/599 (0%)

Query: 9   SRIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVRL 68
           SRIRNFSI+AHIDHGKSTLADR ++    +T+REM  Q+LD+MD+ERERGITIK  +V+L
Sbjct: 12  SRIRNFSIIAHIDHGKSTLADRILEKTAAITQREMKEQLLDSMDLERERGITIKLNSVQL 71

Query: 69  NYTSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQAID 128
            Y + D ++Y ++LIDTPGHVDFTYEVSRSL+ACEG++LVVDA QG+EAQTLANVY A+D
Sbjct: 72  KYKAKDGEEYIMHLIDTPGHVDFTYEVSRSLAACEGAILVVDAAQGIEAQTLANVYLALD 131

Query: 129 NNHEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERIVQQLP 188
           NN EI+ ++NK DLPSA+P+RV+ +IE+ IG+   +A+L SAK G GI  +LE+IV+++P
Sbjct: 132 NNLEILPIINKIDLPSAEPERVRGEIEDVIGLDASEAVLTSAKAGIGIEDILEQIVEKVP 191

Query: 189 SPTS-PEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVERIG 247
           +P   PE   APL+AL+ DS Y++Y GV+  +RI+ G +  GQ I++M T  +++V  +G
Sbjct: 192 APAGDPE---APLQALIFDSLYDAYRGVIAYIRIVEGTVKPGQKIKMMATGKEFEVLEVG 248

Query: 248 ILTPKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVVFCG 307
           + TPK +  + L  G++G + A+IK V  TRVGDTIT   +P   ALPG++ + P+V+CG
Sbjct: 249 VFTPKAMPTDELTVGDVGYLTAAIKNVGDTRVGDTITSAVNPAQEALPGYRKLNPMVYCG 308

Query: 308 LFPVDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERLERE 367
           L+P+D  ++ +LR A+ KL LND+S  +E E S ALGFGFRCGFLG+LH+EIIQER+ERE
Sbjct: 309 LYPIDTAKYNDLREALEKLELNDSSLQYEAETSQALGFGFRCGFLGMLHMEIIQERIERE 368

Query: 368 FSLNLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEYLGSI 427
           F ++LI T+PSV+Y++YM DG    + NP ++P+  KI  + EP+++ T++ PN+Y+GS+
Sbjct: 369 FKIDLITTAPSVIYDVYMTDGEKIVVDNPSNLPDPQKIERIEEPYVKATMMVPNDYVGSV 428

Query: 428 LKLCQERRGIQIDMSHLD-NRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDYRD 486
           ++LCQ +RG  IDM +LD NR  IVYE+PL E++++F+D+LKS +KGYASFDY +I YR 
Sbjct: 429 MELCQGKRGHFIDMQYLDANRVSIVYEIPLAEIVYEFFDQLKSNTKGYASFDYELIGYRP 488

Query: 487 SDLVKLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGGRII 546
           S LVK+ I++N E IDALS +VHR  + +RG+ I +KLK LIP+Q F++ IQAAIG +I+
Sbjct: 489 STLVKMDIMLNGEKIDALSFIVHRDYAYERGKIIVDKLKELIPRQHFEVPIQAAIGQKIV 548

Query: 547 ARETVKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISILKTDN 605
           AR T+KA RK+V AKCYGGDI+RKRKLLEKQKEGKKRM++ G V++PQ AF+++LK D+
Sbjct: 549 ARSTIKAMRKNVLAKCYGGDISRKRKLLEKQKEGKKRMKQVGSVEVPQEAFMAVLKMDD 607


>gi|82702874|ref|YP_412440.1| GTP-binding protein LepA [Nitrosospira multiformis ATCC 25196]
 gi|119371373|sp|Q2Y873|LEPA_NITMU RecName: Full=Elongation factor 4; Short=EF-4; AltName:
           Full=Ribosomal back-translocase LepA
 gi|82410939|gb|ABB75048.1| GTP-binding protein LepA [Nitrosospira multiformis ATCC 25196]
          Length = 597

 Score =  739 bits (1909), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 347/597 (58%), Positives = 463/597 (77%), Gaps = 4/597 (0%)

Query: 8   LSRIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVR 67
           +  IRNFSI+AHIDHGKSTLADR I  C GL++REM  QVLD+M++ERERGITIKAQT  
Sbjct: 1   MQHIRNFSIIAHIDHGKSTLADRIIHLCGGLSDREMEEQVLDSMELERERGITIKAQTAA 60

Query: 68  LNYTSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQAI 127
           L Y S D   Y LNLIDTPGHVDF+YEVSRSL+ACEG+LLVVDA+QGVEAQT+AN Y AI
Sbjct: 61  LEYKSRDGSSYLLNLIDTPGHVDFSYEVSRSLAACEGALLVVDASQGVEAQTVANCYTAI 120

Query: 128 DNNHEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERIVQQL 187
           +   E+I VLNK DLP+A+P+RV K+IE+ IGI  +DA+  SAKTG G+  +LE ++ ++
Sbjct: 121 EQGVEVIPVLNKIDLPAAEPERVIKEIEDIIGIEAQDAVRASAKTGVGVEDILEAVISRI 180

Query: 188 PSPT-SPEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVERI 246
           P P  +PE   APLKAL+IDSW+++Y+GV++LVR+++G L     I LM +   +  E++
Sbjct: 181 PPPKGNPE---APLKALIIDSWFDNYVGVVMLVRVMDGVLKPKDRILLMASKTTHLCEQV 237

Query: 247 GILTPKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVVFC 306
           G+ TPK  + E+L  GE+G +I+ IKE+   +VGDT+T    P    L GFK I+P VF 
Sbjct: 238 GVFTPKSRNRESLSAGEVGFIISGIKELKSAKVGDTVTLVDRPAPQPLLGFKEIKPQVFA 297

Query: 307 GLFPVDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERLER 366
           GL+PV++ Q++ LR A+ KL+LND+S  +E E S ALGFGFRCGFLGLLHL+I+QERLER
Sbjct: 298 GLYPVESNQYDALRDALEKLKLNDSSLQYEPETSQALGFGFRCGFLGLLHLDIVQERLER 357

Query: 367 EFSLNLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEYLGS 426
           E+ +NLI T+P+VVY++ + DGS+ ++ NP  +P+++KI ++REP I  TI+ P EY+GS
Sbjct: 358 EYDMNLITTAPTVVYQVVLRDGSVIEIENPSRLPDLSKIEQIREPIITATILVPQEYVGS 417

Query: 427 ILKLCQERRGIQIDMSHLDNRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDYRD 486
           ++ LC  +RGIQ +M ++  + M+ YE+PLNEV+ DF+DRLKS S+GYAS DY   ++R 
Sbjct: 418 VITLCISKRGIQKNMQYMGRQVMLTYEIPLNEVVMDFFDRLKSTSRGYASLDYEFKEFRA 477

Query: 487 SDLVKLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGGRII 546
           SDLVKL IL+N E +DALS++VHR+ S+ RGR + +K++ LIP+QMF IA+QAAIG  II
Sbjct: 478 SDLVKLDILINGERVDALSLIVHRASSQYRGRELAQKMRELIPRQMFDIAVQAAIGSHII 537

Query: 547 ARETVKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISILKT 603
           ARE++KA RK+V AKCYGGDITRKRKLLEKQK GKKRM++ G V+IPQ AF++IL+ 
Sbjct: 538 ARESIKALRKNVLAKCYGGDITRKRKLLEKQKAGKKRMKQVGNVEIPQEAFLAILQV 594


>gi|104783265|ref|YP_609763.1| GTP-binding protein LepA [Pseudomonas entomophila L48]
 gi|123079098|sp|Q1I5V6|LEPA_PSEE4 RecName: Full=Elongation factor 4; Short=EF-4; AltName:
           Full=Ribosomal back-translocase LepA
 gi|95112252|emb|CAK16979.1| GTP-binding protein LepA [Pseudomonas entomophila L48]
          Length = 599

 Score =  739 bits (1909), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 347/599 (57%), Positives = 458/599 (76%), Gaps = 4/599 (0%)

Query: 8   LSRIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVR 67
           LS IRNFSI+AHIDHGKSTLADRFIQ C GLT REM +QVLD+MD+ERERGITIKA +V 
Sbjct: 4   LSHIRNFSIIAHIDHGKSTLADRFIQMCGGLTAREMEAQVLDSMDLERERGITIKAHSVT 63

Query: 68  LNYTSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQAI 127
           L+Y + D K YQLN IDTPGHVDFTYEVSRSL+ACEG+LLVVDA QGVEAQ++AN Y AI
Sbjct: 64  LHYKAQDGKTYQLNFIDTPGHVDFTYEVSRSLAACEGALLVVDAGQGVEAQSVANCYTAI 123

Query: 128 DNNHEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERIVQQL 187
           +   E++ VLNK DLP ADPDRVK +IE+ IGI   DA+  SAK+G G+  +LER+VQ +
Sbjct: 124 EQGLEVMPVLNKMDLPQADPDRVKDEIEKIIGIDATDAVACSAKSGMGVDEVLERLVQSI 183

Query: 188 PSPTSPEGA-NAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVERI 246
           P+P   EG  +APL+AL+IDSW+++YLGV+ LVR+  G++ KG  I +  T   + V+ +
Sbjct: 184 PAP---EGEIDAPLQALIIDSWFDNYLGVVSLVRVRQGRVKKGDKILVKSTGKVHLVDSV 240

Query: 247 GILTPKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVVFC 306
           G+ TPK      L  GE+G +IASIK++    VGDT+T  ++P    LPGFK IQP V+ 
Sbjct: 241 GVFTPKHTQTADLKAGEVGFIIASIKDIHGAPVGDTLTLSNTPEVEVLPGFKKIQPQVYA 300

Query: 307 GLFPVDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERLER 366
           GLFPV +  FE+ R A+ KL LND+S  +  E+S ALGFGFRCGFLG+LH+EIIQERLER
Sbjct: 301 GLFPVSSDDFEDFRDALQKLTLNDSSLQYMPESSDALGFGFRCGFLGMLHMEIIQERLER 360

Query: 367 EFSLNLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEYLGS 426
           E+ L+LI T+PSV+YEL +  G    + NP  +P+V+ + + REP +  TI+ P E+LG+
Sbjct: 361 EYDLDLITTAPSVIYELELKTGETITVDNPSKLPDVSAVNDFREPIVTATILVPQEHLGN 420

Query: 427 ILKLCQERRGIQIDMSHLDNRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDYRD 486
           ++ LC E+RG+Q DM  L ++  + Y+LP+NEV+ DF+DRLKS S+GYAS DY+   Y+ 
Sbjct: 421 VITLCIEKRGVQRDMQFLGSQVQVRYDLPMNEVVLDFFDRLKSTSRGYASLDYHFDRYQS 480

Query: 487 SDLVKLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGGRII 546
           ++LVKL +L+N + +DAL+++VHR  +  +GR + EK+K LIP+QMF +AIQAAIGG+II
Sbjct: 481 ANLVKLDVLINGDKVDALALIVHRDNAAYKGRALTEKMKELIPRQMFDVAIQAAIGGQII 540

Query: 547 ARETVKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISILKTDN 605
           AR TVKA RK+V AKCYGGD++RK+KLLEKQK GKKRM++ G V+IPQ AF+++L+ D+
Sbjct: 541 ARTTVKALRKNVLAKCYGGDVSRKKKLLEKQKAGKKRMKQVGNVEIPQEAFLAVLRLDS 599


>gi|317401884|gb|EFV82491.1| GTP-binding protein lepA [Achromobacter xylosoxidans C54]
          Length = 597

 Score =  739 bits (1908), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 342/600 (57%), Positives = 464/600 (77%), Gaps = 4/600 (0%)

Query: 8   LSRIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVR 67
           +  IRNFSI+AHIDHGKSTLADR IQ C GL +REMS+QVLD+M+IERERGITIKAQT  
Sbjct: 1   MQHIRNFSIIAHIDHGKSTLADRLIQRCGGLADREMSAQVLDSMEIERERGITIKAQTAA 60

Query: 68  LNYTSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQAI 127
           L+Y + D K Y LNLIDTPGHVDF+YEVSRSLSACEG+LLVVDA+QGVEAQT+AN Y AI
Sbjct: 61  LHYKAQDGKIYNLNLIDTPGHVDFSYEVSRSLSACEGALLVVDASQGVEAQTVANCYTAI 120

Query: 128 DNNHEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERIVQQL 187
           +   E++ VLNK DLP ADPD  ++++E+ IGI    A+L SAKTG GI  +LE IV ++
Sbjct: 121 ELGVEVLPVLNKMDLPQADPDGARQEVEDVIGIDASQAVLASAKTGMGIDEILEAIVARV 180

Query: 188 PSPTS-PEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVERI 246
           P+P   PE   APL+AL+IDSW+++Y+GV++LVRI+NG L     I LM + A +  E+ 
Sbjct: 181 PAPQGDPE---APLQALIIDSWFDNYVGVVMLVRIVNGMLKPKDKILLMASGATHLCEQT 237

Query: 247 GILTPKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVVFC 306
           G+ TPK      L  GE+G +IA IK++   +VGDT+T  S P  + LPGFK ++P VF 
Sbjct: 238 GVFTPKSQQRPHLSAGEVGFIIAGIKQLEDAKVGDTVTLASKPAAAPLPGFKEVKPQVFA 297

Query: 307 GLFPVDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERLER 366
           GL+PV++++++ LR ++ KL+LNDA+  FE E S ALGFGFRCGFLGLLH+EI+QERLER
Sbjct: 298 GLYPVESSEYDQLRDSLEKLKLNDAALMFEPEVSQALGFGFRCGFLGLLHMEIVQERLER 357

Query: 367 EFSLNLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEYLGS 426
           EF +++I T+PSVVYE+   DGS+  + +P  MPE+ KIA++REP ++VT+  P +Y+G 
Sbjct: 358 EFDMDIITTAPSVVYEVEQRDGSVITVESPSRMPEIGKIADIREPIVKVTLFMPQDYVGP 417

Query: 427 ILKLCQERRGIQIDMSHLDNRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDYRD 486
           ++ LC  +RG+QI+MS+   +  +VYE+PL E++ DF+D+LKSVS+GYAS DY  ++YR 
Sbjct: 418 VMTLCNNKRGVQINMSYHGRQVHLVYEIPLAEIVLDFFDKLKSVSRGYASMDYEFLEYRS 477

Query: 487 SDLVKLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGGRII 546
           +D+V++ +L+NN+ +DAL+++VHRS +  R R +  +++ LIP+QMF + IQAAIG  II
Sbjct: 478 ADVVRVDLLINNDRVDALAVIVHRSNARHRARDVVTRMRGLIPRQMFDVVIQAAIGAEII 537

Query: 547 ARETVKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISILKTDNE 606
           ARE VKA RK+V AKCYGGDI+RK+KLLEKQK GKKRM++ G V+IPQ AF++IL+ +++
Sbjct: 538 ARENVKALRKNVLAKCYGGDISRKKKLLEKQKAGKKRMKQVGTVEIPQEAFLAILQVEDK 597


>gi|328554286|gb|AEB24778.1| GTP-binding protein LepA [Bacillus amyloliquefaciens TA208]
 gi|328912683|gb|AEB64279.1| ribosomal elongation factor, GTPase [Bacillus amyloliquefaciens
           LL3]
          Length = 611

 Score =  739 bits (1908), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 335/599 (55%), Positives = 467/599 (77%), Gaps = 5/599 (0%)

Query: 9   SRIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVRL 68
           SRIRNFSI+AHIDHGKSTLADR ++    +T+REM  Q+LD+MD+ERERGITIK  +V+L
Sbjct: 12  SRIRNFSIIAHIDHGKSTLADRILEKTSAITQREMKEQLLDSMDLERERGITIKLNSVQL 71

Query: 69  NYTSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQAID 128
            Y + D ++Y  +LIDTPGHVDFTYEVSRSL+ACEG++LVVDA QG+EAQTLANVY A+D
Sbjct: 72  KYKAKDGEEYIFHLIDTPGHVDFTYEVSRSLAACEGAILVVDAAQGIEAQTLANVYLALD 131

Query: 129 NNHEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERIVQQLP 188
           N+ EI+ V+NK DLPSA+P+RV++++E+ IG+   +A+L SAK G GI  +LE+IV+++P
Sbjct: 132 NDLEILPVINKIDLPSAEPERVRQEVEDVIGLDASEAVLASAKAGIGIEDILEQIVEKVP 191

Query: 189 SPTS-PEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVERIG 247
           +P   PE   APLKAL+ DS Y++Y GV+  +R++ G +  GQ I++M T  +++V  +G
Sbjct: 192 APAGDPE---APLKALIFDSLYDAYRGVVAYIRVVEGTVKPGQKIKMMATGKEFEVIEVG 248

Query: 248 ILTPKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVVFCG 307
           + TPK    + L  G++G + A+IK V  TRVGDTIT    P   ALPG++ + P+V+CG
Sbjct: 249 VFTPKAQPADELTVGDVGYLTAAIKNVGDTRVGDTITSAVKPAAEALPGYRKLNPMVYCG 308

Query: 308 LFPVDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERLERE 367
           L+P+D  ++ +LR A+ KL LND+S  +E E S ALGFGFRCGFLG+LH+EIIQER+ERE
Sbjct: 309 LYPIDTAKYNDLREALEKLELNDSSLQYEAETSQALGFGFRCGFLGMLHMEIIQERIERE 368

Query: 368 FSLNLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEYLGSI 427
           F ++LI T+PSV+Y++YM DG    + NP +MP+  KI  + EP+++ T++ PN+Y+G++
Sbjct: 369 FKIDLITTAPSVIYDVYMTDGEKIIVDNPSNMPDPQKIERVEEPYVKATMMVPNDYVGAV 428

Query: 428 LKLCQERRGIQIDMSHLD-NRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDYRD 486
           ++LCQ +RG  IDM +LD NR  IVYE+PL E++++F+D+LKS +KGYASFDY +I Y+ 
Sbjct: 429 MELCQGKRGNFIDMQYLDANRVSIVYEMPLAEIVYEFFDQLKSSTKGYASFDYELIGYKP 488

Query: 487 SDLVKLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGGRII 546
           S LVK+ I++N E IDALS +VHR  + +RG+ I EKLK LIP+Q F++ +QAAIG +I+
Sbjct: 489 SKLVKMDIMLNAEKIDALSFIVHRDYAYERGKVIVEKLKELIPRQQFEVPVQAAIGQKIV 548

Query: 547 ARETVKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISILKTDN 605
           AR T+KA RK+V AKCYGGDI+RKRKLLEKQKEGK+RM++ G V++PQ AF+++LK D+
Sbjct: 549 ARSTIKAMRKNVLAKCYGGDISRKRKLLEKQKEGKRRMKQVGSVEVPQEAFMAVLKMDD 607


>gi|78065716|ref|YP_368485.1| GTP-binding protein LepA [Burkholderia sp. 383]
 gi|90185145|sp|Q39I75|LEPA_BURS3 RecName: Full=Elongation factor 4; Short=EF-4; AltName:
           Full=Ribosomal back-translocase LepA
 gi|77966461|gb|ABB07841.1| GTP-binding protein LepA [Burkholderia sp. 383]
          Length = 597

 Score =  739 bits (1908), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 341/599 (56%), Positives = 461/599 (76%), Gaps = 2/599 (0%)

Query: 8   LSRIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVR 67
           +  IRNFSI+AHIDHGKSTLADR IQ C GL +REM +QVLD+MDIERERGITIKAQT  
Sbjct: 1   MDHIRNFSIIAHIDHGKSTLADRIIQVCGGLADREMEAQVLDSMDIERERGITIKAQTAA 60

Query: 68  LNYTSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQAI 127
           L+Y + D K Y LNLIDTPGHVDF+YEVSRSLSACEG+LLVVDA+QGVEAQT+AN Y AI
Sbjct: 61  LSYRARDGKVYNLNLIDTPGHVDFSYEVSRSLSACEGALLVVDASQGVEAQTVANCYTAI 120

Query: 128 DNNHEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERIVQQL 187
           +   E++ VLNK DLP+A+P+   ++IE+ IGI   DA   SAKTG G+  +LE ++ ++
Sbjct: 121 ELGVEVVPVLNKIDLPAANPENAIEEIEDVIGIDATDATRCSAKTGLGVEDVLESLIAKV 180

Query: 188 PSPTSPEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVERIG 247
           P P     A  PL+AL+IDSW+++Y+GV++LVRI+NG L     I+LM T A+Y VE IG
Sbjct: 181 PPPKGDPAA--PLQALIIDSWFDNYVGVVMLVRIVNGTLRPKDKIKLMATGAQYPVEHIG 238

Query: 248 ILTPKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVVFCG 307
           + TPK  ++E L  G++G +IA IKE++  +VGDT+T  +      LPGFK ++P VF G
Sbjct: 239 VFTPKSRNLETLSAGQVGFIIAGIKELTAAKVGDTVTHATKAAVEPLPGFKEVKPQVFAG 298

Query: 308 LFPVDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERLERE 367
           L+PV+A Q++ LR ++ KL+LNDAS  +E E S ALGFGFRCGFLGLLH+EI+QERLERE
Sbjct: 299 LYPVEANQYDALRESLEKLKLNDASLQYEPEVSQALGFGFRCGFLGLLHMEIVQERLERE 358

Query: 368 FSLNLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEYLGSI 427
           F ++LI T+P+VVYE+ M DG++ K+ NP  MPE  +I E+REP + V +  P +Y+GS+
Sbjct: 359 FDMDLITTAPTVVYEVMMSDGAIIKVENPAKMPEPPRIEEIREPIVTVNLYMPQDYVGSV 418

Query: 428 LKLCQERRGIQIDMSHLDNRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDYRDS 487
           + LC+++RG QI+M +   +  + YE+P+ E++ DF+DRLKSVS+GYAS DY   +YR +
Sbjct: 419 ITLCEQKRGSQINMQYHGRQVQLTYEIPMAEIVLDFFDRLKSVSRGYASMDYEFKEYRAA 478

Query: 488 DLVKLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGGRIIA 547
           D+VK+ +L+N + +DALS++VHRS S+ RGR +  K++ +IP+QM+ +AIQA IG  IIA
Sbjct: 479 DVVKVDMLINGDKVDALSVIVHRSQSQYRGREVAAKMREIIPRQMYDVAIQATIGAHIIA 538

Query: 548 RETVKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISILKTDNE 606
           RE +KA RK+V AKCYGGDI+RK+KLLEKQK GKKRM++ G V+IPQ AF++IL+ +++
Sbjct: 539 RENIKALRKNVLAKCYGGDISRKKKLLEKQKAGKKRMKQVGSVEIPQEAFLAILRVEDK 597


>gi|226943495|ref|YP_002798568.1| GTP-binding protein LepA [Azotobacter vinelandii DJ]
 gi|259494304|sp|C1DQS0|LEPA_AZOVD RecName: Full=Elongation factor 4; Short=EF-4; AltName:
           Full=Ribosomal back-translocase LepA
 gi|226718422|gb|ACO77593.1| GTP-binding protein LepA [Azotobacter vinelandii DJ]
          Length = 599

 Score =  739 bits (1908), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 344/598 (57%), Positives = 462/598 (77%), Gaps = 2/598 (0%)

Query: 8   LSRIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVR 67
           LS IRNFSI+AHIDHGKSTLADRFIQ C GL+EREM +QVLD+MD+ERERGITIKA +V 
Sbjct: 4   LSHIRNFSIIAHIDHGKSTLADRFIQICGGLSEREMEAQVLDSMDLERERGITIKAHSVT 63

Query: 68  LNYTSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQAI 127
           L+Y + D K YQLN IDTPGHVDFTYEVSRSL+ACEG+LLVVDA QGVEAQ++AN Y AI
Sbjct: 64  LHYKAQDGKTYQLNFIDTPGHVDFTYEVSRSLAACEGALLVVDAGQGVEAQSVANCYTAI 123

Query: 128 DNNHEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERIVQQL 187
           +   E++ VLNK DLP A+P+RVK +IE  IGI   DA+L SAK+G G+P +LE +V+ +
Sbjct: 124 EQGLEVMPVLNKMDLPQAEPERVKDEIEHIIGIDAGDAVLCSAKSGMGVPDVLEHLVRVI 183

Query: 188 PSPTSPEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVERIG 247
           P P       APL+AL+IDSW+++YLGV+ LVR+ +G++ KG  I +  T   +QV+ +G
Sbjct: 184 PPPQGE--IEAPLQALIIDSWFDNYLGVVSLVRVKHGRVKKGDKILVKSTGKVHQVDSVG 241

Query: 248 ILTPKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVVFCG 307
           + TPK  ++  L  GE+G +IA IK++    VGDT+T  S+P    LPGF+ I+P V+ G
Sbjct: 242 VFTPKHTEMPDLKAGEVGFIIAGIKDIHGAPVGDTLTLSSTPNVDMLPGFQRIKPQVYAG 301

Query: 308 LFPVDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERLERE 367
           LFPV +  FE+ R A+ KL LNDA+  +E E+S ALGFGFR GFLG+LH+EIIQERLERE
Sbjct: 302 LFPVSSDDFEDFREALQKLTLNDAALQYEPESSDALGFGFRIGFLGMLHMEIIQERLERE 361

Query: 368 FSLNLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEYLGSI 427
           + L+LI T+P+VVYE+ + +G    + NP  +P++  IAE+REP ++  I+ P E+LG++
Sbjct: 362 YDLDLITTAPTVVYEVLLKNGDTICVDNPSKLPDLASIAEMREPIVRANILVPQEHLGNV 421

Query: 428 LKLCQERRGIQIDMSHLDNRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDYRDS 487
           + LC E+RG+Q DM  L ++  I Y+LP+NEV+ DF+DRLKSVS+GYAS DY+   ++ +
Sbjct: 422 INLCIEKRGVQRDMQFLSSQVQISYDLPMNEVVLDFFDRLKSVSRGYASLDYSFDRFQVA 481

Query: 488 DLVKLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGGRIIA 547
           +LVKL +L+N + +DAL+++VHR  + ++GR + EK+K LIP+QMF +AIQAAIGG+++A
Sbjct: 482 NLVKLDVLINGDKVDALALIVHRDKAHQKGRALTEKMKELIPRQMFDVAIQAAIGGQVVA 541

Query: 548 RETVKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISILKTDN 605
           R TVKA RK+V AKCYGGD+TRKRKLLEKQK GKKRM++ G V+IPQ AF+++LK D+
Sbjct: 542 RTTVKALRKNVLAKCYGGDVTRKRKLLEKQKAGKKRMKQVGSVEIPQEAFLAVLKVDS 599


>gi|91775213|ref|YP_544969.1| GTP-binding protein LepA [Methylobacillus flagellatus KT]
 gi|91775357|ref|YP_545113.1| GTP-binding protein LepA [Methylobacillus flagellatus KT]
 gi|119371366|sp|Q1H2L5|LEPA_METFK RecName: Full=Elongation factor 4; Short=EF-4; AltName:
           Full=Ribosomal back-translocase LepA
 gi|91709200|gb|ABE49128.1| Small GTP-binding protein domain [Methylobacillus flagellatus KT]
 gi|91709344|gb|ABE49272.1| GTP-binding protein LepA [Methylobacillus flagellatus KT]
          Length = 597

 Score =  739 bits (1907), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 352/600 (58%), Positives = 469/600 (78%), Gaps = 4/600 (0%)

Query: 8   LSRIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVR 67
           +  IRNFSI+AHIDHGKSTLADR IQ C GL++REM +QVLD+MDIERERGITIKAQT  
Sbjct: 1   MKNIRNFSIIAHIDHGKSTLADRIIQLCGGLSDREMEAQVLDSMDIERERGITIKAQTAA 60

Query: 68  LNYTSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQAI 127
           L Y + D + Y LNLIDTPGHVDF+YEVSRSL+ACEG+LLVVDA+QGVEAQ++AN Y AI
Sbjct: 61  LEYKALDGQVYNLNLIDTPGHVDFSYEVSRSLAACEGALLVVDASQGVEAQSVANCYTAI 120

Query: 128 DNNHEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERIVQQL 187
           D   E++ VLNK DLP+ADP+RV ++IE+ IG+   +A+  SAKTG G+  +LE ++ ++
Sbjct: 121 DQGVEVVPVLNKIDLPAADPERVMQEIEDVIGVDASEAVRCSAKTGVGVQDVLETMIAKI 180

Query: 188 PSPTS-PEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVERI 246
           P P   PE    PLKAL+IDSW+++Y+GV++LVR+++G L     IR+M T A Y  E++
Sbjct: 181 PPPVGDPE---KPLKALIIDSWFDNYVGVIMLVRVVDGVLKPKDKIRMMATKATYLCEQV 237

Query: 247 GILTPKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVVFC 306
           G+ TPK     +L  GE+G +IA IKE++  +VGDT+T    P + ALPGFK ++P VF 
Sbjct: 238 GVFTPKSRPRASLSAGEVGFIIAGIKELTSAKVGDTVTLADRPASEALPGFKEVKPQVFA 297

Query: 307 GLFPVDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERLER 366
           GL+PV++ QFE LR A+ KLRLNDAS  FE ENS+ALGFGFRCGFLGLLH+EI+QERLER
Sbjct: 298 GLYPVESNQFEALREALEKLRLNDASLQFEPENSSALGFGFRCGFLGLLHMEIVQERLER 357

Query: 367 EFSLNLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEYLGS 426
           E+ ++LI T+P+VVYEL +  G + ++ NP  +PE ++I E+REP I + ++ P +Y+G 
Sbjct: 358 EYDMDLITTAPTVVYELLLKSGEVVQIENPSRLPEPSRITEIREPIITINLLMPQDYVGP 417

Query: 427 ILKLCQERRGIQIDMSHLDNRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDYRD 486
           ++ LC  +RG+Q +M ++  + M+ YE+PLNEV+ DF+DRLKSVS+GYAS DY  +++R 
Sbjct: 418 VMTLCNNKRGVQRNMQYMGRQVMLSYEMPLNEVVLDFFDRLKSVSRGYASMDYEFLEFRA 477

Query: 487 SDLVKLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGGRII 546
           +DLVKL I+VN E +DALS++VHRS S  RGR +  K++ LIP+QMF IA+QA+IG  II
Sbjct: 478 ADLVKLDIMVNGERVDALSLIVHRSNSVYRGRELVSKMRELIPRQMFDIAVQASIGANII 537

Query: 547 ARETVKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISILKTDNE 606
           ARETVKA RK+V AKCYGGDITRK+KLLEKQKEGKKRM++ G V+IPQ AF++IL+ +++
Sbjct: 538 ARETVKAMRKNVLAKCYGGDITRKKKLLEKQKEGKKRMKQVGNVEIPQEAFLAILRVEDK 597


>gi|288555674|ref|YP_003427609.1| GTP-binding protein LepA [Bacillus pseudofirmus OF4]
 gi|288546834|gb|ADC50717.1| GTP-binding protein LepA [Bacillus pseudofirmus OF4]
          Length = 606

 Score =  739 bits (1907), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 338/596 (56%), Positives = 464/596 (77%), Gaps = 3/596 (0%)

Query: 10  RIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVRLN 69
           +IRNFSI+AHIDHGKSTLADR ++    LT+REM  Q LD MD+ERERGITIK   V+L 
Sbjct: 12  KIRNFSIIAHIDHGKSTLADRILEKTGALTDREMKDQTLDAMDLERERGITIKLNAVQLT 71

Query: 70  YTSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQAIDN 129
           YT+ D ++Y  +LIDTPGHVDFTYEVSRSL+ACEG+LL+VD+ QG+EAQTLANVY A+DN
Sbjct: 72  YTAKDGEEYIFHLIDTPGHVDFTYEVSRSLAACEGALLIVDSAQGIEAQTLANVYLALDN 131

Query: 130 NHEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERIVQQLPS 189
           + EI+ V+NK DLPSA+P+RVK+++E+ IG+   DA+L SAK G GI  +LE++V+++P+
Sbjct: 132 DLEILPVINKIDLPSAEPERVKQEVEDVIGLDASDAVLASAKNGIGIEEILEQVVEKVPA 191

Query: 190 PTSPEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVERIGIL 249
           PT     NAPLKAL+ DS Y+SY GV+  +RII+G +  GQ I++M T  +++V  IG+ 
Sbjct: 192 PTG--DPNAPLKALIFDSLYDSYRGVVAYIRIIDGTVKPGQKIKMMATGKEFEVTEIGVF 249

Query: 250 TPKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVVFCGLF 309
           TPK    + L  G++G + A+IK V  TRVGDTIT+  +P +  LPG++ + P+V+CGL+
Sbjct: 250 TPKAEKRDELTVGDVGFLTAAIKNVGDTRVGDTITNAVNPASEPLPGYRRMNPMVYCGLY 309

Query: 310 PVDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERLEREFS 369
           P+D   + +LR A+ +L LNDAS  +E E S ALGFGFRCGFLGLLH+EIIQER+EREF 
Sbjct: 310 PIDTNDYNDLREALERLELNDASLQYEPETSQALGFGFRCGFLGLLHMEIIQERIEREFG 369

Query: 370 LNLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEYLGSILK 429
           ++LI T+PSVVY++ +  G   ++ NP +MP+  KI  + EP+++  ++ PN+Y+GS+++
Sbjct: 370 ISLITTAPSVVYKVQLTSGEDLQIDNPSNMPDAQKIDYVEEPYVKAKVMVPNDYVGSVME 429

Query: 430 LCQERRGIQIDMSHLD-NRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDYRDSD 488
           LCQ +RGI IDM +LD NR  IVYE+PL+E+++DF+D+LKS +KGYASFDY +I Y+ S 
Sbjct: 430 LCQGKRGIFIDMQYLDENRVQIVYEIPLSEIVYDFFDQLKSNTKGYASFDYELIGYKQSK 489

Query: 489 LVKLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGGRIIAR 548
           LVK+ IL+N E +DALS++VHR  +  RG+ I EKLK LIP+Q F++ +QA+IG ++IAR
Sbjct: 490 LVKMDILLNGEKVDALSVIVHRDSAYDRGKIIVEKLKELIPRQQFEVPVQASIGQKVIAR 549

Query: 549 ETVKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISILKTD 604
            T+KA RK+V AKCYGGDI+RKRKLLEKQKEGKKRM+  G V++PQ AF+++L+ D
Sbjct: 550 STIKAMRKNVLAKCYGGDISRKRKLLEKQKEGKKRMKSVGNVEVPQEAFMAVLRMD 605


>gi|52786478|ref|YP_092307.1| GTP-binding protein LepA [Bacillus licheniformis ATCC 14580]
 gi|163119557|ref|YP_079891.2| GTP-binding protein LepA [Bacillus licheniformis ATCC 14580]
 gi|319644943|ref|ZP_07999176.1| GTP-binding protein lepA [Bacillus sp. BT1B_CT2]
 gi|81609042|sp|Q65H50|LEPA_BACLD RecName: Full=Elongation factor 4; Short=EF-4; AltName:
           Full=Ribosomal back-translocase LepA
 gi|52348980|gb|AAU41614.1| LepA [Bacillus licheniformis ATCC 14580]
 gi|145903066|gb|AAU24253.2| GTP-binding protein [Bacillus licheniformis ATCC 14580]
 gi|317392752|gb|EFV73546.1| GTP-binding protein lepA [Bacillus sp. BT1B_CT2]
          Length = 612

 Score =  739 bits (1907), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 332/599 (55%), Positives = 471/599 (78%), Gaps = 5/599 (0%)

Query: 9   SRIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVRL 68
           SRIRNFSI+AHIDHGKSTLADR ++    +T+REM  Q+LD+MD+ERERGITIK  +V+L
Sbjct: 12  SRIRNFSIIAHIDHGKSTLADRILEKTAAITQREMKEQLLDSMDLERERGITIKLNSVQL 71

Query: 69  NYTSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQAID 128
            Y + D ++Y  +LIDTPGHVDFTYEVSRSL+ACEG++LVVDA QG+EAQTLANVY A+D
Sbjct: 72  KYQAKDGEEYIFHLIDTPGHVDFTYEVSRSLAACEGAILVVDAAQGIEAQTLANVYLALD 131

Query: 129 NNHEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERIVQQLP 188
           N+ EI+ V+NK DLPSA+P+RV++++E+ IG+   +A+L SAK G GI  +LE+IV+++P
Sbjct: 132 NDLEILPVINKIDLPSAEPERVRQEVEDVIGLDASEAVLASAKAGIGIEEILEQIVEKVP 191

Query: 189 SPTS-PEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVERIG 247
           +P+  PE   APL+AL+ DS Y++Y GV+  +R++ G +  GQ I++M T  +++V  +G
Sbjct: 192 APSGDPE---APLQALIFDSLYDAYRGVVAYIRVVQGTVKAGQKIKMMATGKEFEVTEVG 248

Query: 248 ILTPKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVVFCG 307
           + TPK +  + L  G++G + A+IK V  TRVGDTIT   +P   ALPG++ + P+V+CG
Sbjct: 249 VFTPKAVPADELTVGDVGFLTAAIKNVGDTRVGDTITSAENPAPEALPGYRKLNPMVYCG 308

Query: 308 LFPVDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERLERE 367
           L+P+D  ++ +LR A+ KL LND++  +E E S ALGFGFRCGFLG+LH+EIIQER+ERE
Sbjct: 309 LYPIDTAKYNDLREALEKLELNDSALQYEAETSQALGFGFRCGFLGMLHMEIIQERIERE 368

Query: 368 FSLNLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEYLGSI 427
           F+++LI T+PSV+Y++YM DG    + NP +MP+  KI  + EP+++ T++ PN+++G++
Sbjct: 369 FNIDLITTAPSVIYDVYMTDGEKIVVDNPSNMPDPQKIDRVEEPFVKATMMVPNDFVGAV 428

Query: 428 LKLCQERRGIQIDMSHLD-NRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDYRD 486
           ++LCQ +RG  IDM +LD NR  IVYE+PL E++++F+D+LKS +KGYASFDY +I Y+ 
Sbjct: 429 MELCQGKRGQFIDMQYLDANRVSIVYEIPLAEIVYEFFDQLKSNTKGYASFDYELIGYKP 488

Query: 487 SDLVKLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGGRII 546
           S LVK+ I++N E IDALS +VHR  + +RG+ I EKLK LIP+Q F++ +QAAIG +I+
Sbjct: 489 SKLVKMDIMLNGEKIDALSFIVHRDYAYERGKVIVEKLKELIPRQQFEVPVQAAIGTKIV 548

Query: 547 ARETVKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISILKTDN 605
           AR T+KA RK+V AKCYGGDI+RKRKLLEKQKEGK+RM++ G V++PQ AF+++LK D+
Sbjct: 549 ARSTIKAMRKNVLAKCYGGDISRKRKLLEKQKEGKRRMKQVGSVEVPQEAFMAVLKMDD 607


>gi|330828480|ref|YP_004391432.1| membrane GTPase LepA [Aeromonas veronii B565]
 gi|328803616|gb|AEB48815.1| Membrane GTPase LepA [Aeromonas veronii B565]
          Length = 597

 Score =  739 bits (1907), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 345/595 (57%), Positives = 457/595 (76%), Gaps = 4/595 (0%)

Query: 8   LSRIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVR 67
           +  IRNFSI+AHIDHGKSTL+DR IQ C GL++REM +QVLD+MD+ERERGITIKAQ+V 
Sbjct: 1   MKHIRNFSIIAHIDHGKSTLSDRLIQTCGGLSDREMQAQVLDSMDLERERGITIKAQSVT 60

Query: 68  LNYTSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQAI 127
           LNY + D   YQLN IDTPGHVDF+YEVSRSL+ACEG+LLVVDA QGVEAQTLAN Y A+
Sbjct: 61  LNYQAQDGNTYQLNFIDTPGHVDFSYEVSRSLAACEGALLVVDAGQGVEAQTLANCYTAM 120

Query: 128 DNNHEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERIVQQL 187
           + + E++ VLNK DLP+A+P+RV ++IE+ +GI   DA+  SAKTG G+ L+LE IV ++
Sbjct: 121 EMDLEVVPVLNKIDLPAAEPERVAEEIEDIVGIDAVDAVRCSAKTGLGVDLVLEEIVAKI 180

Query: 188 PSPTSPEG-ANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVERI 246
           P+P   EG  +APL+AL+IDSW++SYLGV+ LVRI NG L K   I++M T   + V+RI
Sbjct: 181 PAP---EGDPDAPLQALIIDSWFDSYLGVVSLVRIKNGSLKKNDKIKVMSTGQVWGVDRI 237

Query: 247 GILTPKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVVFC 306
           GI TPK +D + L  GE+G ++  IK++    VGDT+T   +    AL GFK ++P V+ 
Sbjct: 238 GIFTPKQVDTQGLGCGEVGWVVCGIKDIHGAPVGDTLTQAKNGADKALAGFKKVKPQVYA 297

Query: 307 GLFPVDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERLER 366
           GLFP+ +  +E+ R A++KL LNDAS  FE E+STALGFGFRCGFLG+LH+EIIQERLER
Sbjct: 298 GLFPISSDDYESFRDALDKLSLNDASLFFEPESSTALGFGFRCGFLGMLHMEIIQERLER 357

Query: 367 EFSLNLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEYLGS 426
           E+ L+LI T+P+VVYE+ + DGS   + +P  MP +T I E+REP  +  I+ P EY+G+
Sbjct: 358 EYDLDLITTAPTVVYEIELTDGSTIHIDSPAQMPAITSIKEMREPIAECHILLPQEYMGN 417

Query: 427 ILKLCQERRGIQIDMSHLDNRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDYRD 486
           ++ LC E+RG+Q +M +   +  + YE+P+ EV+ DF+DRLKS S+GYAS DY    +  
Sbjct: 418 VITLCIEKRGVQTNMVYHGKQVALTYEIPMAEVVLDFFDRLKSTSRGYASLDYGFKRFET 477

Query: 487 SDLVKLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGGRII 546
           SD+V+L I++N E +DAL+I+ H+  ++ RGR + EK++ LIP+QMF IAIQAAIG +II
Sbjct: 478 SDMVRLDIMINGERVDALAIITHKDNAQYRGRQVVEKMRELIPRQMFDIAIQAAIGNQII 537

Query: 547 ARETVKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISIL 601
           AR TVKA RKDVTAKCYGGD++RK+KLL KQKEGKKRM+  GRVD+PQ AF++IL
Sbjct: 538 ARSTVKALRKDVTAKCYGGDVSRKKKLLNKQKEGKKRMKSLGRVDVPQEAFLAIL 592


>gi|33593417|ref|NP_881061.1| GTP-binding protein LepA [Bordetella pertussis Tohama I]
 gi|34978364|sp|P56865|LEPA_BORPE RecName: Full=Elongation factor 4; Short=EF-4; AltName:
           Full=Ribosomal back-translocase LepA
 gi|33572773|emb|CAE42705.1| GTP-binding protein [Bordetella pertussis Tohama I]
 gi|332382826|gb|AEE67673.1| GTP-binding protein LepA [Bordetella pertussis CS]
          Length = 597

 Score =  738 bits (1906), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 339/599 (56%), Positives = 459/599 (76%), Gaps = 2/599 (0%)

Query: 8   LSRIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVR 67
           +  IRNFSI+AHIDHGKSTLADR I  C GL EREMS+QVLD+MDIERERGITIKAQT  
Sbjct: 1   MQHIRNFSIIAHIDHGKSTLADRLIHRCGGLAEREMSAQVLDSMDIERERGITIKAQTAS 60

Query: 68  LNYTSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQAI 127
           L Y S D   Y LNLIDTPGHVDF+YEVSRSLSACEG+LLVVDA+QGVEAQT+AN Y AI
Sbjct: 61  LQYKSQDGTVYNLNLIDTPGHVDFSYEVSRSLSACEGALLVVDASQGVEAQTVANCYTAI 120

Query: 128 DNNHEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERIVQQL 187
           +   E++ VLNK DLP ADP+  ++++E+ IGI   +A+L SAKTG GI  +LE IV ++
Sbjct: 121 ELGMEVLPVLNKMDLPQADPEAARQEVEDVIGIDASEAVLASAKTGMGIDEILESIVARV 180

Query: 188 PSPTSPEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVERIG 247
           P P      +APL+AL+IDSW+++Y+GV++LVRI+NG L     I LM ++A +  E+IG
Sbjct: 181 PPPKG--DPSAPLQALIIDSWFDNYVGVVMLVRIVNGVLKPKDKILLMASHATHLCEQIG 238

Query: 248 ILTPKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVVFCG 307
           + TPK      L  GE+G +IA IKE+ H +VGDTIT    P    LPGFK ++P VF G
Sbjct: 239 VFTPKSQPRPELSAGEVGFVIAGIKELEHAKVGDTITLAGKPAAEPLPGFKEVKPQVFAG 298

Query: 308 LFPVDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERLERE 367
           L+PV++++++ LR ++ KL+LNDA+  FE E S ALGFGFRCGFLGLLH+EI+QERLERE
Sbjct: 299 LYPVESSEYDQLRDSLEKLKLNDAALMFEPEVSQALGFGFRCGFLGLLHMEIVQERLERE 358

Query: 368 FSLNLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEYLGSI 427
           F +++I T+PSVVYE+   DG++  + +P  MPE+ KIA++REP ++VT+  P EY+G +
Sbjct: 359 FDMDIITTAPSVVYEVEQRDGTVVTIESPSRMPEIAKIADIREPIVKVTLFMPQEYVGPV 418

Query: 428 LKLCQERRGIQIDMSHLDNRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDYRDS 487
           + LC  +RG+Q++MS+   +  + YE+PL E++ DF+D+LKSVS+GYAS DY  ++YR +
Sbjct: 419 MTLCNNKRGVQLNMSYHGRQVHLTYEIPLAEIVLDFFDKLKSVSRGYASMDYEFVEYRSA 478

Query: 488 DLVKLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGGRIIA 547
           D+VK+ +L+N + +DAL+++ HR+ +  R R +  +++ LIP+QMF +AIQAAIG  +IA
Sbjct: 479 DVVKVDLLINGDRVDALAMIAHRNNARYRAREVVSRMRGLIPRQMFDVAIQAAIGAEVIA 538

Query: 548 RETVKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISILKTDNE 606
           RE VKA RK+V AKCYGGDI+RK+KLLEKQK GKKRM++ G V+IPQ AF++IL+ +++
Sbjct: 539 RENVKALRKNVLAKCYGGDISRKKKLLEKQKAGKKRMKQVGSVEIPQEAFLAILQVEDK 597


>gi|32265600|ref|NP_859632.1| GTP-binding protein LepA [Helicobacter hepaticus ATCC 51449]
 gi|46396331|sp|Q7VJZ1|LEPA_HELHP RecName: Full=Elongation factor 4; Short=EF-4; AltName:
           Full=Ribosomal back-translocase LepA
 gi|32261648|gb|AAP76698.1| membrane GTPase LepA [Helicobacter hepaticus ATCC 51449]
          Length = 604

 Score =  738 bits (1906), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 349/606 (57%), Positives = 468/606 (77%), Gaps = 5/606 (0%)

Query: 1   MQKKPTPLSRIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGIT 60
           M+    P   IRNFSI+AHIDHGKSTLADR IQ C  ++EREM++Q++D MDIE+ERGIT
Sbjct: 1   MKALIVPQEYIRNFSIIAHIDHGKSTLADRLIQECGAVSEREMTAQIMDTMDIEKERGIT 60

Query: 61  IKAQTVRLNYTSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTL 120
           IKAQ+VRLNY     + Y LNLIDTPGHVDF+YEVSRSLS+CEG+LLVVDA+QGVEAQT+
Sbjct: 61  IKAQSVRLNY-PYKGQTYTLNLIDTPGHVDFSYEVSRSLSSCEGALLVVDASQGVEAQTI 119

Query: 121 ANVYQAIDNNHEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLL 180
           ANVY A++NN EI+ V+NK DLP+ADP RV + IE TIG+   D L VSAK+GEGI  LL
Sbjct: 120 ANVYIAMENNLEILPVINKIDLPAADPLRVAEDIESTIGLDCTDVLQVSAKSGEGIKNLL 179

Query: 181 ERIVQQLPSPTSPEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAK 240
           ERI++ +P+P+  E  NAP KAL+ DSW+++YLG + LVR++NG L  GQ +++M +  K
Sbjct: 180 ERIIECIPAPSGDE--NAPTKALIYDSWFDNYLGALALVRLVNGTLRVGQEVQVMSSGKK 237

Query: 241 YQVERIGILTP-KMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKP 299
           Y+V  +    P + I  + +  GEIG++   +K V+   VGDTITD  +PT   + GF+P
Sbjct: 238 YEVLALYYPHPVQKILTQTIGCGEIGIISLGLKSVTEMAVGDTITDSKNPTKVPVEGFRP 297

Query: 300 IQPVVFCGLFPVDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEI 359
            +P VF G++P++  +FE LR A++KL+LND++ SFE E S ALGFGFR GFLGLLH+E+
Sbjct: 298 AKPFVFAGIYPIETDKFEELREALHKLKLNDSALSFEPETSVALGFGFRVGFLGLLHMEV 357

Query: 360 IQERLEREFSLNLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIIT 419
           ++ERLEREFSLNLI T+P+VVYE+YM DGS   + NP ++PEV KI  + EP+++ +IIT
Sbjct: 358 VKERLEREFSLNLIATAPTVVYEVYMTDGSKVLVQNPSELPEVQKIESIYEPYVRASIIT 417

Query: 420 PNEYLGSILKLCQERRGIQIDMSHLD-NRAMIVYELPLNEVIFDFYDRLKSVSKGYASFD 478
           P+EY+G+I+ L   RRG+Q  M +L+ +R M+ Y LP NE++ DFYD+LKS +KGYASFD
Sbjct: 418 PSEYVGNIITLLSNRRGVQEKMEYLNQSRVMLTYALPSNEIVMDFYDKLKSCTKGYASFD 477

Query: 479 YNVIDYRDSDLVKLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQ 538
           Y  I+YR  DLV+L I V  E +DALSI+V +S S ++GR + E +K ++P+Q+F++AIQ
Sbjct: 478 YEPIEYRQGDLVRLDIRVAGEIVDALSIIVDKSKSYEKGRALVESMKEIVPRQLFEVAIQ 537

Query: 539 AAIGGRIIARETVKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFI 598
           A++G ++IARE +K+  K+VTAKCYGGDITRKRKLLEKQKEGKKRM+  G+V++PQ AF+
Sbjct: 538 ASVGNKVIARENIKSMGKNVTAKCYGGDITRKRKLLEKQKEGKKRMKAIGKVELPQEAFL 597

Query: 599 SILKTD 604
           +ILK D
Sbjct: 598 AILKID 603


>gi|323141877|ref|ZP_08076738.1| GTP-binding protein LepA [Phascolarctobacterium sp. YIT 12067]
 gi|322413624|gb|EFY04482.1| GTP-binding protein LepA [Phascolarctobacterium sp. YIT 12067]
          Length = 599

 Score =  738 bits (1906), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 344/597 (57%), Positives = 467/597 (78%), Gaps = 3/597 (0%)

Query: 9   SRIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVRL 68
           + IRNFSI+AHIDHGKSTLADR I++   L++REM  Q+LD+MD+ERERGITIKAQ VR 
Sbjct: 5   NHIRNFSIIAHIDHGKSTLADRLIEYTGTLSKREMEEQILDSMDLERERGITIKAQAVRS 64

Query: 69  NYTSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQAID 128
            Y + + ++Y LN IDTPGHVDFTYEVSR+L+ACEG+LLV+DATQG+EAQTLANVY A+D
Sbjct: 65  IYKARNGEEYMLNFIDTPGHVDFTYEVSRALAACEGALLVIDATQGIEAQTLANVYLALD 124

Query: 129 NNHEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERIVQQLP 188
           N+ EII V+NK DLPSADP+ VK++IE+ IGI   DA+L SAKTG GI  +LE IV ++P
Sbjct: 125 NDLEIIPVINKIDLPSADPEHVKREIEDVIGIDASDAVLCSAKTGIGIEDVLEAIVARVP 184

Query: 189 SPTSPEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVERIGI 248
           +P     A APLKAL+ DS +++Y GV++ +RI+ G+L KG  IR+M T A++ V  +G 
Sbjct: 185 APQG--DAEAPLKALVFDSKFDAYKGVVLYIRIMQGRLRKGMKIRMMATGAEFDVTEVGY 242

Query: 249 LTPKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVVFCGL 308
             P +++++ L  G++G   ASIK V   RVGDT+TD  +P   ALPG++   P+V+CGL
Sbjct: 243 FKPGLVNVDELEEGQVGFFAASIKNVKDARVGDTVTDADNPAEKALPGYRKATPMVYCGL 302

Query: 309 FPVDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERLEREF 368
           +PV+ + ++NLR A+ KL+LNDAS  FE E STALGFGFRCGFLGLLH+++I+ERLERE+
Sbjct: 303 YPVENSDYDNLRDALEKLQLNDASLVFEPETSTALGFGFRCGFLGLLHMDVIKERLEREY 362

Query: 369 SLNLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEYLGSIL 428
           +L+LI T+P+V+YE++  +G ++ + NP   P+ T I  + EP++  TII P +Y+G+++
Sbjct: 363 NLSLITTAPNVIYEVFRTNGDVEMVDNPSLFPDPTVIDHVEEPFVNATIIVPKDYVGAVM 422

Query: 429 KLCQERRGIQIDMSHLDN-RAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDYRDS 487
           +L QE+RG   +M++LD+ R MI Y LPL+E+IFD++DRLKS ++GYAS DY +  YR S
Sbjct: 423 ELSQEKRGEYDNMTYLDDTRVMIHYALPLSEIIFDYFDRLKSATRGYASLDYELSGYRYS 482

Query: 488 DLVKLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGGRIIA 547
           DLVK+ IL+N E +DALS +VH+  +  RGR + EKL++LIP+QMF+I +QAAIG ++IA
Sbjct: 483 DLVKVDILLNGEPVDALSAIVHKEFATVRGRQLVEKLRSLIPRQMFEIPVQAAIGNKVIA 542

Query: 548 RETVKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISILKTD 604
           RE V+A RKDV AKCYGGDI+RKRKLLEKQKEGKKRM++ G V++PQ AF++ILK D
Sbjct: 543 RENVRAMRKDVLAKCYGGDISRKRKLLEKQKEGKKRMKQVGSVELPQEAFMAILKMD 599


>gi|26988164|ref|NP_743589.1| GTP-binding protein LepA [Pseudomonas putida KT2440]
 gi|33112360|sp|Q88MY7|LEPA_PSEPK RecName: Full=Elongation factor 4; Short=EF-4; AltName:
           Full=Ribosomal back-translocase LepA
 gi|24982898|gb|AAN67053.1|AE016334_2 GTP-binding protein LepA [Pseudomonas putida KT2440]
 gi|313500341|gb|ADR61707.1| LepA [Pseudomonas putida BIRD-1]
          Length = 599

 Score =  738 bits (1906), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 346/599 (57%), Positives = 458/599 (76%), Gaps = 4/599 (0%)

Query: 8   LSRIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVR 67
           LS IRNFSI+AHIDHGKSTLADRFIQ C GL+ REM +QVLD+MD+ERERGITIKA +V 
Sbjct: 4   LSHIRNFSIIAHIDHGKSTLADRFIQMCGGLSAREMEAQVLDSMDLERERGITIKAHSVT 63

Query: 68  LNYTSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQAI 127
           L+Y + D K YQLN IDTPGHVDFTYEVSRSL+ACEG+LLVVDA QGVEAQ++AN Y AI
Sbjct: 64  LHYKAQDGKTYQLNFIDTPGHVDFTYEVSRSLAACEGALLVVDAGQGVEAQSVANCYTAI 123

Query: 128 DNNHEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERIVQQL 187
           +   E++ VLNK DLP ADPDRVK +IE+ IGI   DA+  SAK+G G+  +LER+V  +
Sbjct: 124 EQGLEVMPVLNKMDLPQADPDRVKDEIEKIIGIDATDAVACSAKSGMGVDEVLERLVHTI 183

Query: 188 PSPTSPEGA-NAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVERI 246
           P+P   EG  +APL+AL+IDSW+++YLGV+ LVR+  G++ KG  I +  T   + V+ +
Sbjct: 184 PAP---EGEIDAPLQALIIDSWFDNYLGVVSLVRVRQGRVKKGDKILVKSTGKVHLVDSV 240

Query: 247 GILTPKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVVFC 306
           G+ TPK      L  GE+G +IASIK++    VGDT+T  S+P    LPGFK IQP V+ 
Sbjct: 241 GVFTPKHTQTADLKAGEVGFIIASIKDIHGAPVGDTLTLSSTPEVEVLPGFKKIQPQVYA 300

Query: 307 GLFPVDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERLER 366
           GLFPV +  FE+ R A+ KL LND+S  +  E+S ALGFGFRCGFLG+LH+EIIQERLER
Sbjct: 301 GLFPVSSDDFEDFRDALQKLTLNDSSLQYMPESSDALGFGFRCGFLGMLHMEIIQERLER 360

Query: 367 EFSLNLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEYLGS 426
           E+ L+LI T+PSV+YEL +  G    + NP  +P+V+ +A+ REP +  TI+ P E+LG+
Sbjct: 361 EYDLDLITTAPSVIYELELKTGETIVVDNPSKLPDVSAVADFREPIVTATILVPQEHLGN 420

Query: 427 ILKLCQERRGIQIDMSHLDNRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDYRD 486
           ++ LC E+RG+Q DM  L ++  + Y++P+NEV+ DF+DRLKS S+GYAS DY+   Y+ 
Sbjct: 421 VITLCIEKRGVQRDMQFLGSQVQVRYDMPMNEVVLDFFDRLKSTSRGYASLDYHFDRYQS 480

Query: 487 SDLVKLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGGRII 546
           ++LVKL +L+N + +DAL+++VHR  +  +GR + EK+K LIP+QMF +AIQAAIGG+II
Sbjct: 481 ANLVKLDVLINGDKVDALALIVHRDNAAYKGRALTEKMKELIPRQMFDVAIQAAIGGQII 540

Query: 547 ARETVKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISILKTDN 605
           AR TVKA RK+V AKCYGGD++RK+KLLEKQK GKKRM++ G V+IPQ AF+++L+ D+
Sbjct: 541 ARTTVKALRKNVLAKCYGGDVSRKKKLLEKQKAGKKRMKQVGNVEIPQEAFLAVLRLDS 599


>gi|329906619|ref|ZP_08274465.1| Translation elongation factor LepA [Oxalobacteraceae bacterium
           IMCC9480]
 gi|327547205|gb|EGF32063.1| Translation elongation factor LepA [Oxalobacteraceae bacterium
           IMCC9480]
          Length = 597

 Score =  738 bits (1905), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 341/599 (56%), Positives = 458/599 (76%), Gaps = 2/599 (0%)

Query: 8   LSRIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVR 67
           ++ IRNFSI+AHIDHGKSTLADR IQ C GL++REM +QVLD+MDIERERGITIKAQT  
Sbjct: 1   MNNIRNFSIIAHIDHGKSTLADRIIQLCGGLSDREMEAQVLDSMDIERERGITIKAQTAA 60

Query: 68  LNYTSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQAI 127
           L+Y + D K Y LNLIDTPGHVDF+YEVSRSLSACEG+LLVVDA+QGVEAQT+AN Y A+
Sbjct: 61  LSYKARDGKVYNLNLIDTPGHVDFSYEVSRSLSACEGALLVVDASQGVEAQTVANCYTAL 120

Query: 128 DNNHEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERIVQQL 187
           D   E++ VLNK DLPSADPD    +IEE IGI   +A+  SAK+G G+  +LE ++ ++
Sbjct: 121 DLGVEVVPVLNKIDLPSADPDNAIAEIEEVIGIDASEAVHCSAKSGLGVQDVLESLIVKV 180

Query: 188 PSPTSPEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVERIG 247
           P P      +APL+ALL+DSW+++Y+GV++LVR+ NG L     I LM   + +  E +G
Sbjct: 181 PPPKG--DPDAPLQALLVDSWFDNYVGVVMLVRVFNGTLRAKDKILLMANGSVHLTESVG 238

Query: 248 ILTPKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVVFCG 307
           + TPK +  E +  G++G +IA IKE+   +VGDTIT  S P    LPGFK +QP VF G
Sbjct: 239 VFTPKSVTRETISAGQVGFIIAGIKELKAAKVGDTITLASRPAAEPLPGFKEVQPQVFAG 298

Query: 308 LFPVDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERLERE 367
           LFPV+A Q++ LR ++ KL+LNDA+  +E E S ALGFGFRCGFLGLLH+EI+QERLERE
Sbjct: 299 LFPVEANQYDALRDSLEKLKLNDAALQYEPEVSQALGFGFRCGFLGLLHMEIVQERLERE 358

Query: 368 FSLNLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEYLGSI 427
           F ++LI T+P+V+YE+ + DG++  + NP  MP+ ++I E+REP + V +  P EY+G++
Sbjct: 359 FDMDLITTAPTVIYEVVLRDGTLLMVDNPSKMPDPSRIEEVREPIVTVNLYMPQEYVGAV 418

Query: 428 LKLCQERRGIQIDMSHLDNRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDYRDS 487
           + LC  +RG+QIDM++   +  + YE+P+ E++ DF+D+LKS S+GYAS DY   +YR +
Sbjct: 419 ITLCTGKRGMQIDMNYHGKQVKLTYEMPMAEIVLDFFDKLKSTSRGYASMDYEFKEYRSA 478

Query: 488 DLVKLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGGRIIA 547
           D+VK+ +L+N+E +DAL+I+VHRS S  RGR +  K++ LIP+QMF +AIQAAIG  II+
Sbjct: 479 DVVKVDMLINSEKVDALAIIVHRSNSNYRGRAVAAKMRELIPRQMFDVAIQAAIGANIIS 538

Query: 548 RETVKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISILKTDNE 606
           RE VKA RK+V AKCYGGDI+RKRKLLEKQK GKKRM++ G V+IPQ AF++IL+ D++
Sbjct: 539 RENVKALRKNVLAKCYGGDISRKRKLLEKQKAGKKRMKQVGSVEIPQEAFLAILQVDDK 597


>gi|325275446|ref|ZP_08141377.1| GTP-binding protein LepA [Pseudomonas sp. TJI-51]
 gi|324099422|gb|EGB97337.1| GTP-binding protein LepA [Pseudomonas sp. TJI-51]
          Length = 596

 Score =  738 bits (1905), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 344/598 (57%), Positives = 456/598 (76%), Gaps = 2/598 (0%)

Query: 8   LSRIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVR 67
           +S IRNFSI+AHIDHGKSTLADRFIQ C GLT REM +QVLD+MD+ERERGITIKA +V 
Sbjct: 1   MSHIRNFSIIAHIDHGKSTLADRFIQMCGGLTAREMEAQVLDSMDLERERGITIKAHSVT 60

Query: 68  LNYTSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQAI 127
           L+Y + D K YQLN IDTPGHVDFTYEVSRSL+ACEG+LLVVDA QGVEAQ++AN Y AI
Sbjct: 61  LHYKAQDGKIYQLNFIDTPGHVDFTYEVSRSLAACEGALLVVDAGQGVEAQSVANCYTAI 120

Query: 128 DNNHEIITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERIVQQL 187
           +   E++ VLNK DLP ADPDRVK +IE+ IGI   DA+  SAK+G G+  +LER+V  +
Sbjct: 121 EQGLEVMPVLNKMDLPQADPDRVKDEIEKIIGIDATDAVACSAKSGMGVDEVLERLVHSI 180

Query: 188 PSPTSPEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVERIG 247
           P+P      +APL+AL+IDSW+++YLGV+ LVR+  G++ KG  I +  T   + V+ +G
Sbjct: 181 PAPVGE--IDAPLQALIIDSWFDNYLGVVSLVRVRQGRVKKGDKILVKSTGKVHLVDSVG 238

Query: 248 ILTPKMIDIEALYPGEIGVMIASIKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVVFCG 307
           + TPK      L  GE+G +IASIK++    VGDT+T  S+P    LPGFK IQP V+ G
Sbjct: 239 VFTPKHTQTADLKAGEVGFIIASIKDIHGAPVGDTLTLSSTPEVEVLPGFKKIQPQVYAG 298

Query: 308 LFPVDATQFENLRTAINKLRLNDASFSFELENSTALGFGFRCGFLGLLHLEIIQERLERE 367
           LFPV +  FE+ R A+ KL LND+S  +  E+S ALGFGFRCGFLG+LH+EIIQERLERE
Sbjct: 299 LFPVSSDDFEDFRDALQKLTLNDSSLQYMPESSDALGFGFRCGFLGMLHMEIIQERLERE 358

Query: 368 FSLNLIGTSPSVVYELYMHDGSMQKLSNPIDMPEVTKIAELREPWIQVTIITPNEYLGSI 427
           + L+LI T+PSV+YEL +  G    + NP  +P+V+ +A+ REP +  TI+ P E+LG++
Sbjct: 359 YDLDLITTAPSVIYELELKTGETIVVDNPSKLPDVSAVADFREPIVTATILVPQEHLGNV 418

Query: 428 LKLCQERRGIQIDMSHLDNRAMIVYELPLNEVIFDFYDRLKSVSKGYASFDYNVIDYRDS 487
           + LC E+RG+Q DM  L ++  + Y++P+NEV+ DF+DRLKS S+GYAS DY+   Y+ +
Sbjct: 419 ITLCIEKRGVQRDMQFLGSQVQVRYDMPMNEVVLDFFDRLKSTSRGYASLDYHFDRYQSA 478

Query: 488 DLVKLTILVNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGGRIIA 547
           +LVKL +L+N + +DAL+++VHR  +  +GR + EK+K LIP+QMF +AIQAAIGG+IIA
Sbjct: 479 NLVKLDVLINGDKVDALALIVHRDNAAYKGRALTEKMKELIPRQMFDVAIQAAIGGQIIA 538

Query: 548 RETVKARRKDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISILKTDN 605
           R TVKA RK+V AKCYGGD++RK+KLLEKQK GKKRM++ G V+IPQ AF+++L+ D+
Sbjct: 539 RTTVKALRKNVLAKCYGGDVSRKKKLLEKQKAGKKRMKQVGNVEIPQEAFLAVLRLDS 596


>gi|283850976|ref|ZP_06368261.1| GTP-binding protein LepA [Desulfovibrio sp. FW1012B]
 gi|283573622|gb|EFC