RPSBLAST alignment for GI: 254780321 and conserved domain: TIGR00484

>gnl|CDD|129575 TIGR00484, EF-G, translation elongation factor EF-G. After peptide bond formation, this elongation factor of bacteria and organelles catalyzes the translocation of the tRNA-mRNA complex, with its attached nascent polypeptide chain, from the A-site to the P-site of the ribosome. Every completed bacterial genome has at least one copy, but some species have additional EF-G-like proteins. The closest homolog to canonical (e.g. E. coli) EF-G in the spirochetes clusters as if it is derived from mitochondrial forms, while a more distant second copy is also present. Synechocystis PCC6803 has a few proteins more closely related to EF-G than to any other characterized protein. Two of these resemble E. coli EF-G more closely than does the best match from the spirochetes; it may be that both function as authentic EF-G. Length = 689
 Score = 70.2 bits (172), Expect = 2e-12
 Identities = 58/234 (24%), Positives = 97/234 (41%), Gaps = 33/234 (14%)

Query: 169 SAKTGEGIPLLLERIVQQLPSPTSPEGANA-----------------PLKALLIDSWYNS 211
           SA   +G+ LLL+ +V  LPSPT                        P  AL      + 
Sbjct: 260 SAFKNKGVQLLLDAVVDYLPSPTDVPAIKGIDPDTEKEIERKASDDEPFSALAFKVATDP 319

Query: 212 YLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVERI-GILTPKMIDIEALYPGEIGVMIAS 270
           ++G +  VR+ +G L  G  ++    N K +V R+  +      +I+ +  G+I   I  
Sbjct: 320 FVGQLTFVRVYSGVLKSGSYVKNSRKNKKERVGRLVKMHANNREEIKEVRAGDICAAIG- 378

Query: 271 IKEVSHTRVGDTITDDSSPTTSALPGFKPIQPVVFCGLFPVDATQFENLRTAINKLRLND 330
           +K+ +    GDT+ D        L   +  +PV+   + P      E +  A+ KL   D
Sbjct: 379 LKDTT---TGDTLCDPKIDVI--LERMEFPEPVISLAVEPKTKADQEKMGIALGKLAEED 433

Query: 331 ASF---SFELENSTALGFGFRCGFLGLLHLEIIQERLEREFSLNLIGTSPSVVY 381
            +F   +      T +        +G LHL+II +R++REF +     +P V Y
Sbjct: 434 PTFRTFTDPETGQTIIAG------MGELHLDIIVDRMKREFKVEANVGAPQVAY 481