RPSBLAST alignment for GI: 254780321 and conserved domain: TIGR00484

>gnl|CDD|129575 TIGR00484, EF-G, translation elongation factor EF-G. After peptide bond formation, this elongation factor of bacteria and organelles catalyzes the translocation of the tRNA-mRNA complex, with its attached nascent polypeptide chain, from the A-site to the P-site of the ribosome. Every completed bacterial genome has at least one copy, but some species have additional EF-G-like proteins. The closest homolog to canonical (e.g. E. coli) EF-G in the spirochetes clusters as if it is derived from mitochondrial forms, while a more distant second copy is also present. Synechocystis PCC6803 has a few proteins more closely related to EF-G than to any other characterized protein. Two of these resemble E. coli EF-G more closely than does the best match from the spirochetes; it may be that both function as authentic EF-G. Length = 689
 Score = 46.7 bits (111), Expect = 2e-05
 Identities = 38/129 (29%), Positives = 59/129 (45%), Gaps = 16/129 (12%)

Query: 360 IQERLEREFSLNLIGTSPSVVYELYMHDGSMQ---------KLSNPIDMPEVTKIAE--L 408
           +QE +E      L G  P V  +  + DGS           KL+  +   E  K A   L
Sbjct: 543 LQEAMESG---PLAGY-PVVDIKATLFDGSYHDVDSSEMAFKLAASLAFKEAGKKANPVL 598

Query: 409 REPWIQVTIITPNEYLGSILKLCQERRGIQIDMSHLDNRAMIVYELPLNEVIFDFYDRLK 468
            EP ++V +  P EY+G ++     RRGI   M    N   I  E+PL+E +F +   L+
Sbjct: 599 LEPIMKVEVEVPEEYMGDVMGDLSSRRGIIEGMEARGNVQKIKAEVPLSE-MFGYATDLR 657

Query: 469 SVSKGYASF 477
           S ++G  ++
Sbjct: 658 SFTQGRGTY 666