RPSBLAST alignment for GI: 254780321 and conserved domain: TIGR00485

>gnl|CDD|129576 TIGR00485, EF-Tu, translation elongation factor TU. This alignment models orthologs of translation elongation factor EF-Tu in bacteria, mitochondria, and chloroplasts, one of several GTP-binding translation factors found by the more general pfam model GTP_EFTU. The eukaryotic conterpart, eukaryotic translation elongation factor 1 (eEF-1 alpha), is excluded from this model. EF-Tu is one of the most abundant proteins in bacteria, as well as one of the most highly conserved, and in a number of species the gene is duplicated with identical function. When bound to GTP, EF-Tu can form a complex with any (correctly) aminoacylated tRNA except those for initiation and for selenocysteine, in which case EF-Tu is replaced by other factors. Transfer RNA is carried to the ribosome in these complexes for protein translation. Length = 394
 Score = 57.5 bits (139), Expect = 1e-08
 Identities = 42/133 (31%), Positives = 61/133 (45%), Gaps = 9/133 (6%)

Query: 13  NFSIVAHIDHGKSTL--ADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVRLNY 70
           N   + H+DHGK+TL  A   +    G        Q+ DN   E+ RGITI    V    
Sbjct: 14  NIGTIGHVDHGKTTLTAAITTVLAKEGGAAARAYDQI-DNAPEEKARGITINTAHVEY-- 70

Query: 71  TSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQAID-N 129
             T+ + Y    +D PGH D+   +    +  +G++LVV AT G   QT  ++  A    
Sbjct: 71  -ETENRHYA--HVDCPGHADYVKNMITGAAQMDGAILVVSATDGPMPQTREHILLARQVG 127

Query: 130 NHEIITVLNKADL 142
              I+  LNK D+
Sbjct: 128 VPYIVVFLNKCDM 140