RPSBLAST alignment for GI: 254780321 and conserved domain: cd00881

>gnl|CDD|133257 cd00881, GTP_translation_factor, GTP translation factor family. This family consists primarily of translation initiation, elongation, and release factors, which play specific roles in protein translation. In addition, the family includes Snu114p, a component of the U5 small nuclear riboprotein particle which is a component of the spliceosome and is involved in excision of introns, TetM, a tetracycline resistance gene that protects the ribosome from tetracycline binding, and the unusual subfamily CysN/ATPS, which has an unrelated function (ATP sulfurylase) acquired through lateral transfer of the EF1-alpha gene and development of a new function. Length = 189
 Score =  161 bits (410), Expect = 4e-40
 Identities = 71/194 (36%), Positives = 102/194 (52%), Gaps = 21/194 (10%)

Query: 13  NFSIVAHIDHGKSTLADRFIQHCRGLTER-EMSSQVLDNMDIERERGITIKAQTVRLNYT 71
           N  I  H+DHGK+TL +R +     +     +    LD +  ERERGITIK+      + 
Sbjct: 1   NVGIAGHVDHGKTTLTERLLYVTGDIERDGTVEETFLDVLKEERERGITIKSGVATFEW- 59

Query: 72  STDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQAIDNNH 131
                D ++N IDTPGH DF+ EV R LS  +G++LVVDA +GV+ QT  ++  A +   
Sbjct: 60  ----PDRRVNFIDTPGHEDFSSEVIRGLSVSDGAILVVDANEGVQPQTREHLRIAREGGL 115

Query: 132 EIITVLNKADLPS-ADPDRVKKQIEETIG-----ISTEDA---------LLVSAKTGEGI 176
            II  +NK D     D + V ++I+E +G      + E+          +  SA TG G+
Sbjct: 116 PIIVAINKIDRVGEEDLEEVLREIKELLGLIGFISTKEEGTRNGLLVPIVPGSALTGIGV 175

Query: 177 PLLLERIVQQLPSP 190
             LLE IV+ LP P
Sbjct: 176 EELLEAIVEHLPPP 189