RPSBLAST alignment for GI: 254780321 and conserved domain: cd01883

>gnl|CDD|133283 cd01883, EF1_alpha, Eukaryotic elongation factor 1 (EF1) alpha subfamily. EF1 is responsible for the GTP-dependent binding of aminoacyl-tRNAs to the ribosomes. EF1 is composed of four subunits: the alpha chain which binds GTP and aminoacyl-tRNAs, the gamma chain that probably plays a role in anchoring the complex to other cellular components and the beta and delta (or beta') chains. This subfamily is the alpha subunit, and represents the counterpart of bacterial EF-Tu for the archaea (aEF1-alpha) and eukaryotes (eEF1-alpha). eEF1-alpha interacts with the actin of the eukaryotic cytoskeleton and may thereby play a role in cellular transformation and apoptosis. EF-Tu can have no such role in bacteria. In humans, the isoform eEF1A2 is overexpressed in 2/3 of breast cancers and has been identified as a putative oncogene. This subfamily also includes Hbs1, a G protein known to be important for efficient growth and protein synthesis under conditions of limiting translation initiation in yeast, and to associate with Dom34. It has been speculated that yeast Hbs1 and Dom34 proteins may function as part of a complex with a role in gene expression. Length = 219
 Score = 70.6 bits (174), Expect = 1e-12
 Identities = 51/202 (25%), Positives = 85/202 (42%), Gaps = 47/202 (23%)

Query: 13  NFSIVAHIDHGKSTLADRFIQHCRGLTEREMS----------------SQVLDNMDIERE 56
           N  ++ H+D GKST     +    G+ +R +                 + VLD +  ERE
Sbjct: 1   NLVVIGHVDAGKSTTTGHLLYLLGGVDKRTIEKYEKEAKEMGKGSFKYAWVLDTLKEERE 60

Query: 57  RGITIKAQTVRLNYTSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQG-- 114
           RG+TI    V L    T+   +   ++D PGH DF   +    S  + ++LVVDA +G  
Sbjct: 61  RGVTI---DVGLAKFETEKYRF--TILDAPGHRDFVPNMITGASQADVAVLVVDARKGEF 115

Query: 115 -----VEAQT-----LANVYQAIDNNHEIITVLNKADLPSA--DPDR---VKKQIEE--- 156
                   QT     LA     +    ++I  +NK D  +     +R   +KK++     
Sbjct: 116 EAGFEKGGQTREHALLAR-TLGVK---QLIVAVNKMDDVTVNWSEERYDEIKKELSPFLK 171

Query: 157 TIGISTEDALLV--SAKTGEGI 176
            +G + +D   +  S  TG+ +
Sbjct: 172 KVGYNPKDVPFIPISGLTGDNL 193