RPSBLAST alignment for GI: 254780321 and conserved domain: cd01886

>gnl|CDD|133286 cd01886, EF-G, Elongation factor G (EF-G) subfamily. Translocation is mediated by EF-G (also called translocase). The structure of EF-G closely resembles that of the complex between EF-Tu and tRNA. This is an example of molecular mimicry; a protein domain evolved so that it mimics the shape of a tRNA molecule. EF-G in the GTP form binds to the ribosome, primarily through the interaction of its EF-Tu-like domain with the 50S subunit. The binding of EF-G to the ribosome in this manner stimulates the GTPase activity of EF-G. On GTP hydrolysis, EF-G undergoes a conformational change that forces its arm deeper into the A site on the 30S subunit. To accommodate this domain, the peptidyl-tRNA in the A site moves to the P site, carrying the mRNA and the deacylated tRNA with it. The ribosome may be prepared for these rearrangements by the initial binding of EF-G as well. The dissociation of EF-G leaves the ribosome ready to accept the next aminoacyl-tRNA into the A site. This group contains both eukaryotic and bacterial members. Length = 270
 Score =  130 bits (329), Expect = 1e-30
 Identities = 64/150 (42%), Positives = 87/150 (58%), Gaps = 14/150 (9%)

Query: 13  NFSIVAHIDHGKSTLADRFIQHCRGLTER--EMSS--QVLDNMDIERERGITIKAQTVRL 68
           N  I+AHID GK+T  +R I +  G   +  E+      +D M+ ERERGITI++     
Sbjct: 1   NIGIIAHIDAGKTTTTER-ILYYTGRIHKIGEVHGGGATMDFMEQERERGITIQSAA--- 56

Query: 69  NYTSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQAID 128
             T+   KD+++N+IDTPGHVDFT EV RSL   +G++ V DA  GVE QT     QA  
Sbjct: 57  --TTCFWKDHRINIIDTPGHVDFTIEVERSLRVLDGAVAVFDAVAGVEPQTETVWRQA-- 112

Query: 129 NNHEI--ITVLNKADLPSADPDRVKKQIEE 156
           + + +  I  +NK D   AD  RV +QI E
Sbjct: 113 DRYNVPRIAFVNKMDRTGADFFRVVEQIRE 142