RPSBLAST alignment for GI: 254780321 and conserved domain: cd01898

>gnl|CDD|133298 cd01898, Obg, Obg subfamily. The Obg nucleotide binding protein subfamily has been implicated in stress response, chromosome partitioning, replication initiation, mycelium development, and sporulation. Obg proteins are among a large group of GTP binding proteins conserved from bacteria to humans. The E. coli homolog, ObgE is believed to function in ribosomal biogenesis. Members of the subfamily contain two equally and highly conserved domains, a C-terminal GTP binding domain and an N-terminal glycine-rich domain. Length = 170
 Score = 40.5 bits (96), Expect = 0.001
 Identities = 17/55 (30%), Positives = 27/55 (49%), Gaps = 1/55 (1%)

Query: 133 IITVLNKADLPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLLLERIVQQL 187
            I VLNK DL   + +  +   E    +  +    +SA TGEG+  LL ++ + L
Sbjct: 117 RIVVLNKIDLLDEE-ELFELLKELLKELWGKPVFPISALTGEGLDELLRKLAELL 170