RPSBLAST alignment for GI: 254780321 and conserved domain: cd04163

>gnl|CDD|133363 cd04163, Era, Era subfamily. Era (E. coli Ras-like protein) is a multifunctional GTPase found in all bacteria except some eubacteria. It binds to the 16S ribosomal RNA (rRNA) of the 30S subunit and appears to play a role in the assembly of the 30S subunit, possibly by chaperoning the 16S rRNA. It also contacts several assembly elements of the 30S subunit. Era couples cell growth with cytokinesis and plays a role in cell division and energy metabolism. Homologs have also been found in eukaryotes. Era contains two domains: the N-terminal GTPase domain and a C-terminal domain KH domain that is critical for RNA binding. Both domains are important for Era function. Era is functionally able to compensate for deletion of RbfA, a cold-shock adaptation protein that is required for efficient processing of the 16S rRNA. Length = 168
 Score = 54.4 bits (132), Expect = 9e-08
 Identities = 39/141 (27%), Positives = 59/141 (41%), Gaps = 21/141 (14%)

Query: 62  KAQTVRLN----YTSTDAKDYQLNLIDTPG-----HVDFTYEVSRSLSACEGS---LLVV 109
           K QT R      YT     D Q+  +DTPG            V  + SA +     L VV
Sbjct: 34  KPQTTRNRIRGIYTD---DDAQIIFVDTPGIHKPKKKLGERMVKAAWSALKDVDLVLFVV 90

Query: 110 DATQGV--EAQTLANVYQAIDNNHEIITVLNKADLPSADPDRVKKQIEE-TIGISTEDAL 166
           DA++ +    + +  + +       +I VLNK DL   D + +   +E+        +  
Sbjct: 91  DASEPIGEGDEFILELLKKSKTP--VILVLNKIDL-VKDKEDLLPLLEKLKELGPFAEIF 147

Query: 167 LVSAKTGEGIPLLLERIVQQL 187
            +SA  GE +  LLE IV+ L
Sbjct: 148 PISALKGENVDELLEEIVKYL 168