RPSBLAST alignment for GI: 254780321 and conserved domain: pfam06421

>gnl|CDD|148181 pfam06421, LepA_C, GTP-binding protein LepA C-terminus. This family consists of the C-terminal region of several pro- and eukaryotic GTP-binding LepA proteins. Length = 108
 Score =  200 bits (511), Expect = 8e-52
 Identities = 70/108 (64%), Positives = 89/108 (82%)

Query: 496 VNNETIDALSILVHRSVSEKRGRGICEKLKNLIPQQMFQIAIQAAIGGRIIARETVKARR 555
           +N + +DALS +VHR  +  RGR + EKLK LIP+Q F+I IQAAIG +IIARET+KA R
Sbjct: 1   INGKPVDALSFIVHRDKAYNRGRELVEKLKELIPRQQFEIPIQAAIGSKIIARETIKALR 60

Query: 556 KDVTAKCYGGDITRKRKLLEKQKEGKKRMRRFGRVDIPQSAFISILKT 603
           K+V AKCYGGDI+RK+KLLEKQKEGKKRM++ G V+IPQ AF+++LK 
Sbjct: 61  KNVLAKCYGGDISRKKKLLEKQKEGKKRMKQVGNVEIPQEAFLAVLKL 108