RPSBLAST alignment for GI: 254780321 and conserved domain: PLN00043

>gnl|CDD|165621 PLN00043, PLN00043, elongation factor 1-alpha; Provisional. Length = 447
 Score = 59.3 bits (143), Expect = 3e-09
 Identities = 78/325 (24%), Positives = 130/325 (40%), Gaps = 60/325 (18%)

Query: 13  NFSIVAHIDHGKSTLADRFIQHCRGLTER----------EMSSQ------VLDNMDIERE 56
           N  ++ H+D GKST     I    G+ +R          EM+ +      VLD +  ERE
Sbjct: 9   NIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVLDKLKAERE 68

Query: 57  RGITIKAQTVRLNYTSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQG-- 114
           RGITI     +   T      Y   +ID PGH DF   +    S  + ++L++D+T G  
Sbjct: 69  RGITIDIALWKFETTK-----YYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGF 123

Query: 115 -----VEAQTLANVYQAID-NNHEIITVLNKADLPS-----ADPDRVKKQIE---ETIGI 160
                 + QT  +   A      ++I   NK D  +     A  D + K++    + +G 
Sbjct: 124 EAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGY 183

Query: 161 STEDALLVSAKTGEGI--------------PLLLERIVQQLPSPTSPEGANAPLKALLID 206
           + +    V     EG               P LLE +  Q+  P  P  ++ PL+  L D
Sbjct: 184 NPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEAL-DQINEPKRP--SDKPLRLPLQD 240

Query: 207 SWYNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVERIGILTPKMIDIEALYPGE--- 263
            +    +G + + R+  G +  G  +    T    +V+ + +    +   EAL PG+   
Sbjct: 241 VYKIGGIGTVPVGRVETGVIKPGMVVTFGPTGLTTEVKSVEMHHESL--QEAL-PGDNVG 297

Query: 264 IGVMIASIKEVSHTRVGDTITDDSS 288
             V   ++K++    V     DD +
Sbjct: 298 FNVKNVAVKDLKRGYVASNSKDDPA 322