RPSBLAST alignment for GI: 254780321 and conserved domain: PRK00454

>gnl|CDD|179035 PRK00454, engB, GTP-binding protein YsxC; Reviewed. Length = 196
 Score = 42.4 bits (101), Expect = 3e-04
 Identities = 14/68 (20%), Positives = 31/68 (45%), Gaps = 2/68 (2%)

Query: 122 NVYQAIDNNH-EIITVLNKAD-LPSADPDRVKKQIEETIGISTEDALLVSAKTGEGIPLL 179
            + + +      ++ VL KAD L   +  +  K++ + +    ++ +L S+   +GI  L
Sbjct: 126 QMIEWLKEYGIPVLIVLTKADKLKKGERKKQLKKVRKALKFGDDEVILFSSLKKQGIDEL 185

Query: 180 LERIVQQL 187
              I + L
Sbjct: 186 RAAIAKWL 193