RPSBLAST alignment for GI: 254780321 and conserved domain: PRK05506

>gnl|CDD|180120 PRK05506, PRK05506, bifunctional sulfate adenylyltransferase subunit 1/adenylylsulfate kinase protein; Provisional. Length = 632
 Score = 48.0 bits (115), Expect = 7e-06
 Identities = 35/120 (29%), Positives = 58/120 (48%), Gaps = 27/120 (22%)

Query: 20  IDHGKSTLADRFIQHCRGLTE----------REMSSQ--------VLDNMDIERERGITI 61
           +D GKSTL  R +   + + E          +++ +Q        ++D +  ERE+GITI
Sbjct: 33  VDDGKSTLIGRLLYDSKMIFEDQLAALERDSKKVGTQGDEIDLALLVDGLAAEREQGITI 92

Query: 62  KAQTVRLNYTSTDAKDYQLNLI--DTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQT 119
               V   Y +T  + +    I  DTPGH  +T  +    S  + ++++VDA +GV  QT
Sbjct: 93  D---VAYRYFATPKRKF----IVADTPGHEQYTRNMVTGASTADLAIILVDARKGVLTQT 145