RPSBLAST alignment for GI: 254780321 and conserved domain: PRK07560

>gnl|CDD|181029 PRK07560, PRK07560, elongation factor EF-2; Reviewed. Length = 731
 Score = 45.2 bits (108), Expect = 5e-05
 Identities = 42/169 (24%), Positives = 81/169 (47%), Gaps = 21/169 (12%)

Query: 220 RIINGQLTKGQSIRLMGTNAKYQVERIGI-LTPKMIDIEALYPGEIGVMIASIKEVSHTR 278
           R+ +G L KGQ + L+G   K +V+++GI + P+  ++E +  G I   +  +K+    R
Sbjct: 311 RVFSGTLRKGQEVYLVGAKKKNRVQQVGIYMGPEREEVEEIPAGNI-AAVTGLKDA---R 366

Query: 279 VGDTITDDSSPTTSALPGFKPIQ----PVVFCGLFPVDATQFENLRTAINKLRLNDASFS 334
            G+T+          +  F+ ++    PVV   +   +      L   + +L   D +  
Sbjct: 367 AGETVVSVED-----MTPFESLKHISEPVVTVAIEAKNPKDLPKLIEVLRQLAKEDPTLV 421

Query: 335 FELENSTA--LGFGFRCGFLGLLHLEIIQERLEREFSLNLIGTSPSVVY 381
            ++   T   L  G     +G LHLE+I  R++R++ + ++ + P VVY
Sbjct: 422 VKINEETGEHLLSG-----MGELHLEVITYRIKRDYGIEVVTSEPIVVY 465