RPSBLAST alignment for GI: 254780321 and conserved domain: PRK12736

>gnl|CDD|183709 PRK12736, PRK12736, elongation factor Tu; Reviewed. Length = 394
 Score = 55.7 bits (135), Expect = 3e-08
 Identities = 45/140 (32%), Positives = 70/140 (50%), Gaps = 12/140 (8%)

Query: 13  NFSIVAHIDHGKSTL--ADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVRLNY 70
           N   + H+DHGK+TL  A   +   RGL + +    + D    E+ERGITI   T  + Y
Sbjct: 14  NIGTIGHVDHGKTTLTAAITKVLAERGLNQAKDYDSI-DAAPEEKERGITI--NTAHVEY 70

Query: 71  TSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTLANVYQA--ID 128
             T+ + Y    +D PGH D+   +    +  +G++LVV AT G   QT  ++  A  + 
Sbjct: 71  -ETEKRHYA--HVDCPGHADYVKNMITGAAQMDGAILVVAATDGPMPQTREHILLARQVG 127

Query: 129 NNHEIITVLNKADLPSADPD 148
             + ++  LNK DL   D +
Sbjct: 128 VPY-LVVFLNKVDLVD-DEE 145