RPSBLAST alignment for GI: 254780321 and conserved domain: PRK13351

>gnl|CDD|183990 PRK13351, PRK13351, elongation factor G; Reviewed. Length = 687
 Score = 49.6 bits (119), Expect = 2e-06
 Identities = 24/72 (33%), Positives = 39/72 (54%), Gaps = 2/72 (2%)

Query: 407 ELREPWIQVTIITPNEYLGSILKLCQERRGIQIDMSHLDNRAMIVY-ELPLNEVIFDFYD 465
            L EP +++ I  P E++G +L    +RRG         +  ++V  E PL E+ F +  
Sbjct: 596 VLLEPIMELEITVPTEHVGDVLGDLSQRRGRIEGTEPRGDGEVLVKAEAPLAEL-FGYAT 654

Query: 466 RLKSVSKGYASF 477
           RL+S++KG  SF
Sbjct: 655 RLRSMTKGRGSF 666