RPSBLAST alignment for GI: 254780321 and conserved domain: COG0050

>gnl|CDD|30399 COG0050, TufB, GTPases - translation elongation factors [Translation, ribosomal structure and biogenesis]. Length = 394
 Score = 68.0 bits (166), Expect = 6e-12
 Identities = 66/247 (26%), Positives = 106/247 (42%), Gaps = 36/247 (14%)

Query: 13  NFSIVAHIDHGKSTL--ADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVRLNY 70
           N   + H+DHGK+TL  A   +   +G  E +   Q+ DN   E+ RGITI   T  + Y
Sbjct: 14  NVGTIGHVDHGKTTLTAAITTVLAKKGGAEAKAYDQI-DNAPEEKARGITI--NTAHVEY 70

Query: 71  TSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQT-----LANVYQ 125
             T  + Y    +D PGH D+   +    +  +G++LVV AT G   QT     LA    
Sbjct: 71  -ETANRHYAH--VDCPGHADYVKNMITGAAQMDGAILVVAATDGPMPQTREHILLARQVG 127

Query: 126 AIDNNHEIITVLNKADLPSADPDRVK------KQIEETIGISTED----------ALLVS 169
                  I+  LNK D+   D + ++      +++    G   +D          AL   
Sbjct: 128 V----PYIVVFLNKVDMVD-DEELLELVEMEVRELLSEYGFPGDDTPIIRGSALKALEGD 182

Query: 170 AKTGEGIPLLLERIVQQLPSPTSPEGANAPLKALLIDSWYNSYLGVMVLVRIINGQLTKG 229
           AK    I  L++ +   +P+P      + P    + D +  S  G +V  R+  G L  G
Sbjct: 183 AKWEAKIEELMDAVDSYIPTPERDI--DKPFLMPVEDVFSISGRGTVVTGRVERGILKVG 240

Query: 230 QSIRLMG 236
           + + ++G
Sbjct: 241 EEVEIVG 247