RPSBLAST alignment for GI: 254780321 and conserved domain: KOG0465

>gnl|CDD|35686 KOG0465, KOG0465, KOG0465, Mitochondrial elongation factor [Translation, ribosomal structure and biogenesis]. Length = 721
 Score =  126 bits (317), Expect = 2e-29
 Identities = 66/154 (42%), Positives = 91/154 (59%), Gaps = 14/154 (9%)

Query: 7   PLSRIRNFSIVAHIDHGKSTLADR------FIQHCRGLTEREMSSQVLDNMDIERERGIT 60
           PL++IRN  I AHID GK+TL +R       I+H   + E       +D+M++ER+RGIT
Sbjct: 35  PLNKIRNIGISAHIDAGKTTLTERMLYYTGRIKH---IGEVRGGGATMDSMELERQRGIT 91

Query: 61  IKAQTVRLNYTSTDAKDYQLNLIDTPGHVDFTYEVSRSLSACEGSLLVVDATQGVEAQTL 120
           I++       T    +DY++N+IDTPGHVDFT+EV R+L   +G++LV+DA  GVE+QT 
Sbjct: 92  IQSAA-----TYFTWRDYRINIIDTPGHVDFTFEVERALRVLDGAVLVLDAVAGVESQTE 146

Query: 121 ANVYQAIDNNHEIITVLNKADLPSADPDRVKKQI 154
               Q    N   I  +NK D   A P R   QI
Sbjct: 147 TVWRQMKRYNVPRICFINKMDRMGASPFRTLNQI 180