RPSBLAST alignment for GI: 254780321 and conserved domain: cd03691

>gnl|CDD|58082 cd03691, BipA_TypA_II, BipA_TypA_II: domain II of BipA (also called TypA) having homology to domain II of the elongation factors (EFs) EF-G and EF-Tu. BipA is a highly conserved protein with global regulatory properties in Escherichia coli. BipA is phosphorylated on a tyrosine residue under some cellular conditions. Mutants show altered regulation of some pathways. BipA functions as a translation factor that is required specifically for the expression of the transcriptional modulator Fis. BipA binds to ribosomes at a site that coincides with that of EF-G and has a GTPase activity that is sensitive to high GDP:GTP ratios and, is stimulated by 70S ribosomes programmed with mRNA and aminoacylated tRNAs. The growth rate-dependent induction of BipA allows the efficient expression of Fis, thereby modulating a range of downstream processes, including DNA metabolism and type III secretion.. Length = 86
 Score = 44.3 bits (105), Expect = 1e-04
 Identities = 24/81 (29%), Positives = 44/81 (54%), Gaps = 8/81 (9%)

Query: 209 YNSYLGVMVLVRIINGQLTKGQSIRLMGTNAKYQVERIGILTP----KMIDIEALYPGEI 264
           Y+ Y+G + + RI  G +  GQ + ++  + K +  +I  L      K +++E    G+I
Sbjct: 10  YDDYVGRIAIGRIFRGTVKVGQQVAVVKRDGKIEKAKITKLFGFEGLKRVEVEEAEAGDI 69

Query: 265 GVMIASIKEVSHTRVGDTITD 285
            V IA I++++   +GDTI D
Sbjct: 70  -VAIAGIEDIT---IGDTICD 86