RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddB 21,608 sequences; 5,994,473 total letters Searching..................................................done Query= gi|254780323|ref|YP_003064736.1| ATP/ADP translocase [Candidatus Liberibacter asiaticus str. psy62] (491 letters) >gnl|CDD|162032 TIGR00769, AAA, ADP/ATP carrier protein family. These proteins are members of the ATP:ADP Antiporter (AAA) Family (TC 2.A.12), which consists of nucleotide transporters that have 12 GES predicted transmembrane regions. One protein from Rickettsia prowazekii functions to take up ATP from the eukaryotic cell cytoplasm into the bacterium in exchange for ADP. Five AAA family paralogues are encoded within the genome of R. prowazekii. This organism transports UMP and GMP but not CMP, and it seems likely that one or more of the AAA family paralogues are responsible. The genome of Chlamydia trachomatis encodes two AAA family members, Npt1 and Npt2, which catalyse ATP/ADP exchange and GTP, CTP, ATP and UTP uptake probably employing a proton symport mechanism. Two homologous adenylate translocators of Arabidopsis thaliana are postulated to be localized to the intracellular plastid membrane where they function as ATP importers. Length = 472 Score = 475 bits (1225), Expect = e-135 Identities = 220/475 (46%), Positives = 317/475 (66%), Gaps = 14/475 (2%) Query: 21 VKMSEAKKFIPMTLMMFLVLFNFSTLRPIKDSLVV--PHMGAEIISFVKLWCVFPSAILF 78 +++ E KKF+P+ LM F +LFN++ LR KD+LVV GAEII F+K W V P A++F Sbjct: 1 IEVHELKKFLPLFLMFFCILFNYTILRDTKDTLVVTAKGSGAEIIPFLKTWVVVPMAVIF 60 Query: 79 TILYMKLSNILETEKLFYVVVSFFVSFFAIFAFLLYPYRDFLHPSPESIRALASSWPYLK 138 ++Y KLSNIL E LFY V+S F+ FFA+FAF++YP D LHP+ + + L+ P Sbjct: 61 MLIYTKLSNILSKEALFYTVISPFLGFFALFAFVIYPLSDLLHPTALADKLLSLLPPGFM 120 Query: 139 WFIYLAGKWSFALFYVFAELWGAVMINLMFWQFANRITKTEEATRFYATFGLVGNVGLIF 198 FI + WSFALFYV AELWG+V+++L+FW FAN+IT +EA RFYA FGL NV LIF Sbjct: 121 GFIAILRIWSFALFYVMAELWGSVVLSLLFWGFANQITTIDEAKRFYALFGLGANVALIF 180 Query: 199 AGGIVKTFSKLTNEL---------MIYYSMLTLILSSILLMAVYRWMNLYVLTDPQQYSP 249 +G +K FSKL L + M+ +I S + ++ +Y W+N VLTDP+ Y+P Sbjct: 181 SGRTIKYFSKLRASLGPGVDGWHVSLKNLMVIVICSGLAIILLYWWVNRNVLTDPRSYNP 240 Query: 250 KRGSVKKKLKLSVLESLRMALNSKYLGYLVLLVICYGTAINLVEGPWKEKVRQLYPTQNS 309 K K K+S +ESL+ ++S Y+ L LLVI YG +INLVE WK K++ YP+ N Sbjct: 241 ALKEKKVKPKMSTMESLKFLVSSPYILDLALLVIAYGISINLVEVTWKSKLKAQYPSPNE 300 Query: 310 YAQFMGQFIQWTGIVTIVFMILGSNILKSFRWFTSAIITPLMILITGGGFFVFVIFEDAL 369 Y+ FMG F WTG+V++ M+L N+++ + W T+A+ITPL++L+TG FF + F Sbjct: 301 YSAFMGDFSTWTGVVSVTMMLLSGNVIRKYGWLTAALITPLVMLLTGVAFFSLIFFGGPA 360 Query: 370 LPFTEDVIKLVPLALAVFLGSLQNVLSKATKYTMFDSTKEMAFIPLDDEFRTKGKAVVDV 429 P + + PL LAV++G++QN+LSK+TKY++FD+TKEMA+IPLD+E + KGKA +DV Sbjct: 361 APLVA-KLGMTPLLLAVYVGAIQNILSKSTKYSLFDATKEMAYIPLDEEQKVKGKAAIDV 419 Query: 430 IGGRMAKSGGAVIQSFIFMLFPMATFSSIVPYLAVFFLCLMFIWIYVVNQLSKEY 484 + R+ KSGGA+IQ + ++F + ++ PYLAV L ++ W+ L+KE+ Sbjct: 420 VAARLGKSGGALIQQGLLVIFG--SLAASTPYLAVILLIIVTAWLAAAKSLNKEF 472 >gnl|CDD|173189 PRK14726, PRK14726, bifunctional preprotein translocase subunit SecD/SecF; Provisional. Length = 855 Score = 31.6 bits (72), Expect = 0.42 Identities = 21/36 (58%), Positives = 23/36 (63%), Gaps = 6/36 (16%) Query: 438 GGAVIQSFIF-MLFPMA--TFSSI---VPYLAVFFL 467 GG VI+SF F MLF +A TFSSI P L VF L Sbjct: 794 GGEVIRSFTFAMLFGVAVGTFSSIYIAAPVLIVFKL 829 >gnl|CDD|163126 TIGR03074, PQQ_membr_DH, membrane-bound PQQ-dependent dehydrogenase, glucose/quinate/shikimate family. This protein family has a phylogenetic distribution very similar to that coenzyme PQQ biosynthesis enzymes, as shown by partial phylogenetic profiling. Members of this family have several predicted transmembrane helices in the N-terminal region, and include the quinoprotein glucose dehydrogenase (EC 1.1.5.2) of Escherichia coli and the quinate/shikimate dehydrogenase of Acinetobacter sp. ADP1 (EC 1.1.99.25). Sequences closely related except for the absense of the N-terminal hydrophobic region, scoring in the gray zone between the trusted and noise cutoffs, include PQQ-dependent glycerol (EC 1.1.99.22) and and other polyol (sugar alcohol) dehydrogenases. Length = 764 Score = 30.7 bits (70), Expect = 0.83 Identities = 27/137 (19%), Positives = 40/137 (29%), Gaps = 41/137 (29%) Query: 129 ALASSWPYL---------KWFIYL---AGKWSFALFYVFAELWGAVMINLMFWQFANRIT 176 AL SW YL W ++ AG W +A + +W + L FW R+ Sbjct: 4 ALGGSWYYLLAGLALLLSAWLLFRRRPAGLWLYAALLLGTLIWALWEVGLDFWPLIPRL- 62 Query: 177 KTEEATRFYATFGLVGNVGLIFAGGIVKTFSKLTNELMIY-----YSMLTLILSSILLMA 231 GLI G+ + L +L+ +L A Sbjct: 63 ------------------GLIAVLGLWLLLPWVRRPRSRGPARRGAGALAGVLAVAVLAA 104 Query: 232 VYRWMNLYVLTDPQQYS 248 + TDP Sbjct: 105 LASM-----FTDPHPIV 116 >gnl|CDD|162366 TIGR01448, recD_rel, helicase, putative, RecD/TraA family. This model describes a family similar to RecD, the exodeoxyribonuclease V alpha chain of TIGR01447. Members of this family, however, are not found in a context of RecB and RecC and are longer by about 200 amino acids at the amino end. Chlamydia muridarum has both a member of this family and a RecD. Length = 720 Score = 28.6 bits (64), Expect = 4.1 Identities = 10/39 (25%), Positives = 18/39 (46%) Query: 176 TKTEEATRFYATFGLVGNVGLIFAGGIVKTFSKLTNELM 214 ++E Y + + VG A IVKTF + +++ Sbjct: 74 PTSKEGIVAYLSSRSIKGVGKKLAQRIVKTFGEAAFDVL 112 >gnl|CDD|129374 TIGR00273, TIGR00273, iron-sulfur cluster-binding protein. Members of this family have a perfect 4Fe-4S binding motif C-x(2)-C-x(2)-C-x(3)-CP followed by either a perfect or imperfect (the first Cys replaced by Ser) second copy. Members probably bind two 4fe-4S iron-sulfur clusters. Length = 432 Score = 28.3 bits (63), Expect = 4.5 Identities = 17/57 (29%), Positives = 23/57 (40%), Gaps = 10/57 (17%) Query: 374 EDVIK--LVPLALAVFLGSLQNVLSKATKYTMFDSTKEMAFIPLD--------DEFR 420 E V+K L A+ L + NVL+ + D +E I LD EFR Sbjct: 234 ELVLKSMLARSAVGTRLTAYINVLTGPRQEGDVDGPEEFHLILLDNGRSNILATEFR 290 >gnl|CDD|132235 TIGR03191, benz_CoA_bzdO, benzoyl-CoA reductase, bzd-type, O subunit. Members of this family are the O subunit of one of two related types of four-subunit ATP-dependent benzoyl-CoA reductase. This enzyme system catalyzes the dearomatization of benzoyl-CoA, a common intermediate in pathways for the degradation for a number of different aromatic compounds, such as phenol and toluene. Length = 430 Score = 28.0 bits (62), Expect = 5.4 Identities = 24/81 (29%), Positives = 31/81 (38%), Gaps = 18/81 (22%) Query: 125 ESIRALASS---WPYLKWFIYLA--GKWSFALFYVFA----------ELWGAVMINLMFW 169 E R ++ + WP+LK F YL G S Y FA WGA + W Sbjct: 258 ERCRLMSDTQPPWPFLKIFRYLETYGAVSIGSLYTFALEGIWEDKEDGSWGA---RTLPW 314 Query: 170 QFANRITKTEEATRFYATFGL 190 + I A R YA + L Sbjct: 315 EKGIEINDRATALRLYADWNL 335 >gnl|CDD|162104 TIGR00915, 2A0602, The (Largely Gram-negative Bacterial) Hydrophobe/Amphiphile Efflux-1 (HAE1) Family. This family is one of several subfamilies within the scope of pfam model pfam00873. Length = 1044 Score = 27.8 bits (62), Expect = 6.1 Identities = 33/147 (22%), Positives = 52/147 (35%), Gaps = 31/147 (21%) Query: 331 LGSNILKSFRWFTSAIITPLMILITGGGFFVFVIFEDALLPFTED---VIKLVPLALAVF 387 +G + + R+ + +L+ GG ++FV + LP ED + +V L Sbjct: 531 VGKILKRRGRYLL------VYVLLVGGMVWLFVRLPTSFLP-DEDQGVFMTIVQLPAGAT 583 Query: 388 LGSLQNVLSKATKYTMFDSTKE--------------------MAFIPLDD-EFRTKGKAV 426 Q VL++ KY + MAFI L D E RT + Sbjct: 584 AERTQKVLAQVEKYLLAKEKANVESVFTVNGFSFAGRGQNSGMAFIRLKDWEERTGKENS 643 Query: 427 VDVIGGRMAKSGGAVIQSFIFMLFPMA 453 V I GR + + + P A Sbjct: 644 VFAIAGRATGHFSQIKDAMVIAFNPPA 670 >gnl|CDD|185589 PTZ00386, PTZ00386, formyl tetrahydrofolate synthetase; Provisional. Length = 625 Score = 27.5 bits (61), Expect = 7.2 Identities = 12/24 (50%), Positives = 17/24 (70%) Query: 252 GSVKKKLKLSVLESLRMALNSKYL 275 GS + K+KLSVL+ L + N KY+ Sbjct: 48 GSTRAKVKLSVLKRLENSPNGKYV 71 >gnl|CDD|183871 PRK13146, hisH, imidazole glycerol phosphate synthase subunit HisH; Provisional. Length = 209 Score = 27.4 bits (62), Expect = 9.0 Identities = 7/14 (50%), Positives = 9/14 (64%) Query: 46 LRPIKDSLVVPHMG 59 +P +L VPHMG Sbjct: 113 FQPDGPALKVPHMG 126 Database: CddB Posted date: Feb 4, 2011 9:54 PM Number of letters in database: 5,994,473 Number of sequences in database: 21,608 Lambda K H 0.331 0.142 0.436 Gapped Lambda K H 0.267 0.0744 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21608 Number of Hits to DB: 7,968,488 Number of extensions: 531556 Number of successful extensions: 1853 Number of sequences better than 10.0: 1 Number of HSP's gapped: 1838 Number of HSP's successfully gapped: 109 Length of query: 491 Length of database: 5,994,473 Length adjustment: 97 Effective length of query: 394 Effective length of database: 3,898,497 Effective search space: 1536007818 Effective search space used: 1536007818 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.9 bits) S2: 59 (26.5 bits)